3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
b'SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
molecule tags Transport protein, membrane protein
source organism Escherichia coli
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
3RLFF 3PUVG 3DHWA 4YMTB 3PUWG 4XTCN 4KI0F 2R6GF 4YMSC 4YMVC 3PUVF 4YMUC 3PUZF 3TUJA 3PUYG 2R6GG 4XIGM 3PV0F 3D31C 4XIGN 2ONKC 4KHZF 4XTCM 3PUXG 3TUZA 4TQUM 4KHZG 4TQUN 4JBWF 4KI0G 3PUXF 3TUIA 3RLFG 3PUZG 3PUWF 4YMWC 4JBWG 3PUYF 3PV0G
chains in the Genus database with same CATH superfamily
5AFUL 2LSGA 2I59A 3NRXA 5LNKA 3QNUA 1X9BA 4UVBB 2KSRA 2VASA 2ACZA 3HKBE 2V6XA 2V1DB 4DR1T 4JYAT 3LSVA 3ZT5A 4A97A 3QK6A 3DP7A 3RRCA 3IF8B 4IREA 4B6XA 2XSAA 2E5LT 1ZOYA 5JREA 4KHZF 1HCIA 1WLXA 3JC6C 2JQKA 5AQLB 2WWVA 3T8OA 3ZYLA 2CWOA 2Q9QA 3RI5A 3E08A 5JDLA 5LG4A 4K0KT 1VCSA 2NOXA 5L47A 1IBMT 5LJNA 2UXCT 3GN5A 4HFHA 2K24A 3A8YC 3NVOA 2BS2A 4DR3T 3VR8A 4IL4A 1IAPA 2MTQA 4TNVA 5JR9B 2XQYA 5F3JA 2KINB 2X9WA 3KBUA 2D2SA 2JQQA 2XASB 3SFEA 3L3PA 3WAJA 2JQ9A 2LHRA 4TWHA 4H63H 3JC6D 5LXTE 1X79A 1BR2A 2L8KA 2YDRA 1KNRA 4H9PC 4I55E 3U78A 4DV0T 3RRWA 2VQET 3RC8A 3ZKRA 4EZHA 2V7JA 3JAEA 3PJAJ 5CFBA 1D0YA 3PUZF 3AE6A 3N9QA 5DQVA 5HWXA 4AQFA 3HKEE 3N9LA 3CQCB 5IHYA 5J0ZA 4AKHA 3KV6A 4PK4A 2ACXA 1LRZA 2IIUA 4CN4A 3HI2A 3LDQB 4UVAB 2YDSA 4QH1A 4CXXA 4EYYR 4AKIA 1XDOA 3RGLA 3ZYMA 1HR0T 2IC9A 5ABGA 2IUBA 5CGMA 4UEMA 4HN9A 3IBPA 3OYZA 1ZHCA 4YJ3E 3UUBA 3GN5B 3O1JA 1ZEEA 1BR1A 3ZJ1A 4IE5A 2X66A 3N9PA 3NKZA 4QHOA 3A7MA 5C8YE 2OLTA 2V6YA 2WU5A 3S4UA 4DR6T 1N32T 2E2AA 3QUJA 3EI0A 2PBIA 1L0VA 3F57A 2VL8A 3ZT6A 3ONLC 5JRCB 1QSDA 4IDPA 3LG7A 3ZMSB 3PUGA 3PUWG 3AE1A 4IGUA 2MOZA 4HWIB 4WYVA 1FMWA 3P4QA 3CIRA 4BAYB 1E2AA 3PURA 5IUXA 1N36T 4GIWA 4YMVC 4AQYT 3R84B 2X68A 2WP9A 4YTPA 3KVAA 3P4RA 1I6ZA 3AB3B 4ZS3A 3JAFA 5CA0E 4ZI3D 5L3DB 2XSBA 2UU9T 1AJ3A 2UXDT 3EHZA 4ISTA 4A98A 4X66T 2XHEB 4XBFB 4QKNA 2Q9QB 4XTCM 3N9MA 4LF6T 3LK42 1HG2A 3TUZA 2LRLA 2CM0A 1R8IA 4JI3T 2W61A 3OVUA 1UK5A 4BJNA 4JI7T 4AKGA 4O2AE 1WCRA 2XQ3A 1J1JA 3RQWA 1YQ3A 3P4WA 4KI0G 5AQSB 4DUYT 2I0MA 3SS1A 3AE5A 2NWBA 3EVYA 5AQPB 1G73A 3GWHA 3PU8A 2BG9E 1M62A 4QXHB 1IJ6A 2BG9B 5HCJA 2LKHA 2A72A 1W09A 4MLKA 2WWUA 3K3OA 1MMGA 2LSKA 1HNXT 4LF4T 3QB5A 2YU1A 4ASKA 4B3RT 4KI0F 1MNEA 2FUPA 3FHNA 3C4ZA 2C5KT 2NW8A 2W62A 3B5MA 3QC9A 3AAEB 1W9RA 2OV9A 5JDQA 3QOFA 4DR2T 2CEAA 1DU2A 1E7PA 2WQYA 3ZC1A 5LMUT 4IDQA 1OEDA 2BS3A 3UFEA 4LF9T 2MAWA 1S94A 2FJAA 1EZ3A 3PUAA 2M6BA 4HFIA 4U2YA 4KBMB 4UF0B 4WBOA 2EHOB 2H7OA 2RP4A 1VRBA 2E9XA 3PU3A 4GK5E 3PUSA 3RC3A 5J2TE 2DWKA 2E9XB 4U2ZA 2CE7A 3AXJB 4GKKT 2ZM8A 4JI8T 1IBKT 3ZYKA 2BBHA 4ZI7E 2K3WA 3VKHA 4B3ST 4YMWC 3RIUA 4DMVA 3PE0A 5L4EA 1MMAA 2QYWA 5DJQC 5CB4E 5IYZE 4EV6A 2VL0A 3PJAA 3ZMTB 1KNZA 3DHWA 1CUNA 4MFRA 5AQJB 3VU7H 1I94T 2UUCT 4JV5T 2ZMAA 4KP3C 2L9QA 2WDQA 2WY2A 1FEWA 2YK0A 