3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
2ONKC 3PV0G 4JBWG 4TQUM 4TQUN 3RLFG 3RLFF 3PUVF 4YMTB 3PUZG 3PUWG 3TUIA 4XTCN 3TUJA 3PUYF 4XTCM 3PUXF 3PUYG 3PUXG 2R6GG 4XIGN 3TUZA 3PUVG 3PV0F 4XIGM 3DHWA 3PUZF 3PUWF 4KI0F 4YMVC 3D31C 4KI0G 4YMUC 4YMSC 4YMWC 4KHZG 4KHZF 4JBWF 2R6GF
chains in the Genus database with same CATH superfamily
1SA0E 4YY3T 3NWIA 5L4HA 4MHCA 2JMHA 2Q9QA 4B6XA 2L8KA 3EHZA 3AAAB 4GYSA 4ZS3A 5DQVA 5HEHA 3H3MA 4CN4A 4DMVA 1XMOT 2H89A 5ABFA 3MKDA 2FJDA 2QYWA 3UULA 1MIWA 3LDQB 3LK42 2ZM8A 2BS3A 3AEEA 2UUCT 4YSXA 2JPFA 4JI4T 2XQ4A 3AE9A 3IF8B 3RH3A 1E1HB 1ZP0A 3AE3A 3TKLB 3WI3A 3RC8A 3LJCA 4DR4T 1BR0A 4DV5T 3ZMZB 3AA6B 2YEVC 4PK5A 5LBMA 4EYUA 2XUEA 4AQFA 3AAIA 3HKDE 4AKIA 4GIWA 2NR4A 3C50A 4L0RA 3PUWF 4H9RC 4DIDB 2MYSA 1YQ4A 2OV9A 2D5UA 2CWYA 5JDFA 3GWHA 5LBQB 4CN6A 4KHPT 5AQSB 2LHNA 2KWIB 1D0YA 2K24A 4QH1A 2LHRA 3Q9DA 5JDLA 3NZQA 4DV0T 1VCTA 5HXRA 4IDQA 3PV0G 2JQ9A 4UVCB 1L0VA 5L3DB 2IAKA 2XAGB 3UT5E 3P4PA 4LF5T 3RI5A 1KNRA 1QLBA 3B13A 4EAHA 2LSGA 2XAQB 3PUZG 2VB6A 2K48A 4K0UA 4ADZA 4DV2T 4LFCT 3FBLA 4WBNE 3CPZA 4ZI3D 3AA0B 2A3DA 4JI7T 2CM0A 2ZMAA 1MIVA 2I6HA 3X1DA 1Y01A 3PU8A 4XTCM 3PUXF 3JAEA 2KT9A 2LRLA 5EZYE 5JRCB 1V9DA 2X9HA 2YN6A 2H7OA 3DJBA 4WYVA 1IZNB 5CB4E 2LOPA 5AQHB 3VR8A 2DLRA 4KI0F 3PUZF 1BR1A 1MIYA 1NWMX 1WR6A 2XQ8A 3CIRA 3PJAJ 4I43B 1AJ3A 2BBHA 3KBUA 1ZV4X 2IMLA 3L8RA 4A97A 3ZKRA 4ZI2C 1H7CA 2W00A 3R84B 1HCIA 2W67A 5HXCA 3VKHA 3CQGB 4HFEA 4ANJA 4XBFB 3AE2A 3E0ZA 4HWCA 2V7MA 3AXJB 3ETVA 2LOSA 4LFBT 2A2FX 2V6YA 4I55E 4IE0A 4IT4A 4U31A 2G0UA 4UR9A 5FKYA 4GYRA 5LHGB 1MNDA 4IIJE 2E9XB 4CQIA 2HH7A 3HKBE 5HEUA 3RYHE 3P4WA 3QB5A 2XAHB 3SWHA 5F3JA 5JTGA 3ONJA 2X51A 2QVAA 3RHWA 1KNZA 4TZ4C 4ZHQE 5A1LA 4UV8B 2OLTA 4OX9T 3I0OA 2BS2A 3CX6B 4MALA 3C51A 3OYZA 2FUPA 4P1NA 2YU1A 5L3EB 2WQYA 1NEKA 4JLEA 1Y64B 4CXWA 2CHNA 1S35A 1B7TA 1BR2A 1X79A 2HPLA 2WZIA 2ZLYA 4EOZB 4JYAT 2RP4A 3K3QC 4DV3T 3RRCA 2J62A 4DR5T 1FIOA 2VASA 2E8IA 4KHZG 2H88A 2YDQA 3AE5A 4KUMB 4QH5A 2MBGA 3RC3A 1HR0T 2UXCT 4QHOA 2KMFA 2W66A 1KEYA 4GOUA 4ZZBA 1D0ZA 4G63A 3FZFB 3NKZA 5BMVE 5HCMA 3ZSSA 4HWFA 2YDRA 5HXHA 2CBIA 3RQWA 4BJNA 1QSDA 1SE7A 3PUAA 4N78D 2D9DA 3WAJA 2CPTA 1MNEA 5LP6E 4F8HA 1YKHB 5FL0A 4NXNT 2YKSA 1GQEA 2VKOA 5CGMA 3QUJA 3P8CD 3PUYF 4B3TT 3RX6A 1NAFA 3NRXA 3ZC0A 4ISSA 4Z8XA 1VOMA 1YKEB 2N2NA 2X0HA 4HEAA 3I9WA 1OEDA 2EHOD 3AE4A 4PJNA 1OWAA 1HFAA 3F57A 4O4LE 3ZYLA 4HWIB 2HN2A 3W15B 2M6BA 2IDOB 1IJ6A 2YDSA 3PU3A 3BK9A 4B3RT 4UVBB 4YMSC 2CHOA 1WR0A 2LEHA 2QRXA 3N9QA 3PE0A 2WU2A 5HYAA 3KINB 3FHNA 4EEBA 5JDHA 3HKEE 4QWNB 4EYYR 2CLYB 3VRBA 3AE6A 2A9UA 1HG5A 2C5IT 3P4SA 4O4HE 4U3CA 5JDMA 4PFPA 2MPKA 2FJAA 2YOEA 3C4ZA 3AEDA 2XQ5A 2LLYA 3MACA 5BR8T 3SS1A 3UU3A 2XZEA 3M3ZB 3MZKB 2W62A 4P0AA 3FZLB 2XM2A 4NPPA 4ISTA 3I0QA 2J1DG 3UU8A 4ZXLA 5HWXA 4Q25A 3UTKA 