3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
3PV0F 4TQUM 4TQUN 4YMTB 3PUWG 3PUZF 2R6GF 4YMWC 4KI0G 2R6GG 4YMUC 3PUZG 3RLFF 3PUYF 2ONKC 3TUZA 3PUYG 3RLFG 4JBWF 4KI0F 4KHZF 4YMSC 3PUVF 3PUXG 3TUJA 3PUXF 4XTCM 4XTCN 3PUVG 3PUWF 4KHZG 4XIGM 3DHWA 4XIGN 4JBWG 4YMVC 3TUIA 3PV0G 3D31C
chains in the Genus database with same CATH superfamily
1HX1B 2UUCT 4YTNA 3AA7B 4P0AA 3P4RA 2HH7A 3ONXA 4QKNA 4YLHA 5DABA 5BR8T 5ADXL 2V1DB 4F6RC 4ZZCA 1WR0A 4LF4T 2WU5A 1YXRA 2P9BA 3IA3A 2YOEA 4O4JE 2X51A 4WYVA 4YMWC 3N9MA 2YU1A 3UULA 2JQKA 2HN2A 2N1GA 2MPKA 3NBXX 4IDOA 3AXJB 2V7LA 2LSYA 2NOXA 2HHHT 2IW5B 5FNVE 4K0UA 1HFAA 2LSGA 2LM2A 2V7MA 3ZPOA 5HXEA 5LHHB 3RKGA 4DR4T 2C5IT 3Q5EA 2FJDA 1KEYA 1SHZC 1UK5A 2KT9A 3PUXG 2DCFA 4B3TT 3C4XA 2LRKA 3FBLA 3CQGB 4DV0T 1FJGT 4NIQA 3JADA 3K3QC 3AE6A 4YMVC 3CMLA 3EVYA 5JRCB 2VKHA 4AISA 3PJAA 5FY1A 4L5GA 2DNXA 2DWKA 3NKZA 3VR9A 5HAXA 1X9BA 4HWCA 4G63A 4ILAA 3H37A 3PV0F 3L3PA 4IL4A 2H7OA 1LKXA 5AQPB 3RYFE 4B3MT 2BS4A 3QC9A 4HFIA 3T1HT 1L0VA 1IBKT 2CEAA 2M6BA 4IDZA 1W9RA 5FKYA 3I9WA 4FJOA 2FBWA 3TLWA 3EDUA 3NWIA 4BJMA 4GKJT 4XBFB 2NR4A 3NRXA 2WY2A 2YDSA 4ZXLA 3I0QA 3KVBA 1OEDC 4QH1A 3IF8B 5AQKB 5J2UE 5JDNA 1HS7A 2PTFA 5L2LA 3RYHE 2OV9A 2BDEA 3RYCE 3X1DA 4KI0F 2W62A 1DU2A 4I50E 4OYJA 3TLUA 3OBVE 3FZFB 1WYCA 3A8YC 4U2YA 3DJBA 4WBOA 3RF1A 3UU8A 4YJ2E 4N78D 2ACZA 3AE9A 2LKHA 4HGAA 1T98A 2A9UA 1BR1A 4NUUA 5ABFA 3D31C 1HG2A 3FZMB 3K8PC 3CK6A 1FMVA 4TQUM 2ZM8A 1ZHCA 3ZT7A 3PUSA 4B3RT 2C5KT 3I0OA 1Z8UA 4YXDA 2CWOA 2K3WA 4P0BA 3MZKB 4CZZB 3ANWA 4IREA 2CLYC 2IHR1 4HEAA 2XAQB 2C0SA 2YEVC 1D0YA 2BKNA 4ZI3C 3ZMTB 4ADZA 1OEDE 4F8HA 3HI2A 2Z6EA 4CN1A 2I0MA 5JR9B 3A5XA 5IWAT 2W2UA 4DV3T 4TUYE 5JDGA 3TKLB 3N2KE 2H7VC 2CWYA 2G0UA 2LOSA 3N5LA 4EV6A 2XAGB 2CLYB 4U3CA 4NXMT 1KF6A 2V8SV 5C2TA 3GA8A 4C90A 3P50A 2D0UA 4HFEA 4NUVA 3SS1A 4XTCN 1D0ZA 2XQ9A 3K1SA 2V6XA 2VKOA 4Z8XA 1XDPA 3TUIA 3RKOA 1V9DA 2V7IA 4IL9A 3NZQA 4MFRA 1MNDA 2ACXA 5LOVE 3RIAA 4UV8B 3AEAA 4HFBA 2VL8A 5FL0A 3AVRA 3KBTA 2CE7A 3KV6A 3AE5A 4GK0E 1S94A 2LRLA 2RPAA 3JAEA 4I55E 4JEUB 4ANJA 2ZM0A 4H63V 4PAGA 5L3DB 2E9XC 3MA9A 4DR1T 2DLRA 2EHOA 5CFBA 3C4ZA 2W0GA 3N9OA 3CPZA 1UCUA 3AA6B 4HTEA 4U2ZA 1X79A 5LJNA 5JDQA 2ZM6T 2EHOB 3OKQA 3F31A 4IE7A 2DHRA 5L4EA 4JBWF 3K3OA 1WRDA 5J1GA 4O4LE 2XAHB 4UVAB 3RPUA 4HN9A 2JQQA 3N2GE 4LMKA 4ERRA 3AAIA 4MLKA 3NRYA 4O2AE 4COFA 4JBWG 4AKLA 1IBMT 4LF9T 3HA4A 3ZC0A 4JYAT 2BKOA 5AQUB 4HFHA 3UUNA 3J9X1 3GMIA 1SUMB 2L3LA 3ESLA 1EZ3A 1MIYA 2LSIA 2V7JA 1IJ5A 3EHZA 3AEEA 1CUNA 4MBQA 3P8CD 5HEGA 3NVOA 3P4PA 4V1Av 3U3IA 3ZYMA 4QXBB 3MKDA 5LJMA 4HWDA 4BJNA 1VRBA 2E8IA 1BR2A 2JMKA 3B13A 4EYYR 1XMQT 3PUYF 3ZKRA 1I6ZA 1G8XA 2QA7A 2UU9T 2UUAT 2I59A 2CM0A 2XUEA 3Q5WA 2JQ9A 3E0ZA 4OFZA 3ZLIA 4DMWA 3RLFG 5HWXA 5IYZE 4EAHA 3P4SA 4YSXA 4YSYA 2CBJA 4HFVA 5JTGA 3NZPA 2CXLA 2DL1A 