2KZ7B 4JEHB 3PUVF 3E22E 4IDNA 2VK9A 4YSXA 1IZNB 3I0QA 4NIQA 5L3GB 3V5UA 2LEHA 3F2EA 4UF0A 4X1KE 2WCAA 2X9XA 5AQVB 3ZN0B 3ZC0A 2LRKA 4O2BE 3UUMA 1ZKEA 1SA0E 2X0HA 3ZCIA 3AECA 3CQGB 3FZMB 2X0YA 2X51A 2XQ4A 5AQKB 5LBQB 5LOVE 4TQUM 4PAGA 3RYHE 5LP6E 1LVFA 3UQ4A 1U4QA 2KMFA 3UU5A 4TQUN 1NAFA 2E9XC 2V7LA 3K3NA 2WZIA 3C50A 2LOSA 3AAAB 4O4JE 4QWNB 2XAHB 3AEBA 1D1BA 2C0SA 3ETUA 2VURA 4TV9E 4DMWA 3AXJA 5CJ5A 4DUZT 4DV4T 3FZFB 1Z0PA 4DR7T 1FJGT 4ZOLE 5C3JA 4IHJE 1NWMX 1QLBA 2QA7A 3KV4A 4CZZB 2AXDS 3PUVG 2XAGB 4CI3B 4DIDB 4YTNA 5EZYE 5L3EB 1OWAA 1SHZC 1Y64B 2W4XA 5E0OA 2H88A 2JMKA 4HGAA 2V7IA 5AQUB 2MBGA 2A3DA 5BMVE 1KF6A 3VRAA 1XNQT 4UXNB 1T98A 3FBZA 3O4XE 2D5UA 4N78D 4PJJA 3VRBA 2XQ8A 1XMQT 4HWHA 1W0AA 2BBJA 2XQ6A 2D9DA 2PJQA 2YKSA 3FXEB 3KVBA 5AQGB 5HCMA 4EAHA 4X64T 3KBTA 2UUBT 4LMKA 2XZEA 3D0TA 5AQRB 2VB6A 4PK6A 1HNWT 4LF7T 1HS7A 1D0XA 5JDHA 2UXXB 3C98B 3NZQA 3MK7C 2B76A 4TWDA 3DTOA 3KINB 4NUVA 1H7CA 2XUEA 1W0BA 5F8PA 5AQIB 3ABVA 2NW9A 1QUUA 4MBQA 3ZCJA 3MACA 2A2FX 5EK4A 5FXZA 3C4XA 2BG9A 3ZPOA 4IL9A 4DV6T 4FJOA 4UV9B 5DABA 4YMTB 1YXRA 1ZP0A 2CBIA 2CXFA 1LVKA 2X9HA 3M65A 3K3QC 3MXZA 4YMSC 2CLYB 3I0OA 4X5TA 3ZLIA 3AEGA 4UIGA 4ZZBA 3Q5XA 4YSZA 4HFVA 4F8HA 2R6GG 4QX7B 2XPKA 2AE9A 4WZXA 2EHOC 1HG5A 3ONJA 3M3ZB 2B1EA 2N9DA 2CXLA 2K48A 4MHCA 2XM2A 3CX8B 3P4PA 4V1Av 5LGUB 3J7Yq 4TX5A 5JDFA 4L9IA 2X9YA 5FP3A 2LOPA 4P0AA 5EK3A 2V6YB 2GK9A 3TLSA 2W67A 2CHNA 2G0UA 2LM2A 3B13A 3EAMA 3F31A 4OFZA 1YW0A 5HEHA 1WFDA 3RHWA 5L3CB 4LFBT 3N2KE 4TV8E 3T1YT 2XTLA 4OYJA 1MIYA 2WAUA 5JR9A 3OPCA 4DBRA 4JLEA 2D0TA 2VVNA 3UULA 2I6HA 2BG9C 1YKHB 1NEKA 4QH5A 4HKAA 5HXHA 4TNWA 3JCFA 3TUJA 2W0GA 3WI3A 1SE7A 3LBXA 4TUYE 5ABHA 2E9XD 4U31A 1WR0A 3AVRA 1MIVA 4YSYA 2A9UA 2V8SV 5JDMA 4EXTA 5LGTB 3Q2MA 3AA1B 3T1HT 4CI2B 3AEAA 5M4YA 4TWFA 3PUQA 2VWAA 5FVLA 2MPKA 2KT9A 4O4IE 1IJ5A 4YY3T 3TUIA 2XY8B 3WAKA 5LG3A 3BK9A 1OEDE 4HWDA 2WM9A 3CVRA 4QXBB 4X1IE 4C90A 4PJLA 3IHRA 1OEDB 3OJAA 4YHHT 2PTFA 3UU3A 5TAOA 4TN7B 3QB5K 2WB5A 3ZJ2A 2DI4A 2YEVC 3FZKB 4O8SA 3TLWA 3U3IA 5JQGE 3V5SA 5JRCA 2LM9A 4JI4T 4P1NA 3SWHA 5LHIB 5LMNT 4G63A 4Z90A 5JDGA 1HNZT 4B3TT 3CK6A 4CXYA 4ILAA 2W00A 2HPLA 1UURA 4IE0A 4UELA 3L8RA 2X67A 2JRKA 4G2AA 2VKDA 2XM1A 2J4GA 2LT3A 3CMLA 4L0RA 4IE6A 1XWMA 4TZ4C 2M6IA 2KXPB 3ANWA 3C51A 4AQGA 4ZI2C 5JR9C 4X20E 4NXMT 5KMGP 2CRBA 3OKQA 1JNRA 1UGOA 4OK0A 1T8BA 2JQHA 2XAQB 4BA9A 3RPUA 2BDEA 2WU2A 1B7TA 3AE4A 3CQXC 4I4TE 5KXJA 3EUHA 3AE3A 1YD8G 2DL1A 5AQMB 4IIJE 4YFSA 1T7SA 2NR4A 5AQFB 1UUSA 4PFPA 3RX6A 2LHNA 4Z91A 2YOEA 5AQNB 5FYMA 1XDPA 3LFMA 4YHJA 5ETWA 3SFDA 4AKLA 4ZI2D 2L3LA 1CHUA 1JNZA 3RKOA 2PFVA 4GYSA 2J47A 3RIUC 3RYFE 2VKOA 5JDNA 2FJBA 5LGNB 4ADZA 2YINA 4MALA 3RIFA 4B3MT 4X62T 4PJNA 4XAXB 3PV0F 2K9AA 5LCYA 4XIGN 2CCQA 3AE9A 1T72A 2IHR1 3ZSTA 3C64A 1OXZA 4O4LE 4EEBA 4QXCB 4ERRA 4JI5T 4JUYA 1VOMA 3AE7A 4A5XA 3ZEFB 