1WYBA 2R6GG 3G06A 3P4QA 5HAXA 4TNWA 2XY8B 2WU5A 2X66A 4ZI3C 2VQET 3M65A 2BG9A 5LOVE 5FXZA 4UF0B 3HKCE 4OYKA 1WRDA 3ZPOA 4ZZCA 5KX5E 3ETUA 5EK3A 2WMNA 2CMRA 3E08A 2XQ9A 3ZMSB 3ZMUB 2JRKA 5EK4A 2RA1A 4A5XA 5JDNA 5LYJE 4XZCA 4AISA 3AE8A 4JI8T 2YU2A 2Q9QC 5CA1E 3TLVA 1ZHCA 3NVOA 4PNIA 5JVDE 1E7PA 2YINA 2HN1A 3K3NA 3OVUA 4EB6E 4U33A 3IBPA 4UELA 2WM9A 1U4QA 4P0BA 3UQ4A 1XWMA 2W61A 4O8SA 1EZ3A 2WAUA 4WW0A 2MTQA 3AEGA 4YT0A 2BG9E 4DV4T 1HX8A 2E5VA 4IDNA 3LG7A 2UXNB 4IE4A 4BAYB 3AEAA 5CJ5A 4UEMA 4LF8T 4QKNA 2H7VC 4LF4T 3FXEB 3LBXA 2EHOA 3KV5A 3V5SA 1KFYA 5J2UE 4ILBA 4DO0A 4KI0G 1UCUA 2B1EA 5FVLA 1I6ZA 3U3IA 4I4TE 5LJMA 2BKPA 3ZCIA 3QOFA 4KP3C 1KNPA 3HL6A 2BVLA 2NOXA 2X9YA 2KLQA 4X1KE 3H3AA 2ONKC 2DI4A 3GN5A 5L4EA 4DVDA 2X9WA 1KK7A 3LK3B 4H9PC 2VL8A 3AVRA 2JMKA 3AA1B 3HR0A 2DL1A 2VQFT 5DABA 4LMLA 3QNUA 4JI6T 2C5JA 4LF6T 3I9YA 4G2AA 5F8PA 2LM9A 2CA5A 1YD8G 3FZMB 2BDEA 3I1AA 5JR9A 5AQRB 1XMQT 3ANWB 4ZI7E 3N9NA 4QXBB 4JI5T 4QX7B 4YLHA 3QK6A 1XNQT 3KFWX 4TV9E 5LG3A 5L47A 2F4VT 5AQMB 5F5WA 4PJLA 3RIUA 1SHZC 3UU4A 2D2SA 3LFMA 5JR9B 1G73A 4O2AE 4JV5T 2UUBT 2BVMA 2FBWA 5JQGE 2JQQA 3OBVE 1MMGA 2LKGA 2EHOC 4A56A 4GKJT 5IHYA 4KHZF 4XIGN 4MFRA 5LG4A 2E2AA 3FBZA 3KV6A 4FJOA 3RLFF 2LT3A 2XAFB 4PAGA 3RYCE 4AKRB 4EIWA 4QH4A 3EDUA 3RQUA 4AQGA 1Z8UA 4DMWA 1WCRA 2LSIA 5H6QB 4F6RC 4XTCN 2WDRA 2XQ3A 3L09A 1OEDC 4IGUA 4PK4A 4X5TA 5AQNB 4DR3T 4U7YA 3PUYG 3Q5DA 5M4YA 4C90A 2NWBA 4H63H 3IA3A 1HNZT 2KNDA 2WY2A 4Z90A 3NRYA 1LRZA 4O2BE 2MAWA 1IAPA 3DHWA 2UXBT 4YHHT 1O3XA 3ESLA 3UU6A 4X62T 4UXNB 4CI1B 3GA8A 4IDPA 5JR9C 2UUAT 1XNRT 3JCFA 2WBLA 5EK2A 3ABVA 1FJGT 2DWKA 2D0UA 4H9QC 4H9NC 2FJEA 4AQFC 4JI0T 3CK6A 4UVAB 5ABFB 3ZSTA 1N33T 4ZOLE 3HA4A 2NTXA 2PJQA 3RRWA 2V26A 4V1Av 3CX8B 4NXMT 2BKNA 3JADA 2CXDA 3EVYA 2V6XA 2IHR1 3AA7B 3KVBA 3A8YC 5FY0A 5TAOA 3WAKA 4TX5A 4X65T 1QUUA 3FZKB 4L5GA 1FMWA 2K5BB 3P7IA 3PDYA 1SUMB 3S4UA 5AQLB 4PFOA 2KZ7B 1LVKA 1E2AA 2Y8DA 3VRAA 1HTJF 1US7B 2V5DA 2KWHA 4KMCA 3AE7A 2VKHA 4IL9A 5LCYA 4HWDA 3H37A 5IUXA 1DU2A 5AQOB 3UUMA 3O4XE 4EV6A 5C8YE 3AE1A 3B57A 3F2EA 1UX5A 3AECA 5LA6E 4BA9A 4LF7T 4M1PA 5FMNA 4EGWA 1X9BA 5CA0E 2XTLA 5FXWA 3F31A 3OPCA 3UUBA 3ZCJA 4U72A 3T1YT 1UK5A 2UXXB 2WS3A 3RYFE 4LFAT 3BQKA 4IE5A 2AE9A 2CXFA 5AQVB 5HXSA 3JC6C 3RYIE 2K9AA 4DNDA 5JDQA 3C4WA 4EXTA 1W0AA 1R8IA 4O4JE 3GMIA 3O1HA 2IC9A 3D0TA 3J7Yq 3ZEFB 3DP7A 2C0SA 2Q9QB 4EZ4A 3LK2B 2IW5B 2I0MA 3ZMTB 3ZLIA 3QC9A 4J2CA 2WSSV 2IC6A 4ASKA 5AQIB 2NW8A 3FZHB 5GONE 1T72A 3KV9A 1HF8A 3KV4A 2CEAA 4HFDA 2C5KT 1XDPA 3KBTA 3CWZB 4HTEA 5FL1A 4DV6T 2EHOB 4X20E 2M67A 2CE7A 3KVAA 4YFSA 5FYMA 1WFDA 4TNVA 4TWFA 2V6YB 5L3CB 5HEJA 4I0UA 1HNWT 1IJ5A 1UURA 4JBWG 4TQUN 2L3LA 4YSZA 2BZBA 2WWUA 2JJ9A 1OXZA 2WP9A 3HI2A 3PUGA 4YMTB 2WB5A 1YW0A 4HKAA 5LNKA 4OYJA 5J2TE 3PUWG 1YXRA 4MBQA 5AQGB 2QGSA 4TUYE 4QXCB 3TUIA 3U78A 