3EUHA 2VURA 3IEEA 3LDQB 3RX6A 3ZT6A 4EB6E 5LCYA 2V6YB 4UXNB 3WAKA 1HR0T 4BAYB 4QHOA 3AE1A 5LMUT 4DV5T 1ZOYA 2XY8B 2XPKA 4JI5T 3VRAA 2JQHA 3LFMA 1W09A 2CBIA 4H9PC 1E1HB 4ZI3D 4QX8B 1KFYA 4EXTA 5LHIB 4ZZBA 4LF6T 5LB7B 5AQIB 5C3JA 5ABFB 4BA9A 4LMJA 2BKPA 2LKGA 3VU7H 2KMFA 5DJQC 3TLTA 3CWZB 1UGOA 4WNKA 3RLFF 3PU3A 4PNIA 1LRZA 2W66A 2V26A 4X5TA 1YW0A 4GYRA 2NTYA 3T8OA 3UFGA 4EZHA 3C51A 4JI7T 2Y8DA 2KSRA 2PJQA 2WP9A 3AAAB 2NTXA 3FB2A 3HL6A 3LK2B 3PUQA 5FP3A 5ETWA 4KP3C 3PJAJ 3OPCA 5JR9A 3RIUC 3OYXA 4EEBA 3BQLA 4EEDA 4GYSA 5JRCA 5JDLA 4ISTA 4Z90A 2BG9E 2WDRA 2ZM2A 5F8PA 2VQET 1ZP0A 2E9XB 3P7IA 1T7SA 4GIWA 4E7ZA 1SA0E 2MAWA 2V5DA 5LA6E 4ZS2A 2YKSA 2E9XD 4CQIA 4AQFA 4JV5T 4LFCT 2DWGA 2XASB 3KINB 4DV7T 3C98B 1ZKEA 2XJ7A 2YU2A 2LEHA 5HCMA 3ABVA 3LK42 3UFEA 2IMLA 4AQFC 3PU8A 2WCAA 2XSAA 5HEOA 1JNRA 2LE8A 4TWHA 2RP4A 5HWYA 4DR3T 4GKKT 3EI0A 2RA1A 1KNZA 2A2FX 2NP9A 2WBLA 4YJ3E 4CI1B 2UXCT 2E5VA 2KNDA 4QWNB 2N2NA 5HYAA 1U5PA 2WMOA 5KXJA 4TV9E 4UEMA 1MMAA 3MACA 4H63H 2CA5A 3L39A 5CA0E 5LNKA 2UXDT 3AEFA 5FMNA 1VCTA 5AQHB 3FZKB 2E2AA 3LG7A 3U78A 2IC6A 3C64A 5DQVA 5AQOB 3DHWA 1B7TA 4LFBT 3VRBA 2VB6A 5JH7E 2D0TA 5FXVA 4I4TE 1UURA 2H88A 4DO0A 2W63A 1BR0A 4H9NC 2XZEA 5KX5E 3P4WA 3W15B 4TQUN 3N9QA 4A5XA 3O4XE 3SOLA 4ASKA 2X0HA 2IC9A 3AE4A 3ETVA 3PUAA 3ETUA 3HKDE 4EYUA 2V7KA 3AA0B 3KFWX 3TLVA 5L3GB 2CCQA 2X68A 3GN5B 4JEHB 1HCIA 2JJ9A 1MNEA 2BG9B 4H9QC 4ILUA 3LK3B 4PK4A 4YHJA 4YTPA 1OWAA 2WWVA 4KBMB 5LBMA 1QSDA 4TNWA 1UUSA 4ZEYA 4ZHQE 4QH4A 3UUBA 2M67A 4PFOA 5HCJA 4QXHB 5F5WA 4CXXA 5LBQB 2LOPA 3SFEA 5FXWA 2WS3A 2D2SA 5LGNB 1YKHB 1XDOA 4X65T 4KX6A 4JI2T 2MOZA 4B6XA 5EK4A 4IE5A 2YN6A 1MIWA 2F4VT 4ZS3A 3VKHA 1JNZA 2Y6XA 4UF0B 3AEDA 4GOUA 5KDMC 3AE2A 2BBHA 1J1JA 5FY7A 5H6RB 1WCRA 3PE0A 3SWHA 3LBXB 1Z0PA 4P1NA 3AEGA 3C4WA 2KINB 4PW8A 4TWDA 3ONLC 4XAXB 3HKBE 3Q5DA 2VKJA 3N2OA 3RIFA 5AQMB 1HTJF 2VK9A 2WSSV 2WWUA 2X9XA 3KV5A 2VL0A 3F57A 2EHOD 2NWBA 3HKEE 3S4UA 3D0TA 4JI8T 2ONKC 2XQ7A 4IDNA 4LMLA 2LJLA 1LVKA 4KMCA 5L3CB 3FXEB 4U7YA 3M65A 2BBJA 3SFDA 1YQ3A 2OA5A 2LSKA 3RRCA 3OTOT 4YMSC 1KNPA 3IBPA 2SPCA 2UXNB 3L8RA 2J1DG 2Q9QC 1M62A 3E08A 3EABA 5LXTE 2VVSA 2HPJA 4NPPA 3KVAA 3BQIA 3UU5A 4XIGM 5FY0A 4ZOLE 3ZMUB 4EGWA 4AIUA 3FZLB 5JREA 1UX4A 4IE0A 2HPLA 2KXPB 1ZV4X 3UT5E 1U4QA 5AQQB 5E0OA 4YSZA 1XNQT 4UELA 2UUBT 3RQWA 2LHRA 3CIRA 3I9YA 3N9NA 2WZHA 2W61A 2BVLA 2QYWA 4DV1T 3QUJA 4DV4T 1Y01A 1HG5A 3IHRA 1MMDA 2WB5A 3DP7A 2AXDS 3BK9A 3F2EA 3HR0A 3JC6C 3ONJA 3RC3A 3VR8A 2H3RA 2QRXA 3QB5A 2A3DA 2WDQA 1FIOA 5LGUB 3JCFA 2FJAA 2XQ5A 2FJBA 5BMVE 2L8KA 4KHPT 4FI5A 2ES0A 2CPTA 2A72A 2M6IA 4X1KE 3PUYG 4DBRA 2KWIB 3M3ZB 2K24A 2YINA 1W0AA 4PK5A 1D1CA 1HNXT 3B5MA 4CI3B 2ODVA 2BG9C 4LF8T 2E9XA 2WU2A 3R84B 3E22E 4DMVA 5EK3A 5CGMA 4XZCA 4QXCB 5JVDE 1WR6A 2X9HA 4IT4A 2XQYA 3P4QA 2WQYA 4ZI7E 1IBLT 4AQGA 4YMTB 