3TLVA 2LE8A 5H6RB 2JMHA 5LYJE 2XQ5A 5AQHB 2IMLA 4UR9A 5C2TA 5LBMA 3ZMVB 2CWYA 2NTXA 3AA6B 3HA4A 4ISSA 3OTOT 4DR5T 4X1YE 2BKPA 4WBNE 2Q9QD 4DBQA 2WDRA 3FB2A 2ONKC 5A1LA 2DWGA 4ZS2A 4PFOA 3PV0G 5HAXA 3E0ZA 2CPTA 2YN6A 4A56A 3UUNA 3UU4A 2ZM6T 2E8IA 3N2GE 4OYKA 4OX9T 1M7KA 2QRXA 2DNXA 3AA0B 4ZI3C 3ZSSA 1N33T 1SUMB 3CWZB 4PNIA 1BR0A 3UUXB 3ETVA 2YDQA 1NENA 3AA7B 3HR0A 4C91A 3NWIA 4H9QC 4HEAA 5FY1A 5FKYA 4ZXLA 1UX5A 4Q25A 5DQWA 5L4HA 1XNRT 2ODUA 2WSSV 4ILCA 3ANWB 5IWAT 5FXXA 2WDVA 3KDSE 3CX7B 5HEOA 5LHHB 4HFBA 4J2CA 3UU6A 1ZV4X 3ESLA 2CMRA 2XQAA 4NPPA 3AE2A 5KX5E 1U5PA 2VKJA 2KWHA 3N9OA 3BQLA 4DVDA 2LJLA 3LJCA 3RLFG 5FXWA 2OA5A 5KDMC 3PUZG 4AI6A 4DV5T 3PUYF 1GQEA 2BVLA 4IDZA 5FY7A 2EHOD 4EYUA 4E7SA 3PTRB 4IE4A 2UUAT 4ZZCA 4Z8XA 4XTCN 4M1PA 3RYCE 3KFWX 5L2LA 4YMUC 2ZM2A 4H63V 4HFCA 3TKLB 5HEJA 5JVDE 4CN1A 4ZHQE 3TLTA 4BJMA 3K1SA 5ABEA 3P7IA 4KMCA 2LLYA 2JPFA 2K5BB 1Z8UA 3DJBA 2V7KA 3ONXA 4O4HE 2NTYA 5AQQB 1D1AA 3I9YA 3ZN1B 1MMDA 3HL6A 5LJMA 3SRZA 5FL1A 3CPZA 3LBXB 3VHLA 3KV9A 4COFA 4KHZG 2IAKA 4JI0T 1UX4A 3EDVA 2SPCA 4JI2T 1MIWA 2H7VC 3N5LA 4IDOA 4U7YA 3K8PC 4IT4A 4U74A 3UQ7A 3SOLA 4DV7T 4ILUA 4E7ZA 3MKDA 3Q5EA 4H9SE 3RLFF 2P9BA 3N2OA 4HWCA 5FXVA 5EK2A 4IE7A 5FVKA 2W66A 2Y48B 4AKRB 1OEDC 3NZPA 3LK3B 2JIWA 2KNDA 4H9OC 2V5CA 5L3FB 4H9NC 2XJ7A 3AEDA 2FBWA 4EGWA 2WZHA 1WYCA 5LB7B 4CI1B 1VCTA 4EZ4A 2CBJA 2VKHA 4AXPA 1E1HB 2F4VT 1YKEB 1KFYA 3AEFA 4DNDA 2NP9A 5HEGA 2QVAA 2YU2A 4X65T 2C5JA 2WBLA 4KHPT 3GA8A 1J5ET 1J5WA 3PUXG 2HN2A 2N2NA 2Q9QC 1KK7A 1MMNA 3EABA 4U72A 2RPAA 5J2UE 3IA3A 4AISA 3PDYA 2DCFA 4GK0E 4KUMB 4KX6A 2KWIB 3OYXA 4U7IA 4I43B 4YTMA 2W63A 4UV8B 4ANJA 3KV5A 3PUXF 3FBLA 4GOUA 1BR4A 5HXCA 4LMJA 3RKGA 3X1DA 1YQ4A 2BZBA 4U33A 5FNVE 2IW5B 1Y01A 2CXDA 1IBLT 2MYSA 4JBWG 1WYBA 3B57A 3NBXX 1HTJF 3O1IA 4H9RC 4HE8A 4P09A 5AQOB 5FL0A 4NXNT 3UTKA 3AEEA 2VVSA 4CXWA 2R6GF 1HFAA 2FJEA 2J1DG 4WW0A 3OBVE 2WS3A 2CA5A 4WNKA 3A5XA 3FZHB 5ADXL 4QH4A 1V9DA 2XQ9A 2V26A 3CKDA 1HX1B 5FMNA 3PUYG 4JEUB 3R6NA 3W15B 1FMVA 4LF5T 4I50E 3D31C 3HKDE 3CX6B 1UCUA 3FXDB 3MA9A 3NRYA 1KNPA 4FI5A 2ZM0A 4P0BA 1HF8A 3I9WA 3O1HA 5HYAA 2HH7A 2Z6EA 5HEUA 3ZT7A 2WMNA 4YLHA 3ZMZB 1G8XA 3O9XA 5L3BB 4XZCA 1HX8A 4HTEA 1XMOT 4JBWF 2V5DA 4QX8B 3TLUA 2LSJA 3P4SA 4JI6T 4DR4T 2X0LB 5FY0A 4DV1T 2UXBT 2CLYC 3RH3A 3VKGA 5F5WA 2ODVA 4GYRA 3RYIE 2Y6XA 2HPJA 2XAJB 2Y8DA 2IC6A 2JJ9A 4YT0A 2PG8A 4LFCT 3LK2B 3Q5DA 3I1AA 1FIOA 2LKGA 2ZLYA 1MNDA 5HXRA 4LMLA 4AQFC 2VQFT 2H89A 5BR8T 3HKCE 4PW8A 2BS4A 2H3RA 2IDOB 3L39A 3IEEA 4XIGM 3N9NA 4LFAT 3BQIA 3Q5WA 4UVCB 5JH7E 2HHHT 1O3XA 3H37A 5ABFB 4DV3T 5HXEA 2W2UA 4L5GA 2DLRA 2M67A 4PJMA 5J1GA 3UU8A 4EB6E 3AE8A 4EEDA 5GONE 1N34T 2LSYA 5JTGA 4CN6A 3RQUA 3FZLB 5AQTB 5HXSA 4EIWA 2DHRA 2N1GA 4EOZB 2UXNB 2KLQA 3JADA 4HWFA 1D0ZA 1WR6A 2XAFB 3EDUA 2CHOA 2V7MA 4K0UA 5ABFA 2BKOA 1S35A 2LSIA 2QGSA 1XZYA 2RA1A 1KEYA 2HN1A 3MZKB 4CQIA 3C4WA 4U3CA 3ZMUB 3Q9DA 3MJXA 4LF8T 2NW7A 3VR9A 3BQKA 4GKJT 4DO0A 2E5VA 3J9X1 1D1CA 2WMOA 1WRDA 4HFDA 1US7B 2EHOA 3H3MA 5LA6E 4DV2T 4I0UA 4JI1T 3P50A 4PK5A 3AAIA 3RF1A 2BVMA 3UT5E 3AVSA 5H6QB 2ES0A 3UFGA 5HWYA 5LHGB 3RIAA 2BKNA 3H3AA 3P8CD 4ZEYA 4AIUA 4OHFA 4F6RC 2D0UA 2XQ7A 4NUUA 1LKXA 4YXDA 3G06A 3L09A 3PUWF 4ILBA 3GMIA 4YJ2E 5CA1E 4HFEA 2J62A 2C5IT 2FJDA