3UUXB 1ZOYA 2CRBA 4DUZT 2H3RA 1HS7A 3IHRA 2LKHA 4WZXA 4IDZA 4TWHA 2BG9B 2W0GA 4UV9B 4UF0A 2HHHT 1ZEEA 5ABHA 5LGNB 1LKXA 3RIUC 5LHIB 2FJBA 1U5PA 3OYXA 2VURA 5AQJB 5L2LA 4UIGA 1IBMT 2V1DB 3FXDB 3N5LA 3DTOA 1OEDE 2WMOA 4YMVC 3N2GE 3PUSA 4PK6A 4U2YA 5AQKB 5H6RB 3ZN1B 3Q5XA 2VVSA 3BQLA 5ABEA 4GKKT 2Y6XA 3ANWA 2XQ7A 4X1IE 5ABGA 2ZM6T 4XAXB 3N2OA 2N1GA 5ADXL 4JEHB 4CI2B 4ZI2D 1M7KA 2LE8A 3UQ7A 2GK9A 2LSKA 2Z6EA 2NP9A 4YSYA 3VU7H 2ODVA 3EAMA 4DUYT 4IE7A 5FY1A 3Q5EA 1UX4A 3QB5K 3PUVF 4TV8E 4LF9T 3E22E 5KDMC 1N34T 4PJMA 3A5XA 2XAJB 3PTRB 5HXEA 3L3PA 5FVKA 3SFEA 3UFEA 2CBJA 5L3BB 4B3ST 3AXJA 4JUYA 2NTYA 3TUJA 2NW7A 4AIUA 3A7MA 1UUSA 2XHEB 1G8XA 3C4XA 2XJ7A 2I59A 1XZYA 3MXZA 4HFBA 4ILUA 2L9QA 2CWOA 3CX7B 1FMVA 2BBJA 3FB2A 4H63V 3RF1A 3RIAA 3ZMVB 5HEGA 5LGUB 3CMLA 4DR7T 2VVNA 4QX8B 1S94A 3K8PC 5JRCA 1NENA 2D0TA 2X67A 1OEDB 1M62A 4TN7B 2Y48B 3JAFA 3GN5B 4YMWC 2W2UA 2B76A 3NZPA 3N9OA 4U74A 1N32T 3P4RA 2ACZA 2A72A 4JBWF 3K1SA 3EDVA 5AQFB 2E9XD 4DV7T 4TQUM 1VCSA 2XSBA 4HWHA 4H9OC 3C64A 5L3GB 5LMNT 4GK5E 2IUBA 1XDOA 2VKDA 3ZYKA 4QXHB 3ZT5A 5C2TA 2KXPB 3ONXA 4X1YE 3MA9A 4CXXA 3ZC1A 4LMJA 1W9RA 4L9IA 2V7LA 5C3JA 1HX1B 2WDQA 1J1JA 3RIFA 3TLUA 4AKHA 1CHUA 3JC6D 3AEBA 5AQPB 3J9X1 4EEDA 5IWAT 5J0ZA 3PUXG 2QA7A 2V8SV 2V5CA 5KXJA 1IBLT 4A98A 4O4IE 2WCAA 4ILCA 4H9SE 2DNXA 1WYCA 2P9BA 2ZM2A 3AB3B 2WWVA 1FEWA 2W63A 5JH7E 5LGTB 5CFBA 4DR1T 2KINB 3EI0A 3RGLA 5FY7A 4IDOA 3K3OA 3ZT7A 2DWGA 2CXLA 2AXDS 2X9XA 2VL0A 3O1IA 4TWDA 2BKOA 2E5LT 3AAEB 3CKDA 2N9DA 3PUQA 4HN9A 4WNKA 3RLFG 2JQKA 3AEFA 4C91A 2ODUA 1J5WA 1KF6A 4HFIA 5AQUB 3UFGA 1YQ3A 3EABA 1JNZA 4HGAA 5AQTB 3SRZA 3SOLA 5LHHB 4JI1T 3PURA 5HEOA 3ZT6A 4X66T 1J5ET 2VWAA 2BG9C 1T8BA 3EUHA 4U7IA 2LSYA 5ETWA 3LBXB 5HWYA 3BQIA 4P09A 4JI2T 3V5UA 5JDGA 4HFVA 3P50A 2IIUA 2JIWA 2LJLA 2X0LB 2J47A 4KX6A 3ZN0B 2W4XA 4DV1T 2SPCA 3TUZA 1MMDA 1VRBA 1D0XA 3NBXX 3PV0F 4XIGM 4IL4A 3IEEA 3Q2MA 4CXYA 4NUVA 4PJJA 4DR2T 3D31C 4COFA 3VKGA 3OJAA 5DJQC 4JI3T 5AFUL 2UXDT 4NUUA 2PBIA 5FP3A 4YXDA 2ES0A 4YMUC 4OHFA 4YJ3E 2WZHA 1HG2A 1W0BA 2LM2A 3O1JA 3KDSE 3L39A 2UU9T 4AKGA 4NIQA 4AI6A 2ACXA 2XQYA 3SFDA 3ZJ1A 2E9XA 2M6IA 4ILAA 4U2ZA 4CN1A 5KMGP 5FXXA 5JREA 2HPJA 2RPAA 3CVRA 2KSRA 3OKQA 2PTFA 2MOZA 3UU5A 4E7SA 4EZHA 3CQCB 4FI5A 3Q5WA 2XSAA 5FNVE 2OA5A 4YTPA 1T98A 3VHLA 2JQHA 4DR6T 4BJMA 2XASB 2VKJA 2X68A 1MMAA 4KBMB 3CQXC 4K0KT 4GK0E 5DQWA 4HFHA 5L3FB 3PJAA 1Z0PA 4X64T 3AVSA 2CCQA 4OFZA 3MJXA 2LSJA 2PFVA 3PUVG 2YK0A 1CUNA 3MK7C 3N2KE 4IREA 3RKGA 3RPUA 3VR9A 4CZZB 2V7IA 4E7ZA 1WLXA 5LJNA 1D1CA 4AQYT 1ZKEA 2K3WA 3ONLC 2V7JA 1T7SA 4LMKA 3T8OA 3TLTA 3RKOA 5E0OA 4YJ2E 4OK0A 3ZYMA 4PW8A 3B5MA 5LXTE 1HNXT 2R6GF 1LVFA 3LSVA 2VK9A 2ZM0A 5IYZE 2WDVA 3N9LA 3N9MA 2XPKA 4HFCA 4JEUB 3R6NA 4DBRA 1UGOA 2PG8A 2X0YA 5HCJA 1D1BA 1JNRA 2XM1A 4HE8A 5LMUT 2E9XC 4IE6A 4YTNA 1BR4A 1W09A 5FXVA 4CI3B 2LRKA 4IHJE 4MLKA 3OTOT 2J4GA 3O9XA 4ZS2A 2XQ6A 4YTMA 3TLWA 3C98B 2V7KA 3UUNA 1IBKT 3ZJ2A 2BS4A 2Q9QD 3T1HT 5J1GA 3N9PA 4AXPA 2CLYC 4AKLA 4YHJA 4DBQA 3TLSA 5LB7B 1N36T 5AQQB 2DHRA 4WBOA 1D1AA 1I94T 2DCFA 4Z91A 4I50E 4ERRA 2XQAA 2NW9A 1MMNA 4B3MT 4ZEYA
chains in the Genus database with same CATH topology
2ONKC 3PV0G 4JBWG 4TQUM 4TQUN 3RLFG 3RLFF 3PUVF 4YMTB 3PUZG 3PUWG 3TUIA 4XTCN 3TUJA 3PUYF 4XTCM 3PUXF 3PUYG 3PUXG 2R6GG 4XIGN 3TUZA 3PUVG 3PV0F 4XIGM 3DHWA 3PUZF 3PUWF 4KI0F 4YMVC 3D31C 4KI0G 4YMUC 4YMSC 4YMWC 4KHZG 4KHZF 4JBWF 2R6GF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONK C;  3PV0 G;  4JBW G;  4TQU M;  4TQU N;  3RLF G;  3RLF F;  3PUV F;  4YMT B;  3PUZ G;  3PUW G;  3TUI A;  4XTC N;  3TUJ A;  3PUY F;  4XTC M;  3PUX F;  3PUY G;  3PUX G;  2R6G G;  4XIG N;  3TUZ A;  3PUV G;  3PV0 F;  4XIG M;  3DHW A;  3PUZ F;  3PUW F;  4KI0 F;  4YMV C;  3D31 C;  4KI0 G;  4YMU C;  4YMS C;  4YMW C;  4KHZ G;  4KHZ F;  4JBW F;  2R6G F; 
#chains in the Genus database with same CATH topology
 1SA0 E;  4YY3 T;  3NWI A;  5L4H A;  4MHC A;  2JMH A;  2Q9Q A;  4B6X A;  2L8K A;  3EHZ A;  3AAA B;  4GYS A;  4ZS3 A;  5DQV A;  5HEH A;  3H3M A;  4CN4 A;  4DMV A;  1XMO T;  2H89 A;  5ABF A;  3MKD A;  2FJD A;  2QYW A;  3UUL A;  1MIW A;  3LDQ B;  3LK4 2;  2ZM8 A;  2BS3 A;  3AEE A;  2UUC T;  4YSX A;  2JPF A;  4JI4 T;  2XQ4 A;  3AE9 A;  3IF8 B;  3RH3 A;  1E1H B;  1ZP0 A;  3AE3 A;  3TKL B;  3WI3 A;  3RC8 A;  3LJC A;  4DR4 T;  1BR0 A;  4DV5 T;  3ZMZ B;  3AA6 B;  2YEV C;  4PK5 A;  5LBM A;  4EYU A;  2XUE A;  4AQF A;  3AAI A;  3HKD E;  4AKI A;  4GIW A;  2NR4 A;  3C50 A;  4L0R A;  3PUW F;  4H9R C;  4DID B;  2MYS A;  1YQ4 A;  2OV9 A;  2D5U A;  2CWY A;  5JDF A;  3GWH A;  5LBQ B;  4CN6 A;  4KHP T;  5AQS B;  2LHN A;  2KWI B;  1D0Y A;  2K24 A;  4QH1 A;  2LHR A;  3Q9D A;  5JDL A;  3NZQ A;  4DV0 T;  1VCT A;  5HXR A;  4IDQ A;  3PV0 G;  2JQ9 A;  4UVC B;  1L0V A;  5L3D B;  2IAK A;  2XAG B;  3UT5 E;  3P4P A;  4LF5 T;  3RI5 A;  1KNR A;  1QLB A;  3B13 A;  4EAH A;  2LSG A;  2XAQ B;  3PUZ G;  2VB6 A;  2K48 A;  4K0U A;  4ADZ A;  4DV2 T;  4LFC T;  3FBL A;  4WBN E;  3CPZ A;  4ZI3 D;  3AA0 B;  2A3D A;  4JI7 T;  2CM0 A;  2ZMA A;  1MIV A;  2I6H A;  3X1D A;  1Y01 A;  3PU8 A;  4XTC M;  3PUX F;  3JAE A;  2KT9 A;  2LRL A;  5EZY E;  5JRC B;  1V9D A;  2X9H A;  2YN6 A;  2H7O A;  3DJB A;  4WYV A;  1IZN B;  5CB4 E;  2LOP A;  5AQH B;  3VR8 A;  2DLR A;  4KI0 F;  3PUZ F;  1BR1 A;  1MIY A;  1NWM X;  1WR6 A;  2XQ8 A;  3CIR A;  3PJA J;  4I43 B;  1AJ3 A;  2BBH A;  3KBU A;  1ZV4 X;  2IML A;  3L8R A;  4A97 A;  3ZKR A;  4ZI2 C;  1H7C A;  2W00 A;  3R84 B;  1HCI A;  2W67 A;  5HXC A;  3VKH A;  3CQG B;  4HFE A;  4ANJ A;  4XBF B;  3AE2 A;  3E0Z A;  4HWC A;  2V7M A;  3AXJ B;  3ETV A;  2LOS A;  4LFB T;  2A2F X;  2V6Y