3RYIE 2MTQA 5FVLA 2MBGA 4YY3T 5JDHA 2XM1A 1S35A 4DVDA 1E2AA 4H9RC 4KUMB 5FL1A 1N32T 2XQAA 1KNRA 2PFVA 5L3EB 2XAJB 3RHWA 5EK2A 3KV4A 2UXBT 3CKDA 1SE7A 2QGSA 3MJXA 4HFDA 4WW0A 3PDYA 4ISSA 2I6HA 2KZ7B 2ZMAA 2CHOA 5AQLB 4DIDB 4WBNE 2WZIA 4DR6T 2PBIA 3O1JA 2X67A 5AQGB 2L9QA 4UVBB 5ABGA 5L3FB 1YQ4A 2IIUA 4TV8E 3ZEFB 1WYBA 2D5UA 2XQ8A 3PUXF 3A7MA 4TN7B 5AQSB 1OEDB 4H9OC 4DR7T 5LP6E 1J5WA 2XSBA 4I0UA 1NENA 5J0ZA 2J62A 1OEDA 2XQ4A 1VCSA 1NEKA 4C91A 4PJJA 4PFPA 3QK6A 3ZMZB 4U31A 1HNWT 2VASA 1T72A 4IE4A 4G2AA 5JQGE 3ZMSB 2JRKA 2ZLYA 3FZHB 5CA1E 3CQXC 3FBZA 1W0BA 3RIUA 3B57A 5HXHA 4QX7B 4JI4T 4NXNT 5HEHA 2XTLA 1IAPA 3MXZA 4PJMA 2JPFA 2IUBA 2X0LB 4PJLA 3ZSTA 4X66T 2MYSA 5FYMA 2VQFT 2GK9A 4H9SE 4O2BE 3AXJA 4TWFA 1MMGA 1D0XA 1ZEEA 4KHZF 4J2CA 2WM9A 3K3NA 3RC8A 2BVMA 5LYJE 5LHGB 3PUWF 4KHZG 3AEBA 2CHNA 2FJEA 2H89A 2W00A 2AE9A 2Y48B 4HKAA 3ZN1B 2VVNA 2WMNA 2XAFB 1D1BA 3CX6B 4A98A 4ZI2C 4LFAT 1FMWA 3UQ7A 3KDSE 3MK7C 4X1IE 3PTRB 4U33A 2V6YA 1XNRT 3PUZF 3CX8B 3AECA 3UUXB 4DUZT 2CMRA 1N36T 3ZMVB 2Q9QB 2DI4A 3H3AA 2LHNA 2LSJA 3UQ4A 1WLXA 3QNUA 5C8YE 4JI3T 4X64T 3RQUA 2J47A 4KI0G 2R6GG 1BR4A 2Q9QA 3Q2MA 1XZYA 4HE8A 4IDQA 4ILBA 2K48A 2V5CA 4TNVA 4I43B 1IZNB 3OYZA 4EZ4A 4DV6T 3LBXA 3OJAA 4X1YE 5HXCA 1NWMX 3VKGA 5M4YA 4OX9T 1VOMA 4LF7T 2X9WA 2YDQA 2VWAA 4TX5A 3UU6A 3V5SA 2OLTA 4CN6A 4YFSA 4CN4A 3LJCA 2K5BB 3JC6D 3FHNA 1OXZA 2HN1A 3CQCB 4O4IE 4DNDA 3AAEB 1NAFA 2X66A 3UU3A 3ZCIA 4E7SA 1XMOT 4DR2T 4DR5T 4AKGA 5H6QB 3PV0G 2EHOC 2CXDA 1GQEA 2YK0A 1R8IA 4L9IA 5GONE 3R6NA 4OYKA 3CVRA 4QH5A 5HXRA 1AJ3A 1IJ6A 1LVFA 3AA1B 5CB4E 3RI5A 3SRZA 2Q9QD 5LMNT 3T1YT 3AE3A 2IDOB 4JI6T 1T8BA 5L4HA 5F3JA 4OK0A 5FXZA 5HXSA 2W4XA 5TAOA 1WFDA 3ANWB 2B1EA 4Z91A 3ZT5A 3ZSSA 4O4HE 3ZC1A 4EOZB 4HWFA 5J2TE 1US7B 3BQKA 4IIJE 1YKEB 4Q25A 4ZI2D 5LGTB 3KBUA 3O9XA 3PUVF 1Y64B 4YT0A 3ZJ1A 1N34T 4U72A 4JI0T 2JMHA 3AVSA 4XTCM 5AQRB 3FXDB 5AQJB 3PUVG 5FVKA 4UIGA 4XIGN 3L09A 1D1AA 2IAKA 2BS2A 4UV9B 5CJ5A 4JLEA 3UUMA 1KK7A 4L0RA 3RH3A 5A1LA 5ABEA 2E5LT 2WAUA 5KMGP 4AKIA 2X0YA 3ZN0B 3RGLA 3LSVA 4A97A 3PUWG 1G73A 2XHEB 2BZBA 3UTKA 4X20E 3ZCJA 2D9DA 1UX5A 4YTMA 2KLQA 5L47A 4JI1T 5AQNB 3C50A 2NW7A 3HKCE 2FUPA 3J7Yq 4YMUC 2CXFA 4AI6A 1CHUA 2VKDA 4HFCA 4DBQA 2PG8A 2XQ6A 3KV9A 4GK5E 3ZYLA 5LG4A 3DTOA 3AE8A 3H3MA 3EDVA 3GN5A 5DQWA 1YD8G 4IE6A 4K0KT 4CI2B 3UU4A 1I94T 2BG9A 4TZ4C 3Q9DA 5JR9C 4O8SA 4DV2T 4IGUA 2LM9A 2XQ3A 1E7PA 2XM2A 4ILCA 4M1PA 1QLBA 2N9DA 3N9PA 3VHLA 2BS3A 4CXYA 1J5ET 4JUYA 1HX8A 3PUGA 2CRBA 4HWIB 2KWHA 4MHCA 3OVUA 4AQYT 4IHJE 4UF0A 5HEJA 4B3ST 5AFUL 2ODUA 4YHHT 5HEUA 5ABHA 4P09A 5LG3A 2NW8A 2WDVA 2X9YA 3O1HA 2R6GF 1MMNA 1HNZT 1XWMA 2LLYA 5IHYA 3O1IA 5L3BB 4AKHA 1MIVA 2W67A 5AQVB 3V5UA 4U74A 4OHFA 3PUZG 3ZYKA 5AQTB 5FXXA 3RRWA 4HWHA 4EIWA 2B76A 4A56A 4UVCB 1H7CA 2QVAA 3I1AA 5JDMA 2JIWA 4LF5T 2K9AA 4DUYT 3AE7A 2YDRA 3TUZA 3GWHA 4PJNA 4WZXA 2NW9A 5IUXA 3WAJA 3CX7B 3PURA 5EZYE 1O3XA 2C5JA 4CXWA 5AQFB 3TLSA 4X62T 3TUJA 1HF8A 2J4GA 1QUUA 3QOFA 4MALA 4U7IA 5JDFA 4AXPA 1N33T 3N9LA 3G06A 3WI3A 1M7KA 1FEWA 2LT3A 4UR9A 3Q5XA 3EAMA 3QB5K 4IDPA 2UXXB 3AB3B 4PK6A 4AKRB 3ZJ2A 3JAFA