chains in the Genus database with same CATH topology
3RLFF 3PUVG 3DHWA 4YMTB 3PUWG 4XTCN 4KI0F 2R6GF 4YMSC 4YMVC 3PUVF 4YMUC 3PUZF 3TUJA 3PUYG 2R6GG 4XIGM 3PV0F 3D31C 4XIGN 2ONKC 4KHZF 4XTCM 3PUXG 3TUZA 4TQUM 4KHZG 4TQUN 4JBWF 4KI0G 3PUXF 3TUIA 3RLFG 3PUZG 3PUWF 4YMWC 4JBWG 3PUYF 3PV0G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLF F;  3PUV G;  3DHW A;  4YMT B;  3PUW G;  4XTC N;  4KI0 F;  2R6G F;  4YMS C;  4YMV C;  3PUV F;  4YMU C;  3PUZ F;  3TUJ A;  3PUY G;  2R6G G;  4XIG M;  3PV0 F;  3D31 C;  4XIG N;  2ONK C;  4KHZ F;  4XTC M;  3PUX G;  3TUZ A;  4TQU M;  4KHZ G;  4TQU N;  4JBW F;  4KI0 G;  3PUX F;  3TUI A;  3RLF G;  3PUZ G;  3PUW F;  4YMW C;  4JBW G;  3PUY F;  3PV0 G; 
#chains in the Genus database with same CATH topology
 5AFU L;  2LSG A;  2I59 A;  3NRX A;  5LNK A;  3QNU A;  1X9B A;  4UVB B;  2KSR A;  2VAS A;  2ACZ A;  3HKB E;  2V6X A;  2V1D B;  4DR1 T;  4JYA T;  3LSV A;  3ZT5 A;  4A97 A;  3QK6 A;  3DP7 A;  3RRC A;  3IF8 B;  4IRE A;  4B6X A;  2XSA A;  2E5L T;  1ZOY A;  5JRE A;  4KHZ F;  1HCI A;  1WLX A;  3JC6 C;  2JQK A;  5AQL B;  2WWV A;  3T8O A;  3ZYL A;  2CWO A;  2Q9Q A;  3RI5 A;  3E08 A;  5JDL A;  5LG4 A;  4K0K T;  1VCS A;  2NOX A;  5L47 A;  1IBM T;  5LJN A;  2UXC T;  3GN5 A;  4HFH A;  2K24 A;  3A8Y C;  3NVO A;  2BS2 A;  4DR3 T;  3VR8 A;  4IL4 A;  1IAP A;  2MTQ A;  4TNV A;  5JR9 B;  2XQY A;  5F3J A;  2KIN B;  2X9W A;  3KBU A;  2D2S A;  2JQQ A;  2XAS B;  3SFE A;  3L3P A;  3WAJ A;  2JQ9 A;  2LHR A;  4TWH A;  4H63 H;  3JC6 D;  5LXT E;  1X79 A;  1BR2 A;  2L8K A;  2YDR A;  1KNR A;  4H9P C;  4I55 E;  3U78 A;  4DV0 T;  3RRW A;  2VQE T;  3RC8 A;  3ZKR A;  4EZH A;  2V7J A;  3JAE A;  3PJA J;  5CFB A;  1D0Y A;  3PUZ F;  3AE6 A;  3N9Q A;  5DQV A;  5HWX A;  4AQF A;  3HKE E;  3N9L A;  3CQC B;  5IHY A;  5J0Z A;  4AKH A;  3KV6 A;  4PK4 A;  2ACX A;  1LRZ A;  2IIU A;  4CN4 A;  3HI2 A;  3LDQ B;  4UVA B;  2YDS A;  4QH1 A;  4CXX A;  4EYY R;  4AKI A;  1XDO A;  3RGL A;  3ZYM A;  1HR0 T;  2IC9 A;  5ABG A;  2IUB A;  5CGM A;  4UEM A;  4HN9 A;  3IBP A;  3OYZ A;  1ZHC A;  4YJ3 E;  3UUB A;  3GN5 B;  3O1J A;  1ZEE A;  1BR1 A;  3ZJ1 A;  4IE5 A;  2X66 A;  3N9P A;  3NKZ A;  4QHO A;  3A7M A;  5C8Y E;  2OLT A;  2V6Y A;  2WU5 A;  3S4U A;  4DR6 T;  1N32 T;  2E2A A;  3QUJ A;  3EI0 A;  2PBI A;  1L0V A;  3F57 A;  2VL8 A;  3ZT6 A;  3ONL C;  5JRC B;  1QSD A;  4IDP A;  3LG7 A;  3ZMS B;  3PUG A;  3PUW G;  3AE1 A;  4IGU A;  