A;  4I55 E;  4IE0 A;  4IT4 A;  4U31 A;  2G0U A;  4UR9 A;  5FKY A;  4GYR A;  5LHG B;  1MND A;  4IIJ E;  2E9X B;  4CQI A;  2HH7 A;  3HKB E;  5HEU A;  3RYH E;  3P4W A;  3QB5 A;  2XAH B;  3SWH A;  5F3J A;  5JTG A;  3ONJ A;  2X51 A;  2QVA A;  3RHW A;  1KNZ A;  4TZ4 C;  4ZHQ E;  5A1L A;  4UV8 B;  2OLT A;  4OX9 T;  3I0O A;  2BS2 A;  3CX6 B;  4MAL A;  3C51 A;  3OYZ A;  2FUP A;  4P1N A;  2YU1 A;  5L3E B;  2WQY A;  1NEK A;  4JLE A;  1Y64 B;  4CXW A;  2CHN A;  1S35 A;  1B7T A;  1BR2 A;  1X79 A;  2HPL A;  2WZI A;  2ZLY A;  4EOZ B;  4JYA T;  2RP4 A;  3K3Q C;  4DV3 T;  3RRC A;  2J62 A;  4DR5 T;  1FIO A;  2VAS A;  2E8I A;  4KHZ G;  2H88 A;  2YDQ A;  3AE5 A;  4KUM B;  4QH5 A;  2MBG A;  3RC3 A;  1HR0 T;  2UXC T;  4QHO A;  2KMF A;  2W66 A;  1KEY A;  4GOU A;  4ZZB A;  1D0Z A;  4G63 A;  3FZF B;  3NKZ A;  5BMV E;  5HCM A;  3ZSS A;  4HWF A;  2YDR A;  5HXH A;  2CBI A;  3RQW A;  4BJN A;  1QSD A;  1SE7 A;  3PUA A;  4N78 D;  2D9D A;  3WAJ A;  2CPT A;  1MNE A;  5LP6 E;  4F8H A;  1YKH B;  5FL0 A;  4NXN T;  2YKS A;  1GQE A;  2VKO A;  5CGM A;  3QUJ A;  3P8C D;  3PUY F;  4B3T T;  3RX6 A;  1NAF A;  3NRX A;  3ZC0 A;  4ISS A;  4Z8X A;  1VOM A;  1YKE B;  2N2N A;  2X0H A;  4HEA A;  3I9W A;  1OED A;  2EHO D;  3AE4 A;  4PJN A;  1OWA A;  1HFA A;  3F57 A;  4O4L E;  3ZYL A;  4HWI B;  2HN2 A;  3W15 B;  2M6B A;  2IDO B;  1IJ6 A;  2YDS A;  3PU3 A;  3BK9 A;  4B3R T;  4UVB B;  4YMS C;  2CHO A;  1WR0 A;  2LEH A;  2QRX A;  3N9Q A;  3PE0 A;  2WU2 A;  5HYA A;  3KIN B;  3FHN A;  4EEB A;  5JDH A;  3HKE E;  4QWN B;  4EYY R;  2CLY B;  3VRB A;  3AE6 A;  2A9U A;  1HG5 A;  2C5I T;  3P4S A;  4O4H E;  4U3C A;  5JDM A;  4PFP A;  2MPK A;  2FJA A;  2YOE A;  3C4Z A;  3AED A;  2XQ5 A;  2LLY A;  3MAC A;  5BR8 T;  3SS1 A;  3UU3 A;  2XZE A;  3M3Z B;  3MZK B;  2W62 A;  4P0A A;  3FZL B;  2XM2 A;  4NPP A;  4IST A;  3I0Q A;  2J1D G;  3UU8 A;  4ZXL A;  5HWX A;  4Q25 A;  3UTK A;  1WYB A;  2R6G G;  3G06 A;  3P4Q A;  5HAX A;  4TNW A;  2XY8 B;  2WU5 A;  2X66 A;  4ZI3 C;  2VQE T;  3M65 A;  2BG9 A;  5LOV E;  5FXZ A;  4UF0 B;  3HKC E;  4OYK A;  1WRD A;  3ZPO A;  4ZZC A;  5KX5 E;  3ETU A;  5EK3 A;  2WMN A;  2CMR A;  3E08 A;  2XQ9 A;  3ZMS B;  3ZMU B;  2JRK A;  5EK4 A;  2RA1 A;  4A5X A;  5JDN A;  5LYJ E;  4XZC A;  4AIS A;  3AE8 A;  4JI8 T;  2YU2 A;  2Q9Q C;  5CA1 E;  3TLV A;  1ZHC A;  3NVO A;  4PNI A;  5JVD E;  1E7P A;  2YIN A;  2HN1 A;  3K3N A;  3OVU A;  4EB6 E;  4U33 A;  3IBP A;  4UEL A;  2WM9 A;  1U4Q A;  4P0B A;  3UQ4 A;  1XWM A;  2W61 A;  4O8S A;  1EZ3 A;  2WAU A;  4WW0 A;  2MTQ A;  3AEG A;  4YT0 A;  2BG9 E;  4DV4 T;  1HX8 A;  2E5V A;  4IDN A;  3LG7 A;  2UXN B;  4IE4 A;  4BAY B;  3AEA A;  5CJ5 A;  4UEM A;  4LF8 T;  4QKN A;  2H7V C;  4LF4 T;  3FXE B;  3LBX A;  2EHO A;  3KV5 A;  3V5S A;  1KFY A;  5J2U E;  4ILB A;  4DO0 A;  4KI0 