chains in the Genus database with same CATH topology
3PV0F 4TQUM 4TQUN 4YMTB 3PUWG 3PUZF 2R6GF 4YMWC 4KI0G 2R6GG 4YMUC 3PUZG 3RLFF 3PUYF 2ONKC 3TUZA 3PUYG 3RLFG 4JBWF 4KI0F 4KHZF 4YMSC 3PUVF 3PUXG 3TUJA 3PUXF 4XTCM 4XTCN 3PUVG 3PUWF 4KHZG 4XIGM 3DHWA 4XIGN 4JBWG 4YMVC 3TUIA 3PV0G 3D31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 F;  4TQU M;  4TQU N;  4YMT B;  3PUW G;  3PUZ F;  2R6G F;  4YMW C;  4KI0 G;  2R6G G;  4YMU C;  3PUZ G;  3RLF F;  3PUY F;  2ONK C;  3TUZ A;  3PUY G;  3RLF G;  4JBW F;  4KI0 F;  4KHZ F;  4YMS C;  3PUV F;  3PUX G;  3TUJ A;  3PUX F;  4XTC M;  4XTC N;  3PUV G;  3PUW F;  4KHZ G;  4XIG M;  3DHW A;  4XIG N;  4JBW G;  4YMV C;  3TUI A;  3PV0 G;  3D31 C; 
#chains in the Genus database with same CATH topology
 1HX1 B;  2UUC T;  4YTN A;  3AA7 B;  4P0A A;  3P4R A;  2HH7 A;  3ONX A;  4QKN A;  4YLH A;  5DAB A;  5BR8 T;  5ADX L;  2V1D B;  4F6R C;  4ZZC A;  1WR0 A;  4LF4 T;  2WU5 A;  1YXR A;  2P9B A;  3IA3 A;  2YOE A;  4O4J E;  2X51 A;  4WYV A;  4YMW C;  3N9M A;  2YU1 A;  3UUL A;  2JQK A;  2HN2 A;  2N1G A;  2MPK A;  3NBX X;  4IDO A;  3AXJ B;  2V7L A;  2LSY A;  2NOX A;  2HHH T;  2IW5 B;  5FNV E;  4K0U A;  1HFA A;  2LSG A;  2LM2 A;  2V7M A;  3ZPO A;  5HXE A;  5LHH B;  3RKG A;  4DR4 T;  2C5I T;  3Q5E A;  2FJD A;  1KEY A;  1SHZ C;  1UK5 A;  2KT9 A;  3PUX G;  2DCF A;  4B3T T;  3C4X A;  2LRK A;  3FBL A;  3CQG B;  4DV0 T;  1FJG T;  4NIQ A;  3JAD A;  3K3Q C;  3AE6 A;  4YMV C;  3CML A;  3EVY A;  5JRC B;  2VKH A;  4AIS A;  3PJA A;  5FY1 A;  4L5G A;  2DNX A;  2DWK A;  3NKZ A;  3VR9 A;  5HAX A;  1X9B A;  4HWC A;  4G63 A;  4ILA A;  3H37 A;  3PV0 F;  3L3P A;  4IL4 A;  2H7O A;  1LKX A;  5AQP B;  3RYF E;  4B3M T;  2BS4 A;  3QC9 A;  4HFI A;  3T1H T;  1L0V A;  1IBK T;  2CEA A;  2M6B A;  4IDZ A;  1W9R A;  5FKY A;  3I9W A;  4FJO A;  2FBW A;  3TLW A;  3EDU A;  3NWI A;  4BJM A;  4GKJ T;  4XBF B;  2NR4 A;  3NRX A;  2WY2 A;  2YDS A;  4ZXL A;  3I0Q A;  3KVB A;  1OED C;  4QH1 A;  3IF8 B;  5AQK B;  5J2U E;  5JDN A;  1HS7 A;  2PTF A;  5L2L A;  3RYH E;  2OV9 A;  2BDE A;  3RYC E;  3X1D A;  4KI0 F;  2W62 A;  1DU2 A;  4I50 E;  4OYJ A;  3TLU A;  3OBV E;  3FZF B;  1WYC A;  3A8Y C;  4U2Y A;  3DJB A;  4WBO A;  3RF1 A;  3UU8 A;  4YJ2 E;  4N78 D;  2ACZ A;  3AE9 A;  2LKH A;  4HGA A;  1T98 A;  2A9U A;  1BR1 A;  4NUU A;  5ABF A;  3D31 C;  1HG2 A;  3FZM B;  3K8P C;  3CK6 A;  1FMV A;  4TQU M;  2ZM8 A;  1ZHC A;  3ZT7 A;  3PUS A;  4B3R T;  2C5K T;  3I0O A;  1Z8U A;  4YXD A;  2CWO A;  2K3W A;  4P0B A;  3MZK B;  4CZZ B;  3ANW A;  4IRE A;  2CLY C;  2IHR 1;  4HEA A;  2XAQ B;  2C0S A;  2YEV C;  1D0Y A;  2BKN A;  4ZI3 C;  3ZMT B;  4ADZ A;  1OED E;  4F8H A;  3HI2 A;  2Z6E A;  4CN1 A;  2I0M A;  5JR9 B;  3A5X A;  5IWA T;  2W2U A;  4DV3 T;  4TUY E;  5JDG A;  3TKL B;  3N2K E;  2H7V C;  2CWY A;  2G0U A;  2LOS A;  3N5L A;  4EV6 A;  2XAG B;  2CLY B;  4U3C A;  4NXM T;  1KF6 A;  2V8S V;  5C2T A;  3GA8 A;  4C90 A;  3P50 A;  2D0U A;  4HFE A;  4NUV A;  3SS1 A;  4XTC N;  1D0Z A;  2XQ9 A;  3K1S A;  2V6X A;  2VKO A;  4Z8X A;  1XDP A;  3TUI A;  3RKO A;  1V9D A;  2V7I A;  4IL9 A;  3NZQ A;  4MFR A;  1MND A;  2ACX A;  5LOV E;  3RIA A;  4UV8 B;  3AEA A;  4HFB A;  2VL8 A;  5FL0 A;  3AVR A;  3KBT A;  2CE7 A;  3KV6 A;  3AE5 A;  4GK0 E;  1S94 A;  2LRL A;  2RPA A;  3JAE A;  4I55 E;  4JEU B;  4ANJ A;  2ZM0 A;  4H63 V;  4PAG A;  5L3D B;  2E9X C;  3MA9 A;  4DR1 T;  2DLR A;  2EHO A;  5CFB A;  3C4Z A;  2W0G A;  3N9O A;  3CPZ A;  1UCU A;  3AA6 B;  4HTE A;  4U2Z A;  1X79 A;  5LJN A;  5JDQ A;  2ZM6 T;  2EHO B;  3OKQ A;  3F31 A;  4IE7 A;  2DHR A;  5L4E A;  4JBW F;  3K3O A;  1WRD A;  5J1G A;  4O4L E;  2XAH B;  4UVA B;  3RPU A;  4HN9 A;  2JQQ A;  3N2G E;  4LMK A;  4ERR A;  3AAI A;  4MLK A;  3NRY A;  4O2A E;  4COF A;  4JBW G;  4AKL A;  1IBM T;  4LF9 T;  3HA4 A;  3ZC0 A;  4JYA T;  2BKO A;  5AQU B;  4HFH A;  3UUN A;  3J9X 1;  3GMI A;  1SUM B;  2L3L A;  3ESL A;  1EZ3 A;  1MIY A;  2LSI A;  2V7J A;  1IJ5 A;  3EHZ A;  3AEE A;  1CUN A;  4MBQ A;  3P8C D;  5HEG A;  3NVO A;  3P4P A;  4V1A v;  3U3I A;  3ZYM A;  4QXB B;  3MKD A;  5LJM A;  4HWD A;  4BJN A;  1VRB A;  2E8I A;  1BR2 A;  2JMK A;  3B13 A;  4EYY R;  1XMQ T;  3PUY F;  3ZKR A;  1I6Z A;  1G8X A;  2QA7 A;  2UU9 T;  2UUA T;  2I59 A;  2CM0 A;  2XUE A;  3Q5W A;  2JQ9 A;  3E0Z A;  4OFZ A;  3ZLI A;  4DMW A;  3RLF G;  5HWX A;  5IYZ E;  4EAH A;  3P4S A;  4YSX A;  4YSY A;  2CBJ A;  4HFV A;  5JTG A;  3NZP A;  2CXL A;  2DL1 A;  3EUH A;  2VUR A;  3IEE A;  3LDQ B;  3RX6 A;  3ZT6 A;  4EB6 E;  5LCY A;  2V6Y B;  4UXN B;  3WAK A;  1HR0 T;  4BAY B;  4QHO A;  3AE1 A;  5LMU T;  4DV5 T;  1ZOY A;  2XY8 B;  2XPK A;  4JI5 T;  3VRA A;  2JQH A;  3LFM A;  1W09 A;  2CBI A;  4H9P C;  1E1H B;  4ZI3 D;  4QX8 B;  1KFY A;  4EXT A;  5LHI B;  4ZZB A;  4LF6 T;  5LB7 B;  5AQI B;  5C3J A;  5ABF B;  4BA9 A;  4LMJ A;  2BKP A;  2LKG A;  3VU7 H;  2KMF A;  5DJQ C;  3TLT A;  3CWZ B;  1UGO A;  4WNK A;  3RLF F;  3PU3 A;  4PNI A;  1LRZ A;  2W66 A;  2V26 A;  4X5T A;  1YW0 A;  4GYR A;  2NTY A;  3T8O A;  3UFG A;  4EZH A;  3C51 A;  4JI7 T;  2Y8D A;  2KSR A;  2PJQ A;  2WP9 A;  3AAA B;  2NTX A;  3FB2 A;  3HL6 A;  3LK2 B;  3PUQ A;  5FP3 A;  5ETW A;  4KP3 C;  3PJA J;  3OPC A;  5JR9 A;  3RIU C;  3OYX A;  4EEB A;  3BQL A;  4EED A;  4GYS A;  5JRC A;  5JDL A;  4IST A;  4Z90 A;  2BG9 E;  2WDR A;  2ZM2 A;  5F8P A;  2VQE