2MOZ A;  4HWI B;  4WYV A;  1FMW A;  3P4Q A;  3CIR A;  4BAY B;  1E2A A;  3PUR A;  5IUX A;  1N36 T;  4GIW A;  4YMV C;  4AQY T;  3R84 B;  2X68 A;  2WP9 A;  4YTP A;  3KVA A;  3P4R A;  1I6Z A;  3AB3 B;  4ZS3 A;  3JAF A;  5CA0 E;  4ZI3 D;  5L3D B;  2XSB A;  2UU9 T;  1AJ3 A;  2UXD T;  3EHZ A;  4IST A;  4A98 A;  4X66 T;  2XHE B;  4XBF B;  4QKN A;  2Q9Q B;  4XTC M;  3N9M A;  4LF6 T;  3LK4 2;  1HG2 A;  3TUZ A;  2LRL A;  2CM0 A;  1R8I A;  4JI3 T;  2W61 A;  3OVU A;  1UK5 A;  4BJN A;  4JI7 T;  4AKG A;  4O2A E;  1WCR A;  2XQ3 A;  1J1J A;  3RQW A;  1YQ3 A;  3P4W A;  4KI0 G;  5AQS B;  4DUY T;  2I0M A;  3SS1 A;  3AE5 A;  2NWB A;  3EVY A;  5AQP B;  1G73 A;  3GWH A;  3PU8 A;  2BG9 E;  1M62 A;  4QXH B;  1IJ6 A;  2BG9 B;  5HCJ A;  2LKH A;  2A72 A;  1W09 A;  4MLK A;  2WWU A;  3K3O A;  1MMG A;  2LSK A;  1HNX T;  4LF4 T;  3QB5 A;  2YU1 A;  4ASK A;  4B3R T;  4KI0 F;  1MNE A;  2FUP A;  3FHN A;  3C4Z A;  2C5K T;  2NW8 A;  2W62 A;  3B5M A;  3QC9 A;  3AAE B;  1W9R A;  2OV9 A;  5JDQ A;  3QOF A;  4DR2 T;  2CEA A;  1DU2 A;  1E7P A;  2WQY A;  3ZC1 A;  5LMU T;  4IDQ A;  1OED A;  2BS3 A;  3UFE A;  4LF9 T;  2MAW A;  1S94 A;  2FJA A;  1EZ3 A;  3PUA A;  2M6B A;  4HFI A;  4U2Y A;  4KBM B;  4UF0 B;  4WBO A;  2EHO B;  2H7O A;  2RP4 A;  1VRB A;  2E9X A;  3PU3 A;  4GK5 E;  3PUS A;  3RC3 A;  5J2T E;  2DWK A;  2E9X B;  4U2Z A;  2CE7 A;  3AXJ B;  4GKK T;  2ZM8 A;  4JI8 T;  1IBK T;  3ZYK A;  2BBH A;  4ZI7 E;  2K3W A;  3VKH A;  4B3S T;  4YMW C;  3RIU A;  4DMV A;  3PE0 A;  5L4E A;  1MMA A;  2QYW A;  5DJQ C;  5CB4 E;  5IYZ E;  4EV6 A;  2VL0 A;  3PJA A;  3ZMT B;  1KNZ A;  3DHW A;  1CUN A;  4MFR A;  5AQJ B;  3VU7 H;  1I94 T;  2UUC T;  4JV5 T;  2ZMA A;  4KP3 C;  2L9Q A;  2WDQ A;  2WY2 A;  1FEW A;  2YK0 A;  2KZ7 B;  4JEH B;  3PUV F;  3E22 E;  4IDN A;  2VK9 A;  4YSX A;  1IZN B;  3I0Q A;  4NIQ A;  5L3G B;  3V5U A;  2LEH A;  3F2E A;  4UF0 A;  4X1K E;  2WCA A;  2X9X A;  5AQV B;  3ZN0 B;  3ZC0 A;  2LRK A;  4O2B E;  3UUM A;  1ZKE A;  1SA0 E;  2X0H A;  3ZCI A;  3AEC A;  3CQG B;  3FZM B;  2X0Y A;  2X51 A;  2XQ4 A;  5AQK B;  5LBQ B;  5LOV E;  4TQU M;  4PAG A;  3RYH E;  5LP6 E;  1LVF A;  3UQ4 A;  1U4Q A;  2KMF A;  3UU5 A;  4TQU N;  1NAF A;  2E9X C;  2V7L A;  3K3N A;  2WZI A;  3C50 A;  2LOS A;  3AAA B;  4O4J E;  4QWN B;  2XAH B;  3AEB A;  1D1B A;  2C0S A;  3ETU A;  2VUR A;  4TV9 E;  4DMW A;  3AXJ A;  5CJ5 A;  4DUZ T;  4DV4 T;  3FZF B;  1Z0P A;  4DR7 T;  1FJG T;  4ZOL E;  5C3J A;  4IHJ E;  1NWM X;  1QLB A;  2QA7 A;  3KV4 A;  4CZZ B;  2AXD S;  3PUV G;  2XAG B;  4CI3 B;  4DID B;  4YTN A;  5EZY E;  5L3E B;  1OWA A;  1SHZ C;  1Y64 B;  2W4X A;  5E0O A;  2H88 A;  2JMK A;  4HGA A;  2V7I A;  5AQU B;  2MBG A;  2A3D A;  5BMV E;  1KF6 A;  3VRA A;  1XNQ T;  4UXN B;  1T98 A;  3FBZ A;  3O4X E;  2D5U A;  4N78 D;  4PJJ A;  3VRB A;  2XQ8 A;  1XMQ T;  4HWH