3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
2R6GF 3RLFG 3D31C 3PUWG 4XIGM 4YMVC 4JBWF 3PUYG 3PUVG 4TQUM 3PUZF 4XTCN 4KHZG 3TUIA 4YMSC 4YMTB 3PV0G 4KI0G 2R6GG 3PUXF 4YMUC 3PUYF 4JBWG 4XIGN 3PUZG 4YMWC 3PUWF 4KI0F 3RLFF 3PUVF 2ONKC 4TQUN 3TUZA 4XTCM 4KHZF 3PUXG 3DHWA 3TUJA 3PV0F
chains in the Genus database with same CATH superfamily
5ABFB 1X79A 3ZMSB 1UURA 2X9XA 4UVCB 3HR0A 2YINA 2KMFA 2D0UA 3ZLIA 2ZLYA 3NZPA 4GYSA 3ZCIA 1WR6A 1NEKA 4AXPA 4AQGA 3MZKB 2X9WA 1ZV4X 3KV9A 3TUJA 5CA0E 4DR5T 3F2EA 3JC6D 3O4XE 3P4SA 4EV6A 4HWFA 4GYRA 3ZCJA 4P09A 5C2TA 4U3CA 2VKOA 3QB5A 2XJ7A 5KXJA 4XTCN 3RX6A 3AE5A 5F5WA 1AJ3A 2R6GG 4X65T 3JC6C 1OEDB 2VKJA 2VL8A 4HKAA 2IIUA 3RRWA 2CRBA 4JI1T 4LMKA 4DR7T 2XHEB 4LF9T 1OEDC 5LOVE 2C5KT 1JNRA 2ODVA 4X1KE 1IJ6A 2WS3A 3DHWA 1SUMB 1FMVA 4A56A 4TWHA 2V1DB 2XAGB 3PDYA 4UV8B 4WBOA 4EYYR 5BR8T 2XZEA 3PUWF 3K8PC 4GOUA 3AE2A 3RRCA 3FZMB 1HFAA 1MNEA 2AE9A 4ZS3A 4WW0A 2ODUA 1YD8G 1T8BA 4YFSA 3AVRA 2KT9A 3AB3B 4O2AE 3G06A 2VVNA 2J47A 4BJNA 2QRXA 2LHRA 3CK6A 4PFPA 4Q25A 3VKGA 4LF5T 2UXCT 5FMNA 2WY2A 3F31A 4WNKA 4AQFC 1HX8A 1MIYA 3PV0F 2F4VT 5TAOA 2LT3A 5DABA 2WMNA 1XDPA 4PAGA 2HN2A 3KV5A 4UXNB 2V7IA 3AE8A 3CX8B 3UTKA 4X1YE 5KX5E 3ZT6A 2XSAA 3N9PA 1CHUA 4X66T 2WZHA 3ANWA 4Z90A 5L4HA 5AFUL 1XMQT 2X67A 2ZM8A 4JI3T 5LMUT 3JAFA 3BQLA 2EHOD 3UUBA 1VRBA 3SRZA 3EDVA 5KDMC 2VQET 4O4LE 4DV5T 4EGWA 3U3IA 3TUIA 3EI0A 2OV9A 2PTFA 3P50A 5JH7E 4EZHA 3ZPOA 2DWGA 2ACXA 3PUAA 1V9DA 5J1GA 3ZJ1A 3T8OA 3IA3A 3A8YC 3LJCA 2Q9QC 4PJMA 4KUMB 4JLEA 4JI2T 3FZHB 2V6YA 3PUQA 4TWDA 4MBQA 2LSYA 2EHOC 2RA1A 3CQGB 4YXDA 2X0HA 4B6XA 4YJ2E 4TUYE 5J2TE 1WCRA 2Q9QA 4X64T 2KSRA 5LBQB 1U4QA 3JCFA 3FZFB 3D0TA 5AQGB 4ADZA 5L3EB 1MMGA 2EHOA 2I0MA 2CPTA 2JPFA 4P0AA 1JNZA 2PG8A 2A3DA 3Q5WA 4IL9A 3FZKB 3JADA 4CXXA 3C51A 2MOZA 2XQAA 3I0OA 2KZ7B 4DV7T 4FJOA 4TNWA 4IHJE 4OFZA 1NENA 2QA7A 3DJBA 2JRKA 4U7YA 1US7B 4UELA 4HFEA 1ZHCA 4ZEYA 1X9BA 3RQUA 2JMHA 5LB7B 3P4RA 1XZYA 2NOXA 2X51A 4TNVA 3ZT5A 4FI5A 5LGTB 4UV9B 3KDSE 