T;  1ZP0 A;  2E9X B;  3P7I A;  1T7S A;  4GIW A;  4E7Z A;  1SA0 E;  2MAW A;  2V5D A;  5LA6 E;  4ZS2 A;  2YKS A;  2E9X D;  4CQI A;  4AQF A;  4JV5 T;  4LFC T;  2DWG A;  2XAS B;  3KIN B;  4DV7 T;  3C98 B;  1ZKE A;  2XJ7 A;  2YU2 A;  2LEH A;  5HCM A;  3ABV A;  3LK4 2;  3UFE A;  2IML A;  4AQF C;  3PU8 A;  2WCA A;  2XSA A;  5HEO A;  1JNR A;  2LE8 A;  4TWH A;  2RP4 A;  5HWY A;  4DR3 T;  4GKK T;  3EI0 A;  2RA1 A;  1KNZ A;  2A2F X;  2NP9 A;  2WBL A;  4YJ3 E;  4CI1 B;  2UXC T;  2E5V A;  2KND A;  4QWN B;  2N2N A;  5HYA A;  1U5P A;  2WMO A;  5KXJ A;  4TV9 E;  4UEM A;  1MMA A;  3MAC A;  4H63 H;  2CA5 A;  3L39 A;  5CA0 E;  5LNK A;  2UXD T;  3AEF A;  5FMN A;  1VCT A;  5AQH B;  3FZK B;  2E2A A;  3LG7 A;  3U78 A;  2IC6 A;  3C64 A;  5DQV A;  5AQO B;  3DHW A;  1B7T A;  4LFB T;  3VRB A;  2VB6 A;  5JH7 E;  2D0T A;  5FXV A;  4I4T E;  1UUR A;  2H88 A;  4DO0 A;  2W63 A;  1BR0 A;  4H9N C;  2XZE A;  5KX5 E;  3P4W A;  3W15 B;  4TQU N;  3N9Q A;  4A5X A;  3O4X E;  3SOL A;  4ASK A;  2X0H A;  2IC9 A;  3AE4 A;  3ETV A;  3PUA A;  3ETU A;  3HKD E;  4EYU A;  2V7K A;  3AA0 B;  3KFW X;  3TLV A;  5L3G B;  2CCQ A;  2X68 A;  3GN5 B;  4JEH B;  1HCI A;  2JJ9 A;  1MNE A;  2BG9 B;  4H9Q C;  4ILU A;  3LK3 B;  4PK4 A;  4YHJ A;  4YTP A;  1OWA A;  2WWV A;  4KBM B;  5LBM A;  1QSD A;  4TNW A;  1UUS A;  4ZEY A;  4ZHQ E;  4QH4 A;  3UUB A;  2M67 A;  4PFO A;  5HCJ A;  4QXH B;  5F5W A;  4CXX A;  5LBQ B;  2LOP A;  3SFE A;  5FXW A;  2WS3 A;  2D2S A;  5LGN B;  1YKH B;  1XDO A;  4X65 T;  4KX6 A;  4JI2 T;  2MOZ A;  4B6X A;  5EK4 A;  4IE5 A;  2YN6 A;  1MIW A;  2F4V T;  4ZS3 A;  3VKH A;  1JNZ A;  2Y6X A;  4UF0 B;  3AED A;  4GOU A;  5KDM C;  3AE2 A;  2BBH A;  1J1J A;  5FY7 A;  5H6R B;  1WCR A;  3PE0 A;  3SWH A;  3LBX B;  1Z0P A;  4P1N A;  3AEG A;  3C4W A;  2KIN B;  4PW8 A;  4TWD A;  3ONL C;  4XAX B;  3HKB E;  3Q5D A;  2VKJ A;  3N2O A;  3RIF A;  5AQM B;  1HTJ F;  2VK9 A;  2WSS V;  2WWU A;  2X9X A;  3KV5 A;  2VL0 A;  3F57 A;  2EHO D;  2NWB A;  3HKE E;  3S4U A;  3D0T A;  4JI8 T;  2ONK C;  2XQ7 A;  4IDN A;  4LML A;  2LJL A;  1LVK A;  4KMC A;  5L3C B;  3FXE B;  4U7Y A;  3M65 A;  2BBJ A;  3SFD A;  1YQ3 A;  2OA5 A;  2LSK A;  3RRC A;  3OTO T;  4YMS C;  1KNP A;  3IBP A;  2SPC A;  2UXN B;  3L8R A;  2J1D G;  2Q9Q C;  1M62 A;  3E08 A;  3EAB A;  5LXT E;  2VVS A;  2HPJ A;  4NPP A;  3KVA A;  3BQI A;  3UU5 A;  4XIG M;  5FY0 A;  4ZOL E;  3ZMU B;  4EGW A;  4AIU A;  3FZL B;  5JRE A;  1UX4 A;  4IE0 A;  2HPL A;  2KXP B;  1ZV4 X;  3UT5 E;  1U4Q A;  5AQQ B;  5E0O A;  4YSZ A;  1XNQ T;  4UEL A;  2UUB T;  3RQW A;  2LHR A;  3CIR A;  3I9Y A;  3N9N A;  2WZH A;  2W61 A;  2BVL A;  2QYW A;  4DV1 T;  3QUJ A;  4DV4 T;  1Y01 A;  1HG5 A;  3IHR A;  1MMD A;  2WB5 A;  3DP7 A;  2AXD S;  3BK9 A;  3F2E A;  3HR0 A;  3JC6 C;  3ONJ A;  3RC3 A;  3VR8 A;  