A;  1W0A A;  2BBJ A;  2XQ6 A;  2D9D A;  2PJQ A;  2YKS A;  3FXE B;  3KVB A;  5AQG B;  5HCM A;  4EAH A;  4X64 T;  3KBT A;  2UUB T;  4LMK A;  2XZE A;  3D0T A;  5AQR B;  2VB6 A;  4PK6 A;  1HNW T;  4LF7 T;  1HS7 A;  1D0X A;  5JDH A;  2UXX B;  3C98 B;  3NZQ A;  3MK7 C;  2B76 A;  4TWD A;  3DTO A;  3KIN B;  4NUV A;  1H7C A;  2XUE A;  1W0B A;  5F8P A;  5AQI B;  3ABV A;  2NW9 A;  1QUU A;  4MBQ A;  3ZCJ A;  3MAC A;  2A2F X;  5EK4 A;  5FXZ A;  3C4X A;  2BG9 A;  3ZPO A;  4IL9 A;  4DV6 T;  4FJO A;  4UV9 B;  5DAB A;  4YMT B;  1YXR A;  1ZP0 A;  2CBI A;  2CXF A;  1LVK A;  2X9H A;  3M65 A;  3K3Q C;  3MXZ A;  4YMS C;  2CLY B;  3I0O A;  4X5T A;  3ZLI A;  3AEG A;  4UIG A;  4ZZB A;  3Q5X A;  4YSZ A;  4HFV A;  4F8H A;  2R6G G;  4QX7 B;  2XPK A;  2AE9 A;  4WZX A;  2EHO C;  1HG5 A;  3ONJ A;  3M3Z B;  2B1E A;  2N9D A;  2CXL A;  2K48 A;  4MHC A;  2XM2 A;  3CX8 B;  3P4P A;  4V1A v;  5LGU B;  3J7Y q;  4TX5 A;  5JDF A;  4L9I A;  2X9Y A;  5FP3 A;  2LOP A;  4P0A A;  5EK3 A;  2V6Y B;  2GK9 A;  3TLS A;  2W67 A;  2CHN A;  2G0U A;  2LM2 A;  3B13 A;  3EAM A;  3F31 A;  4OFZ A;  1YW0 A;  5HEH A;  1WFD A;  3RHW A;  5L3C B;  4LFB T;  3N2K E;  4TV8 E;  3T1Y T;  2XTL A;  4OYJ A;  1MIY A;  2WAU A;  5JR9 A;  3OPC A;  4DBR A;  4JLE A;  2D0T A;  2VVN A;  3UUL A;  2I6H A;  2BG9 C;  1YKH B;  1NEK A;  4QH5 A;  4HKA A;  5HXH A;  4TNW A;  3JCF A;  3TUJ A;  2W0G A;  3WI3 A;  1SE7 A;  3LBX A;  4TUY E;  5ABH A;  2E9X D;  4U31 A;  1WR0 A;  3AVR A;  1MIV A;  4YSY A;  2A9U A;  2V8S V;  5JDM A;  4EXT A;  5LGT B;  3Q2M A;  3AA1 B;  3T1H T;  4CI2 B;  3AEA A;  5M4Y A;  4TWF A;  3PUQ A;  2VWA A;  5FVL A;  2MPK A;  2KT9 A;  4O4I E;  1IJ5 A;  4YY3 T;  3TUI A;  2XY8 B;  3WAK A;  5LG3 A;  3BK9 A;  1OED E;  4HWD A;  2WM9 A;  3CVR A;  4QXB B;  4X1I E;  4C90 A;  4PJL A;  3IHR A;  1OED B;  3OJA A;  4YHH T;  2PTF A;  3UU3 A;  5TAO A;  4TN7 B;  3QB5 K;  2WB5 A;  3ZJ2 A;  2DI4 A;  2YEV C;  3FZK B;  4O8S A;  3TLW A;  3U3I A;  5JQG E;  3V5S A;  5JRC A;  2LM9 A;  4JI4 T;  4P1N A;  3SWH A;  5LHI B;  5LMN T;  4G63 A;  4Z90 A;  5JDG A;  1HNZ T;  4B3T T;  3CK6 A;  4CXY A;  4ILA A;  2W00 A;  2HPL A;  1UUR A;  4IE0 A;  4UEL A;  3L8R A;  2X67 A;  2JRK A;  4G2A A;  2VKD A;  2XM1 A;  2J4G A;  2LT3 A;  3CML A;  4L0R A;  4IE6 A;  1XWM A;  4TZ4 C;  2M6I A;  2KXP B;  3ANW A;  3C51 A;  4AQG A;  4ZI2 C;  5JR9 C;  4X20 E;  4NXM T;  5KMG P;  2CRB A;  3OKQ A;  1JNR A;  1UGO A;  4OK0 A;  1T8B A;  2JQH A;  2XAQ B;  4BA9 A;  3RPU A;  2BDE A;  2WU2 A;  1B7T A;  3AE4 A;  3CQX C;  4I4T E;  5KXJ A;  3EUH A;  3AE3 A;  1YD8 G;  2DL1 A;  5AQM B;  4IIJ E;  4YFS A;  1T7S A;  2NR4 A;  5AQF B;  1UUS A;  4PFP A;  3RX6 A;  2LHN A;  4Z91 A;  2YOE A;  5AQN B;  5FYM A;  1XDP A;  3LFM A;  4YHJ A;  5ETW A;  3SFD A;  4AKL A;  4ZI2 D;  2L3L A;  1CHU A;  1JNZ A;  3RKO A;  2PFV A;  4GYS A;  