5HEJA 3ZYKA 5LHGB 1MNDA 1LRZA 5JR9B 2VKDA 5BMVE 4EEDA 4AI6A 2ACZA 2IUBA 3UU4A 5CJ5A 4IE6A 4DMWA 4JBWG 2LSGA 2XQ9A 4ILAA 5JR9C 3AVSA 2W2UA 4DIDB 2D2SA 1HNWT 4M1PA 1YKHB 3AE6A 3ESLA 4YT0A 3ZT7A 2QGSA 3P4PA 5FL0A 1CUNA 3OVUA 5LMNT 1N34T 4GK0E 3UFGA 5FXZA 2K24A 2Y48B 1GQEA 1HF8A 3FXEB 2H7VC 4HN9A 2CA5A 3RH3A 2JQ9A 4DV1T 3UU8A 4H9OC 2BG9B 4XIGM 4HFVA 5ABGA 2JMKA 4LMLA 4HWHA 3LBXB 2M6IA 2CXLA 2IDOB 4OX9T 3AXJB 2IC6A 3ZMTB 2BG9C 5JDFA 2V8SV 2CHNA 2VASA 1MMDA 5HWXA 3MXZA 2KWIB 3PTRB 4TV9E 4K0UA 5JDHA 2X66A 2LRKA 2NW8A 5J0ZA 1BR0A 5FP3A 4KI0G 3RC3A 4JEHB 3KBTA 3AE4A 1UCUA 2YEVC 4ZI2D 2KNDA 3ZN1B 4GKKT 5FY7A 5M4YA 4B3TT 3IF8B 3N2KE 3ZMUB 2Z6EA 4TQUM 4I50E 4COFA 4YMSC 3SWHA 1J5WA 2X9HA 5HCMA 4QH1A 3KV6A 5AQLB 3A7MA 2K48A 3LK3B 2YDRA 1YKEB 4UEMA 3JAEA 3UFEA 2H7OA 4ZI2C 3RIAA 3N9NA 3GN5B 3RGLA 4E7ZA 4L9IA 2CWYA 1MIVA 3LG7A 3RYIE 3AAAB 2ONKC 3CVRA 2WCAA 1WLXA 4JI7T 2XQ8A 5LJNA 3PUXF 5ABHA 4OK0A 2JQHA 3TLVA 4ZS2A 4TQUN 4XAXB 4JI6T 3RYCE 4ZZBA 4OYJA 4JI0T 2LM9A 5LG3A 2WWVA 3RHWA 4JBWF 2XSBA 4XZCA 3WAKA 5DQVA 1HNXT 1KNPA 3BQIA 3PUZG 4XTCM 4LFBT 2ZM6T 4U72A 5LBMA 3DTOA 3P4WA 4YHJA 3ZC1A 5L3FB 5F3JA 4V1Av 3AEEA 1D0XA 3AA0B 5JDQA 5L3BB 2BVMA 4UF0B 4ISSA 4QWNB 5H6RB 4OYKA 3ZMZB 2LHNA 4PJNA 4HFDA 1FJGT 3AAEB 3ETVA 4EAHA 4H9SE 4DUZT 4CQIA 2IAKA 5GONE 5ABFA 5L3DB 3RLFF 4LMJA 4KI0F 2CBIA 3I0QA 2OA5A 2XAJB 5FXXA 2DI4A 3B57A 4YTNA 4K0KT 1I94T 4YTPA 3UULA 2YDQA 4EYUA 2ZMAA 3OYZA 4IT4A 2NW9A 5CA1E 2LKHA 5E0OA 1UX5A 4U2ZA 3EUHA 1N33T 3LSVA 2X0LB 4I0UA 4BA9A 5CGMA 2L3LA 2BS2A 3FZLB 4EXTA 3H3AA 5LXTE 4ZI7E 4HGAA 1YQ3A 1OEDA 5FXVA 2Y6XA 2LSIA 3PUGA 5HYAA 2NTXA 2WSSV 3HKBE 1N32T 4B3RT 3MK7C 3ONJA 1EZ3A 2WZIA 3DP7A 2E9XB 1WR0A 2WP9A 4OHFA 5ABEA 1LKXA 2NW7A 3K3NA 2NWBA 4CN6A 5HEHA 3UUNA 3VR9A 4KBMB 4YTMA 3U78A 3R84B 2B1EA 3P7IA 4DVDA 3ZJ2A 3LK42 5JREA 3Q5XA 2QVAA 2BS3A 2B76A 3MA9A 4JI4T 3HL6A 4AQFA 4A5XA 4NPPA 2M6BA 2C5JA 3L09A 1SA0E 3AA7B 2WAUA 4ZI3D 3FBLA 4DR6T 4QXCB 2XQ7A 3ZKRA 5JDLA 2WM9A 5DJQC 1VCSA 5FL1A 3ZSSA 4H9QC 3RYFE 