G;  1UCU A;  2B1E A;  5FVL A;  1I6Z A;  3U3I A;  4I4T E;  5LJM A;  2BKP A;  3ZCI A;  3QOF A;  4KP3 C;  1KNP A;  3HL6 A;  2BVL A;  2NOX A;  2X9Y A;  2KLQ A;  4X1K E;  3H3A A;  2ONK C;  2DI4 A;  3GN5 A;  5L4E A;  4DVD A;  2X9W A;  1KK7 A;  3LK3 B;  4H9P C;  2VL8 A;  3AVR A;  2JMK A;  3AA1 B;  3HR0 A;  2DL1 A;  2VQF T;  5DAB A;  4LML A;  3QNU A;  4JI6 T;  2C5J A;  4LF6 T;  3I9Y A;  4G2A A;  5F8P A;  2LM9 A;  2CA5 A;  1YD8 G;  3FZM B;  2BDE A;  3I1A A;  5JR9 A;  5AQR B;  1XMQ T;  3ANW B;  4ZI7 E;  3N9N A;  4QXB B;  4JI5 T;  4QX7 B;  4YLH A;  3QK6 A;  1XNQ T;  3KFW X;  4TV9 E;  5LG3 A;  5L47 A;  2F4V T;  5AQM B;  5F5W A;  4PJL A;  3RIU A;  1SHZ C;  3UU4 A;  2D2S A;  3LFM A;  5JR9 B;  1G73 A;  4O2A E;  4JV5 T;  2UUB T;  2BVM A;  2FBW A;  5JQG E;  2JQQ A;  3OBV E;  1MMG A;  2LKG A;  2EHO C;  4A56 A;  4GKJ T;  5IHY A;  4KHZ F;  4XIG N;  4MFR A;  5LG4 A;  2E2A A;  3FBZ A;  3KV6 A;  4FJO A;  3RLF F;  2LT3 A;  2XAF B;  4PAG A;  3RYC E;  4AKR B;  4EIW A;  4QH4 A;  3EDU A;  3RQU A;  4AQG A;  1Z8U A;  4DMW A;  1WCR A;  2LSI A;  5H6Q B;  4F6R C;  4XTC N;  2WDR A;  2XQ3 A;  3L09 A;  1OED C;  4IGU A;  4PK4 A;  4X5T A;  5AQN B;  4DR3 T;  4U7Y A;  3PUY G;  3Q5D A;  5M4Y A;  4C90 A;  2NWB A;  4H63 H;  3IA3 A;  1HNZ T;  2KND A;  2WY2 A;  4Z90 A;  3NRY A;  1LRZ A;  4O2B E;  2MAW A;  1IAP A;  3DHW A;  2UXB T;  4YHH T;  1O3X A;  3ESL A;  3UU6 A;  4X62 T;  4UXN B;  4CI1 B;  3GA8 A;  4IDP A;  5JR9 C;  2UUA T;  1XNR T;  3JCF A;  2WBL A;  5EK2 A;  3ABV A;  1FJG T;  2DWK A;  2D0U A;  4H9Q C;  4H9N C;  2FJE A;  4AQF C;  4JI0 T;  3CK6 A;  4UVA B;  5ABF B;  3ZST A;  1N33 T;  4ZOL E;  3HA4 A;  2NTX A;  2PJQ A;  3RRW A;  2V26 A;  4V1A v;  3CX8 B;  4NXM T;  2BKN A;  3JAD A;  2CXD A;  3EVY A;  2V6X A;  2IHR 1;  3AA7 B;  3KVB A;  3A8Y C;  5FY0 A;  5TAO A;  3WAK A;  4TX5 A;  4X65 T;  1QUU A;  3FZK B;  4L5G A;  1FMW A;  2K5B B;  3P7I A;  3PDY A;  1SUM B;  3S4U A;  5AQL B;  4PFO A;  2KZ7 B;  1LVK A;  1E2A A;  2Y8D A;  3VRA A;  1HTJ F;  1US7 B;  2V5D A;  2KWH A;  4KMC A;  3AE7 A;  2VKH A;  4IL9 A;  5LCY A;  4HWD A;  3H37 A;  5IUX A;  1DU2 A;  5AQO B;  3UUM A;  3O4X E;  4EV6 A;  5C8Y E;  3AE1 A;  3B57 A;  3F2E A;  1UX5 A;  3AEC A;  5LA6 E;  4BA9 A;  4LF7 T;  4M1P A;  5FMN A;  4EGW A;  1X9B A;  5CA0 E;  2XTL A;  5FXW A;  3F31 A;  3OPC A;  3UUB A;  3ZCJ A;  4U72 A;  3T1Y T;  1UK5 A;  2UXX B;  2WS3 A;  3RYF E;  4LFA T;  3BQK A;  4IE5 A;  2AE9 A;  2CXF A;  5AQV B;  5HXS A;  3JC6 C;  3RYI E;  2K9A A;  4DND A;  5JDQ A;  3C4W A;  4EXT A;  1W0A A;  1R8I A;  4O4J E;  3GMI A;  3O1H A;  2IC9 A;  3D0T A;  3J7Y q;  3ZEF B;  3DP7 A;  2C0S A;  2Q9Q B;  4EZ4 A;  3LK2 B;  2IW5 B;  2I0M A;  3ZMT B;  3ZLI A;  3QC9 A;  4J2C A;  2WSS V;  2IC6 A;  4ASK A;  5AQI B;  2NW8 A;  3FZH B;  5GON E;  1T72 A;  3KV9 A;  1HF8 