2J47 A;  3RIU C;  3RYF E;  2VKO A;  5JDN A;  2FJB A;  5LGN B;  4ADZ A;  2YIN A;  4MAL A;  3RIF A;  4B3M T;  4X62 T;  4PJN A;  4XAX B;  3PV0 F;  2K9A A;  5LCY A;  4XIG N;  2CCQ A;  3AE9 A;  1T72 A;  2IHR 1;  3ZST A;  3C64 A;  1OXZ A;  4O4L E;  4EEB A;  4QXC B;  4ERR A;  4JI5 T;  4JUY A;  1VOM A;  3AE7 A;  4A5X A;  3ZEF B;  3TLV A;  2LE8 A;  5H6R B;  2JMH A;  5LYJ E;  2XQ5 A;  5AQH B;  2IML A;  4UR9 A;  5C2T A;  5LBM A;  3ZMV B;  2CWY A;  2NTX A;  3AA6 B;  3HA4 A;  4ISS A;  3OTO T;  4DR5 T;  4X1Y E;  2BKP A;  4WBN E;  2Q9Q D;  4DBQ A;  2WDR A;  3FB2 A;  2ONK C;  5A1L A;  2DWG A;  4ZS2 A;  4PFO A;  3PV0 G;  5HAX A;  3E0Z A;  2CPT A;  2YN6 A;  4A56 A;  3UUN A;  3UU4 A;  2ZM6 T;  2E8I A;  3N2G E;  4OYK A;  4OX9 T;  1M7K A;  2QRX A;  2DNX A;  3AA0 B;  4ZI3 C;  3ZSS A;  1N33 T;  1SUM B;  3CWZ B;  4PNI A;  1BR0 A;  3UUX B;  3ETV A;  2YDQ A;  1NEN A;  3AA7 B;  3HR0 A;  4C91 A;  3NWI A;  4H9Q C;  4HEA A;  5FY1 A;  5FKY A;  4ZXL A;  1UX5 A;  4Q25 A;  5DQW A;  5L4H A;  1XNR T;  2ODU A;  2WSS V;  4ILC A;  3ANW B;  5IWA T;  5FXX A;  2WDV A;  3KDS E;  3CX7 B;  5HEO A;  5LHH B;  4HFB A;  4J2C A;  3UU6 A;  1ZV4 X;  3ESL A;  2CMR A;  2XQA A;  4NPP A;  3AE2 A;  5KX5 E;  1U5P A;  2VKJ A;  2KWH A;  3N9O A;  3BQL A;  4DVD A;  2LJL A;  3LJC A;  3RLF G;  5FXW A;  2OA5 A;  5KDM C;  3PUZ G;  4AI6 A;  4DV5 T;  3PUY F;  1GQE A;  2BVL A;  4IDZ A;  5FY7 A;  2EHO D;  4EYU A;  4E7S A;  3PTR B;  4IE4 A;  2UUA T;  4ZZC A;  4Z8X A;  4XTC N;  4M1P A;  3RYC E;  3KFW X;  5L2L A;  4YMU C;  2ZM2 A;  4H63 V;  4HFC A;  3TKL B;  5HEJ A;  5JVD E;  4CN1 A;  4ZHQ E;  3TLT A;  4BJM A;  3K1S A;  5ABE A;  3P7I A;  4KMC A;  2LLY A;  2JPF A;  2K5B B;  1Z8U A;  3DJB A;  2V7K A;  3ONX A;  4O4H E;  2NTY A;  5AQQ B;  1D1A A;  3I9Y A;  3ZN1 B;  1MMD A;  3HL6 A;  5LJM A;  3SRZ A;  5FL1 A;  3CPZ A;  3LBX B;  3VHL A;  3KV9 A;  4COF A;  4KHZ G;  2IAK A;  4JI0 T;  1UX4 A;  3EDV A;  2SPC A;  4JI2 T;  1MIW A;  2H7V C;  3N5L A;  4IDO A;  4U7Y A;  3K8P C;  4IT4 A;  4U74 A;  3UQ7 A;  3SOL A;  4DV7 T;  4ILU A;  4E7Z A;  3MKD A;  3Q5E A;  4H9S E;  3RLF F;  2P9B A;  3N2O A;  4HWC A;  5FXV A;  5EK2 A;  4IE7 A;  5FVK A;  2W66 A;  2Y48 B;  4AKR B;  1OED C;  3NZP A;  3LK3 B;  2JIW A;  2KND A;  4H9O C;  2V5C A;  5L3F B;  4H9N C;  2XJ7 A;  3AED A;  2FBW A;  4EGW A;  2WZH A;  1WYC A;  5LB7 B;  4CI1 B;  1VCT A;  4EZ4 A;  2CBJ A;  2VKH A;  4AXP A;  1E1H B;  2F4V T;  1YKE B;  1KFY A;  3AEF A;  4DND A;  2NP9 A;  5HEG A;  2QVA A;  2YU2 A;  4X65 T;  2C5J A;  2WBL A;  4KHP T;  3GA8 A;  1J5E T;  1J5W A;  3PUX G;  2HN2 A;  2N2N A;  2Q9Q C;  1KK7 A;  1MMN A;  3EAB A;  4U72 A;  2RPA A;  5J2U E;  3IA3 A;  4AIS A;  3PDY A;  2DCF A;  4GK0 E;  4KUM B;  4KX6 A;  2KWI B;  3OYX A;  4U7I A;  4I43 B;  4YTM A;  2W63 A;  4UV8 B;  4ANJ A;  3KV5 A;  3PUX F;  3FBL A;  4GOU