3TKLB 3AEFA 4CI3B 2KINB 3AEGA 3FBZA 3GA8A 4NXNT 3QNUA 3AA1B 4ZI3C 2ES0A 3C4ZA 4ANJA 3AA6B 2FJDA 2LKGA 4IE7A 4QH5A 5AQRB 2R6GF 2H3RA 3CX6B 4Z91A 2GK9A 5H6QB 1D0YA 3O1JA 5AQIB 2LLYA 4UVBB 3TLUA 2XM2A 4KX6A 3M65A 1E1HB 2P9BA 3UQ4A 1W09A 2XQYA 4KHPT 2HPLA 4X62T 3PJAJ 2A9UA 2DCFA 2RP4A 3NRXA 2H88A 3H3MA 2E2AA 4HWCA 4B3MT 3Q9DA 4IIJE 4P1NA 1UK5A 4H9PC 1MIWA 4CI1B 5L3GB 2MTQA 1KEYA 3RQWA 5JRCB 3ZSTA 4DO0A 2UUBT 3HKDE 3UU3A 3HKEE 3CKDA 4CXYA 2YN6A 4A97A 4JI8T 4AKGA 2V7LA 2V5DA 3CPZA 2X9YA 3A5XA 1MMNA 4MLKA 1Z0PA 3P4QA 2CCQA 2WB5A 3AE7A 3NWIA 4HFCA 1YW0A 2C5IT 4ZZCA 3KBUA 5AQUB 2CXFA 4YSYA 5LCYA 2LJLA 3AEAA 5FYMA 1HR0T 5HXCA 4UR9A 4J2CA 3EVYA 1W0AA 5LP6E 5HAXA 3PURA 1R8IA 5AQHB 2K5BB 3O1IA 2D5UA 1YQ4A 2W66A 1ZKEA 4JV5T 2H89A 2J1DG 4DV2T 4DV3T 1OWAA 3AAIA 1H7CA 5HWYA 3Q5EA 3V5SA 3ZC0A 2UXNB 2YDSA 2WDRA 4IDOA 3MACA 5EK2A 4IL4A 2WU2A 1IAPA 2M67A 3L39A 4ERRA 3UUXB 1XNQT 3VR8A 4AQYT 1M7KA 2BKPA 2A72A 1Y64B 2SPCA 2N2NA 4JUYA 1D1BA 1YXRA 5LYJE 5JR9A 2I6HA 4IE5A 4TV8E 4LF7T 4I55E 3IEEA 4IREA 2QYWA 2K9AA 2YU1A 3MKDA 3ONLC 3ETUA 2W63A 2BKNA 5JQGE 2JQQA 1HG2A 2ZM0A 5L47A 1WYCA 5ETWA 4ZOLE 3LFMA 4EIWA 2WWUA 3F57A 2LEHA 3D31C 2JIWA 2XQ6A 3VRBA 4HWDA 2YOEA 4DMVA 3VHLA 1E2AA 2W67A 4AISA 4NIQA 4YJ3E 2BG9A 3N2OA 3E22E 2V6XA 3LBXA 2A2FX 1IBKT 3UU6A 3PUYG 3AXJA 2E8IA 1VOMA 1BR1A 2FBWA 4LF4T 2FJAA 2G0UA 4QXHB 1T72A 4NUUA 2J4GA 2V26A 4YMWC 5JDNA 5HEOA 3C64A 5ADXL 4PJLA 3CQCB 1B7TA 3SFDA 4EZ4A 4CI2B 1NWMX 1W9RA 2DHRA 4IDQA 4IDZA 2XAFB 3RI5A 4ASKA 2UXDT 5HEGA 5L3CB 2V7JA 5IWAT 4DR1T 2ZM2A 3GMIA 3VRAA 2PFVA 3K3OA 2BBJA 3FHNA 5LHHB 2DNXA 4WZXA 2BDEA 4X1IE 1OXZA 3NBXX 4F6RC 4KHZG 4LF8T 2PJQA 1N36T 4CXWA 4Z8XA 4YHHT 3ZEFB 4U7IA 3OPCA 1S35A 3ZYLA 4QHOA 3I1AA 2W4XA 3GN5A 3SFEA 2VB6A 4JI5T 1HTJF 1OEDE 5CFBA 2DL1A 2CE7A 4TN7B 4N78D 2LM2A 4IE4A 4ILBA 4U2YA 1XDOA 5HXSA 3GWHA 4AKLA 3VU7H 3T1YT 3CIRA 5FVKA 3BQKA 2YU2A 2LSKA 2XY8B 4PFOA 4TWFA 2VVSA 1HCIA 4QKNA 1KNZA 3N9MA 3PU3A 2CBJA 4NXMT 2CMRA 4HFHA 2LOSA 4GK5E 1G8XA 4U74A 1FIOA 1S94A 