A;  3KV4 A;  2CEA A;  4HFD A;  2C5K T;  1XDP A;  3KBT A;  3CWZ B;  4HTE A;  5FL1 A;  4DV6 T;  2EHO B;  4X20 E;  2M67 A;  2CE7 A;  3KVA A;  4YFS A;  5FYM A;  1WFD A;  4TNV A;  4TWF A;  2V6Y B;  5L3C B;  5HEJ A;  4I0U A;  1HNW T;  1IJ5 A;  1UUR A;  4JBW G;  4TQU N;  2L3L A;  4YSZ A;  2BZB A;  2WWU A;  2JJ9 A;  1OXZ A;  2WP9 A;  3HI2 A;  3PUG A;  4YMT B;  2WB5 A;  1YW0 A;  4HKA A;  5LNK A;  4OYJ A;  5J2T E;  3PUW G;  1YXR A;  4MBQ A;  5AQG B;  2QGS A;  4TUY E;  4QXC B;  3TUI A;  3U78 A;  3UUX B;  1ZOY A;  2CRB A;  4DUZ T;  2H3R A;  1HS7 A;  3IHR A;  2LKH A;  4WZX A;  4IDZ A;  4TWH A;  2BG9 B;  2W0G A;  4UV9 B;  4UF0 A;  2HHH T;  1ZEE A;  5ABH A;  5LGN B;  1LKX A;  3RIU C;  5LHI B;  2FJB A;  1U5P A;  3OYX A;  2VUR A;  5AQJ B;  5L2L A;  4UIG A;  1IBM T;  2V1D B;  3FXD B;  3N5L A;  3DTO A;  1OED E;  2WMO A;  4YMV C;  3N2G E;  3PUS A;  4PK6 A;  4U2Y A;  5AQK B;  5H6R B;  3ZN1 B;  3Q5X A;  2VVS A;  3BQL A;  5ABE A;  4GKK T;  2Y6X A;  3ANW A;  2XQ7 A;  4X1I E;  5ABG A;  2ZM6 T;  4XAX B;  3N2O A;  2N1G A;  5ADX L;  4JEH B;  4CI2 B;  4ZI2 D;  1M7K A;  2LE8 A;  3UQ7 A;  2GK9 A;  2LSK A;  2Z6E A;  2NP9 A;  4YSY A;  3VU7 H;  2ODV A;  3EAM A;  4DUY T;  4IE7 A;  5FY1 A;  3Q5E A;  1UX4 A;  3QB5 K;  3PUV F;  4TV8 E;  4LF9 T;  3E22 E;  5KDM C;  1N34 T;  4PJM A;  3A5X A;  2XAJ B;  3PTR B;  5HXE A;  3L3P A;  5FVK A;  3SFE A;  3UFE A;  2CBJ A;  5L3B B;  4B3S T;  3AXJ A;  4JUY A;  2NTY A;  3TUJ A;  2NW7 A;  4AIU A;  3A7M A;  1UUS A;  2XHE B;  1G8X A;  3C4X A;  2XJ7 A;  2I59 A;  1XZY A;  3MXZ A;  4HFB A;  4ILU A;  2L9Q A;  2CWO A;  3CX7 B;  1FMV A;  2BBJ A;  3FB2 A;  4H63 V;  3RF1 A;  3RIA A;  3ZMV B;  5HEG A;  5LGU B;  3CML A;  4DR7 T;  2VVN A;  4QX8 B;  1S94 A;  3K8P C;  5JRC A;  1NEN A;  2D0T A;  2X67 A;  1OED B;  1M62 A;  4TN7 B;  2Y48 B;  3JAF A;  3GN5 B;  4YMW C;  2W2U A;  2B76 A;  3NZP A;  3N9O A;  4U74 A;  1N32 T;  3P4R A;  2ACZ A;  2A72 A;  4JBW F;  3K1S A;  3EDV A;  5AQF B;  2E9X D;  4DV7 T;  4TQU M;  1VCS A;  2XSB A;  4HWH A;  4H9O C;  3C64 A;  5L3G B;  5LMN T;  4GK5 E;  2IUB A;  1XDO A;  2VKD A;  3ZYK A;  4QXH B;  3ZT5 A;  5C2T A;  2KXP B;  3ONX A;  4X1Y E;  3MA9 A;  4CXX A;  3ZC1 A;  4LMJ A;  1W9R A;  4L9I A;  2V7L A;  5C3J A;  1HX1 B;  2WDQ A;  1J1J A;  3RIF A;  3TLU A;  4AKH A;  1CHU A;  3JC6 D;  3AEB A;  5AQP B;  3J9X 1;  4EED A;  5IWA T;  5J0Z A;  3PUX G;  2QA7 A;  2V8S V;  2V5C A;  5KXJ A;  1IBL T;  4A98 A;  4O4I E;  2WCA A;  4ILC A;  4H9S E;  2DNX A;  1WYC A;  2P9B A;  2ZM2 A;  3AB3 B;  2WWV A;  1FEW A;  2W63 A;  5JH7 E;  5LGT B;  5CFB A;  4DR1 T;  2KIN B;  3EI0 A;  3RGL A;  5FY7 A;  4IDO A;  3K3O A;  3ZT7 A;  2DWG A;  2CXL A;  2AXD S;  2X9X A;  2VL0 A;  3O1I A;  4TWD A;  2BKO A;  2E5L T;  3AAE B;  3CKD A;  2N9D A;  3PUQ A;  4HN9 A;  4WNK A;  3RLF G;  