A;  1BR4 A;  5HXC A;  4LMJ A;  3RKG A;  3X1D A;  1YQ4 A;  2BZB A;  4U33 A;  5FNV E;  2IW5 B;  1Y01 A;  2CXD A;  1IBL T;  2MYS A;  4JBW G;  1WYB A;  3B57 A;  3NBX X;  1HTJ F;  3O1I A;  4H9R C;  4HE8 A;  4P09 A;  5AQO B;  5FL0 A;  4NXN T;  3UTK A;  3AEE A;  2VVS A;  4CXW A;  2R6G F;  1HFA A;  2FJE A;  2J1D G;  4WW0 A;  3OBV E;  2WS3 A;  2CA5 A;  4WNK A;  3A5X A;  3FZH B;  5ADX L;  4QH4 A;  1V9D A;  2XQ9 A;  2V26 A;  3CKD A;  1HX1 B;  5FMN A;  3PUY G;  4JEU B;  3R6N A;  3W15 B;  1FMV A;  4LF5 T;  4I50 E;  3D31 C;  3HKD E;  3CX6 B;  1UCU A;  3FXD B;  3MA9 A;  3NRY A;  1KNP A;  4FI5 A;  2ZM0 A;  4P0B A;  1HF8 A;  3I9W A;  3O1H A;  5HYA A;  2HH7 A;  2Z6E A;  5HEU A;  3ZT7 A;  2WMN A;  4YLH A;  3ZMZ B;  1G8X A;  3O9X A;  5L3B B;  4XZC A;  1HX8 A;  4HTE A;  1XMO T;  4JBW F;  2V5D A;  4QX8 B;  3TLU A;  2LSJ A;  3P4S A;  4JI6 T;  4DR4 T;  2X0L B;  5FY0 A;  4DV1 T;  2UXB T;  2CLY C;  3RH3 A;  3VKG A;  5F5W A;  2ODV A;  4GYR A;  3RYI E;  2Y6X A;  2HPJ A;  2XAJ B;  2Y8D A;  2IC6 A;  2JJ9 A;  4YT0 A;  2PG8 A;  4LFC T;  3LK2 B;  3Q5D A;  3I1A A;  1FIO A;  2LKG A;  2ZLY A;  1MND A;  5HXR A;  4LML A;  4AQF C;  2VQF T;  2H89 A;  5BR8 T;  3HKC E;  4PW8 A;  2BS4 A;  2H3R A;  2IDO B;  3L39 A;  3IEE A;  4XIG M;  3N9N A;  4LFA T;  3BQI A;  3Q5W A;  4UVC B;  5JH7 E;  2HHH T;  1O3X A;  3H37 A;  5ABF B;  4DV3 T;  5HXE A;  2W2U A;  4L5G A;  2DLR A;  2M67 A;  4PJM A;  5J1G A;  3UU8 A;  4EB6 E;  3AE8 A;  4EED A;  5GON E;  1N34 T;  2LSY A;  5JTG A;  4CN6 A;  3RQU A;  3FZL B;  5AQT B;  5HXS A;  4EIW A;  2DHR A;  2N1G A;  4EOZ B;  2UXN B;  2KLQ A;  3JAD A;  4HWF A;  1D0Z A;  1WR6 A;  2XAF B;  3EDU A;  2CHO A;  2V7M A;  4K0U A;  5ABF A;  2BKO A;  1S35 A;  2LSI A;  2QGS A;  1XZY A;  2RA1 A;  1KEY A;  2HN1 A;  3MZK B;  4CQI A;  3C4W A;  4U3C A;  3ZMU B;  3Q9D A;  3MJX A;  4LF8 T;  2NW7 A;  3VR9 A;  3BQK A;  4GKJ T;  4DO0 A;  2E5V A;  3J9X 1;  1D1C A;  2WMO A;  1WRD A;  4HFD A;  1US7 B;  2EHO A;  3H3M A;  5LA6 E;  4DV2 T;  4I0U A;  4JI1 T;  3P50 A;  4PK5 A;  3AAI A;  3RF1 A;  2BVM A;  3UT5 E;  3AVS A;  5H6Q B;  2ES0 A;  3UFG A;  5HWY A;  5LHG B;  3RIA A;  2BKN A;  3H3A A;  3P8C D;  4ZEY A;  4AIU A;  4OHF A;  4F6R C;  2D0U A;  2XQ7 A;  4NUU A;  1LKX A;  4YXD A;  3G06 A;  3L09 A;  3PUW F;  4ILB A;  3GMI A;  4YJ2 E;  5CA1 E;  4HFE A;  2J62 A;  2C5I T;  2FJD A; 
#chains in the Genus database with same CATH homology
 3RLF F;  3PUV G;  3DHW A;  4YMT B;  3PUW G;  4XTC N;  4KI0 F;  2R6G F;  4YMS C;  4YMV C;  3PUV F;  4YMU C;  3PUZ F;  3TUJ A;  3PUY G;  2R6G G;  4XIG M;  3PV0 F;  3D31 C;  4XIG N;  2ONK C;  4KHZ F;  4XTC M;  3PUX G;  3TUZ A;  4TQU M;  4KHZ G;  4TQU N;  4JBW F;  4KI0 G;  3PUX F;  3TUI A;  3RLF G;  3PUZ G;  3PUW F;  4YMW C;  4JBW G;  3PUY F;  3PV0 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...