2H3R A;  2QRX A;  3QB5 A;  2A3D A;  2WDQ A;  1FIO A;  5LGU B;  3JCF A;  2FJA A;  2XQ5 A;  2FJB A;  5BMV E;  2L8K A;  4KHP T;  4FI5 A;  2ES0 A;  2CPT A;  2A72 A;  2M6I A;  4X1K E;  3PUY G;  4DBR A;  2KWI B;  3M3Z B;  2K24 A;  2YIN A;  1W0A A;  4PK5 A;  1D1C A;  1HNX T;  3B5M A;  4CI3 B;  2ODV A;  2BG9 C;  4LF8 T;  2E9X A;  2WU2 A;  3R84 B;  3E22 E;  4DMV A;  5EK3 A;  5CGM A;  4XZC A;  4QXC B;  5JVD E;  1WR6 A;  2X9H A;  4IT4 A;  2XQY A;  3P4Q A;  2WQY A;  4ZI7 E;  1IBL T;  4AQG A;  4YMT B;  3RYI E;  2MTQ A;  5FVL A;  2MBG A;  4YY3 T;  5JDH A;  2XM1 A;  1S35 A;  4DVD A;  1E2A A;  4H9R C;  4KUM B;  5FL1 A;  1N32 T;  2XQA A;  1KNR A;  2PFV A;  5L3E B;  2XAJ B;  3RHW A;  5EK2 A;  3KV4 A;  2UXB T;  3CKD A;  1SE7 A;  2QGS A;  3MJX A;  4HFD A;  4WW0 A;  3PDY A;  4ISS A;  2I6H A;  2KZ7 B;  2ZMA A;  2CHO A;  5AQL B;  4DID B;  4WBN E;  2WZI A;  4DR6 T;  2PBI A;  3O1J A;  2X67 A;  5AQG B;  2L9Q A;  4UVB B;  5ABG A;  5L3F B;  1YQ4 A;  2IIU A;  4TV8 E;  3ZEF B;  1WYB A;  2D5U A;  2XQ8 A;  3PUX F;  3A7M A;  4TN7 B;  5AQS B;  1OED B;  4H9O C;  4DR7 T;  5LP6 E;  1J5W A;  2XSB A;  4I0U A;  1NEN A;  5J0Z A;  2J62 A;  1OED A;  2XQ4 A;  1VCS A;  1NEK A;  4C91 A;  4PJJ A;  4PFP A;  3QK6 A;  3ZMZ B;  4U31 A;  1HNW T;  2VAS A;  1T72 A;  4IE4 A;  4G2A A;  5JQG E;  3ZMS B;  2JRK A;  2ZLY A;  3FZH B;  5CA1 E;  3CQX C;  3FBZ A;  1W0B A;  3RIU A;  3B57 A;  5HXH A;  4QX7 B;  4JI4 T;  4NXN T;  5HEH A;  2XTL A;  1IAP A;  3MXZ A;  4PJM A;  2JPF A;  2IUB A;  2X0L B;  4PJL A;  3ZST A;  4X66 T;  2MYS A;  5FYM A;  2VQF T;  2GK9 A;  4H9S E;  4O2B E;  3AXJ A;  4TWF A;  1MMG A;  1D0X A;  1ZEE A;  4KHZ F;  4J2C A;  2WM9 A;  3K3N A;  3RC8 A;  2BVM A;  5LYJ E;  5LHG B;  3PUW F;  4KHZ G;  3AEB A;  2CHN A;  2FJE A;  2H89 A;  2W00 A;  2AE9 A;  2Y48 B;  4HKA A;  3ZN1 B;  2VVN A;  2WMN A;  2XAF B;  1D1B A;  3CX6 B;  4A98 A;  4ZI2 C;  4LFA T;  1FMW A;  3UQ7 A;  3KDS E;  3MK7 C;  4X1I E;  3PTR B;  4U33 A;  2V6Y A;  1XNR T;  3PUZ F;  3CX8 B;  3AEC A;  3UUX B;  4DUZ T;  2CMR A;  1N36 T;  3ZMV B;  2Q9Q B;  2DI4 A;  3H3A A;  2LHN A;  2LSJ A;  3UQ4 A;  1WLX A;  3QNU A;  5C8Y E;  4JI3 T;  4X64 T;  3RQU A;  2J47 A;  4KI0 G;  2R6G G;  1BR4 A;  2Q9Q A;  3Q2M A;  1XZY A;  4HE8 A;  4IDQ A;  4ILB A;  2K48 A;  2V5C A;  4TNV A;  4I43 B;  1IZN B;  3OYZ A;  4EZ4 A;  4DV6 T;  3LBX A;  3OJA A;  4X1Y E;  5HXC A;  1NWM X;  3VKG A;  5M4Y A;  4OX9 T;  1VOM A;  4LF7 T;  2X9W A;  2YDQ A;  2VWA A;  4TX5 A;  3UU6 A;  3V5S A;  2OLT A;  4CN6 A;  4YFS A;  4CN4 A;  3LJC A;  2K5B B;  3JC6 D;  3FHN A;  1OXZ A;  2HN1 A;  3CQC B;  4O4I E;  4DND A;  3AAE B;  1NAF A;  2X66 A;  3UU3 A;  3ZCI A;  4E7S A;  1XMO T;  4DR2 T;  4DR5 T;  4AKG A;  5H6Q B;  3PV0 G;  2EHO C;  2CXD A;  1GQE A;  2YK0 A;  1R8I A;  4L9I A;  5GON E;  3R6N A;  4OYK A;  