2JQK A;  3AEF A;  4C91 A;  2ODU A;  1J5W A;  1KF6 A;  4HFI A;  5AQU B;  3UFG A;  1YQ3 A;  3EAB A;  1JNZ A;  4HGA A;  5AQT B;  3SRZ A;  3SOL A;  5LHH B;  4JI1 T;  3PUR A;  5HEO A;  3ZT6 A;  4X66 T;  1J5E T;  2VWA A;  2BG9 C;  1T8B A;  3EUH A;  4U7I A;  2LSY A;  5ETW A;  3LBX B;  5HWY A;  3BQI A;  4P09 A;  4JI2 T;  3V5U A;  5JDG A;  4HFV A;  3P50 A;  2IIU A;  2JIW A;  2LJL A;  2X0L B;  2J47 A;  4KX6 A;  3ZN0 B;  2W4X A;  4DV1 T;  2SPC A;  3TUZ A;  1MMD A;  1VRB A;  1D0X A;  3NBX X;  3PV0 F;  4XIG M;  4IL4 A;  3IEE A;  3Q2M A;  4CXY A;  4NUV A;  4PJJ A;  4DR2 T;  3D31 C;  4COF A;  3VKG A;  3OJA A;  5DJQ C;  4JI3 T;  5AFU L;  2UXD T;  4NUU A;  2PBI A;  5FP3 A;  4YXD A;  2ES0 A;  4YMU C;  4OHF A;  4YJ3 E;  2WZH A;  1HG2 A;  1W0B A;  2LM2 A;  3O1J A;  3KDS E;  3L39 A;  2UU9 T;  4AKG A;  4NIQ A;  4AI6 A;  2ACX A;  2XQY A;  3SFD A;  3ZJ1 A;  2E9X A;  2M6I A;  4ILA A;  4U2Z A;  4CN1 A;  5KMG P;  5FXX A;  5JRE A;  2HPJ A;  2RPA A;  3CVR A;  2KSR A;  3OKQ A;  2PTF A;  2MOZ A;  3UU5 A;  4E7S A;  4EZH A;  3CQC B;  4FI5 A;  3Q5W A;  2XSA A;  5FNV E;  2OA5 A;  4YTP A;  1T98 A;  3VHL A;  2JQH A;  4DR6 T;  4BJM A;  2XAS B;  2VKJ A;  2X68 A;  1MMA A;  4KBM B;  3CQX C;  4K0K T;  4GK0 E;  5DQW A;  4HFH A;  5L3F B;  3PJA A;  1Z0P A;  4X64 T;  3AVS A;  2CCQ A;  4OFZ A;  3MJX A;  2LSJ A;  2PFV A;  3PUV G;  2YK0 A;  1CUN A;  3MK7 C;  3N2K E;  4IRE A;  3RKG A;  3RPU A;  3VR9 A;  4CZZ B;  2V7I A;  4E7Z A;  1WLX A;  5LJN A;  1D1C A;  4AQY T;  1ZKE A;  2K3W A;  3ONL C;  2V7J A;  1T7S A;  4LMK A;  3T8O A;  3TLT A;  3RKO A;  5E0O A;  4YJ2 E;  4OK0 A;  3ZYM A;  4PW8 A;  3B5M A;  5LXT E;  1HNX T;  2R6G F;  1LVF A;  3LSV A;  2VK9 A;  2ZM0 A;  5IYZ E;  2WDV A;  3N9L A;  3N9M A;  2XPK A;  4HFC A;  4JEU B;  3R6N A;  4DBR A;  1UGO A;  2PG8 A;  2X0Y A;  5HCJ A;  1D1B A;  1JNR A;  2XM1 A;  4HE8 A;  5LMU T;  2E9X C;  4IE6 A;  4YTN A;  1BR4 A;  1W09 A;  5FXV A;  4CI3 B;  2LRK A;  4IHJ E;  4MLK A;  3OTO T;  2J4G A;  3O9X A;  4ZS2 A;  2XQ6 A;  4YTM A;  3TLW A;  3C98 B;  2V7K A;  3UUN A;  1IBK T;  3ZJ2 A;  2BS4 A;  2Q9Q D;  3T1H T;  5J1G A;  3N9P A;  4AXP A;  2CLY C;  4AKL A;  4YHJ A;  4DBQ A;  3TLS A;  5LB7 B;  1N36 T;  5AQQ B;  2DHR A;  4WBO A;  1D1A A;  1I94 T;  2DCF A;  4Z91 A;  4I50 E;  4ERR A;  2XQA A;  2NW9 A;  1MMN A;  4B3M T;  4ZEY A; 
#chains in the Genus database with same CATH homology
 2ONK C;  3PV0 G;  4JBW G;  4TQU M;  4TQU N;  3RLF G;  3RLF F;  3PUV F;  4YMT B;  3PUZ G;  3PUW G;  3TUI A;  4XTC N;  3TUJ A;  3PUY F;  4XTC M;  3PUX F;  3PUY G;  3PUX G;  2R6G G;  4XIG N;  3TUZ A;  3PUV G;  3PV0 F;  4XIG M;  3DHW A;  3PUZ F;  3PUW F;  4KI0 F;  4YMV C;  3D31 C;  4KI0 G;  4YMU C;  4YMS C;  4YMW C;  4KHZ G;  4KHZ F;  4JBW F;  2R6G F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...