3CVR A;  4QH5 A;  5HXR A;  1AJ3 A;  1IJ6 A;  1LVF A;  3AA1 B;  5CB4 E;  3RI5 A;  3SRZ A;  2Q9Q D;  5LMN T;  3T1Y T;  3AE3 A;  2IDO B;  4JI6 T;  1T8B A;  5L4H A;  5F3J A;  4OK0 A;  5FXZ A;  5HXS A;  2W4X A;  5TAO A;  1WFD A;  3ANW B;  2B1E A;  4Z91 A;  3ZT5 A;  3ZSS A;  4O4H E;  3ZC1 A;  4EOZ B;  4HWF A;  5J2T E;  1US7 B;  3BQK A;  4IIJ E;  1YKE B;  4Q25 A;  4ZI2 D;  5LGT B;  3KBU A;  3O9X A;  3PUV F;  1Y64 B;  4YT0 A;  3ZJ1 A;  1N34 T;  4U72 A;  4JI0 T;  2JMH A;  3AVS A;  4XTC M;  5AQR B;  3FXD B;  5AQJ B;  3PUV G;  5FVK A;  4UIG A;  4XIG N;  3L09 A;  1D1A A;  2IAK A;  2BS2 A;  4UV9 B;  5CJ5 A;  4JLE A;  3UUM A;  1KK7 A;  4L0R A;  3RH3 A;  5A1L A;  5ABE A;  2E5L T;  2WAU A;  5KMG P;  4AKI A;  2X0Y A;  3ZN0 B;  3RGL A;  3LSV A;  4A97 A;  3PUW G;  1G73 A;  2XHE B;  2BZB A;  3UTK A;  4X20 E;  3ZCJ A;  2D9D A;  1UX5 A;  4YTM A;  2KLQ A;  5L47 A;  4JI1 T;  5AQN B;  3C50 A;  2NW7 A;  3HKC E;  2FUP A;  3J7Y q;  4YMU C;  2CXF A;  4AI6 A;  1CHU A;  2VKD A;  4HFC A;  4DBQ A;  2PG8 A;  2XQ6 A;  3KV9 A;  4GK5 E;  3ZYL A;  5LG4 A;  3DTO A;  3AE8 A;  3H3M A;  3EDV A;  3GN5 A;  5DQW A;  1YD8 G;  4IE6 A;  4K0K T;  4CI2 B;  3UU4 A;  1I94 T;  2BG9 A;  4TZ4 C;  3Q9D A;  5JR9 C;  4O8S A;  4DV2 T;  4IGU A;  2LM9 A;  2XQ3 A;  1E7P A;  2XM2 A;  4ILC A;  4M1P A;  1QLB A;  2N9D A;  3N9P A;  3VHL A;  2BS3 A;  4CXY A;  1J5E T;  4JUY A;  1HX8 A;  3PUG A;  2CRB A;  4HWI B;  2KWH A;  4MHC A;  3OVU A;  4AQY T;  4IHJ E;  4UF0 A;  5HEJ A;  4B3S T;  5AFU L;  2ODU A;  4YHH T;  5HEU A;  5ABH A;  4P09 A;  5LG3 A;  2NW8 A;  2WDV A;  2X9Y A;  3O1H A;  2R6G F;  1MMN A;  1HNZ T;  1XWM A;  2LLY A;  5IHY A;  3O1I A;  5L3B B;  4AKH A;  1MIV A;  2W67 A;  5AQV B;  3V5U A;  4U74 A;  4OHF A;  3PUZ G;  3ZYK A;  5AQT B;  5FXX A;  3RRW A;  4HWH A;  4EIW A;  2B76 A;  4A56 A;  4UVC B;  1H7C A;  2QVA A;  3I1A A;  5JDM A;  2JIW A;  4LF5 T;  2K9A A;  4DUY T;  3AE7 A;  2YDR A;  3TUZ A;  3GWH A;  4PJN A;  4WZX A;  2NW9 A;  5IUX A;  3WAJ A;  3CX7 B;  3PUR A;  5EZY E;  1O3X A;  2C5J A;  4CXW A;  5AQF B;  3TLS A;  4X62 T;  3TUJ A;  1HF8 A;  2J4G A;  1QUU A;  3QOF A;  4MAL A;  4U7I A;  5JDF A;  4AXP A;  1N33 T;  3N9L A;  3G06 A;  3WI3 A;  1M7K A;  1FEW A;  2LT3 A;  4UR9 A;  3Q5X A;  3EAM A;  3QB5 K;  4IDP A;  2UXX B;  3AB3 B;  4PK6 A;  4AKR B;  3ZJ2 A;  3JAF A; 
#chains in the Genus database with same CATH homology
 3PV0 F;  4TQU M;  4TQU N;  4YMT B;  3PUW G;  3PUZ F;  2R6G F;  4YMW C;  4KI0 G;  2R6G G;  4YMU C;  3PUZ G;  3RLF F;  3PUY F;  2ONK C;  3TUZ A;  3PUY G;  3RLF G;  4JBW F;  4KI0 F;  4KHZ F;  4YMS C;  3PUV F;  3PUX G;  3TUJ A;  3PUX F;  4XTC M;  4XTC N;  3PUV G;  3PUW F;  4KHZ G;  4XIG M;  3DHW A;  4XIG N;  4JBW G;  4YMV C;  3TUI A;  3PV0 G;  3D31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...