5FY1A 1WRDA 4H9RC 3I9WA 4YMVC 4IDNA 1ZOYA 2WBLA 4IE0A 4ZXLA 2NR4A 4H63H 4HFBA 3QB5K 4BAYB 4MFRA 3AE9A 4IGUA 2N1GA 5A1LA 3V5UA 3J9X1 4AIUA 1HG5A 5LGUB 3HA4A 2XAHB 3UT5E 1IZNB 3CMLA 4UF0A 5FNVE 2KXPB 3N9OA 1QSDA 4BJMA 3K3QC 3IBPA 5AQTB 2RPAA 5HXRA 3PUYF 3CX7B 2XASB 4DNDA 3ZYMA 3TUZA 3RKOA 4MALA 3SOLA 2BZBA 2JJ9A 5FXWA 2X68A 3TLWA 3OTOT 2DLRA 3M3ZB 4YMUC 1WFDA 2AXDS 3KINB 2XQ5A 1KF6A 2IHR1 1QUUA 3AECA 3CWZB 3Q2MA 2E9XD 5AQNB 1VCTA 3UUMA 3EHZA 1IBLT 1D0ZA 2BVLA 2D0TA 2IC9A 4NUVA 4KHZF 2LRLA 1UGOA 2W0GA 4G2AA 2BS4A 4P0BA 4WYVA 4YLHA 3ABVA 3LK2B 3OJAA 3H37A 4HWIB 2E9XC 3KFWX 2N9DA 3OKQA 4MHCA 1FMWA 4DBQA 3QOFA 2XQ3A 1KK7A 4TZ4C 1UX4A 1SHZC 3PUZF 4GKJT 4YY3T 3KVBA 3KV4A 2E9XA 5CB4E 1XMOT 3C98B 3O9XA 4LFAT 3UU5A 3ANWB 4DR3T 5AQKB 1T7SA 3TLSA 2WDVA 2PBIA 4L0RA 2UXBT 1WYBA 2BKOA 2V5CA 3HKCE 5AQJB 2MYSA 2XAQB 4CN4A 2V7KA 3N9QA 5AQSB 5L2LA 2YK0A 2VQFT 2K3WA 4EOZB 4EB6E 2Q9QD 2VURA 1L0VA 1NAFA 4B3ST 1U5PA 2V6YB 2I59A 4H63V 2D9DA 5IYZE 3ONXA 4E7SA 3W15B 2Q9QB 4X5TA 2XTLA 1IBMT 3R6NA 5AQFB 2HPJA 1ZEEA 2V7MA 2EHOB 1M62A 5JVDE 2FJEA 3RYHE 2CM0A 1HNZT 4C91A 4ILUA 5F8PA 2UXXB 1ZP0A 2X0YA 2HH7A 3CQXC 4QX7B 3MJXA 3X1DA 3NVOA 3B13A 4LF6T 5AQVB 4HFIA 2CLYB 3T1HT 1T98A 3B5MA 2BBHA 2C0SA 4TX5A 3N9LA 2XQ4A 3EDUA 3AEBA 3NRYA 4YSZA 2CLYC 4PNIA 2BG9E 3RF1A 3IHRA 1E7PA 4A98A 4KP3C 4YSXA 3FB2A 1G73A 5JRCA 3I9YA 3RIUC 4DBRA 3PUVG 5DQWA 4LFCT 1FEWA 4ILCA 3Q5DA 2E5LT 5FY0A 3VKHA 2FJBA 3L8RA 3RIUA 4H9NC 5HXEA 5LG4A 2VWAA 5JDMA 1MMAA 3PE0A 3QK6A 2J62A 4KMCA 3RIFA 2KLQA 4PK6A 1UUSA 3K1SA 3AE3A 3P8CD 3E08A 4F8HA 4JYAT 3PUXG 3NKZA 2XM1A 3L3PA 2LSJA 5LGNB 4O4JE 3EABA 5AQQB 1O3XA 2W62A 4U31A 4O4HE 5JDGA 3E0ZA 5C3JA 4CZZB 4DUYT 2MPKA 2W00A 4I4TE 2IW5B 2UUCT 5IUXA 1W0BA 5KMGP 2WQYA 4AKIA 3S4UA 3WAJA 3RKGA 1SE7A 4O2BE 5FKYA 2Y8DA 3AE1A 4HE8A 3OBVE 4U33A 3PU8A 1BR4A 2VL0A 4JEUB 3RC8A 4DV4T 2CXDA 4C90A 3RPUA 5LA6E 1D1AA 5JTGA 1Z8UA 5AQPB 2WU5A 3TLTA 2JQKA 2CEAA 4QXBB 3ZN0B 4G63A 4GIWA 1XNRT 5FVLA 2MAWA 1LVFA 1BR2A 5J2UE 4PJJA 2VKHA 3NZQA 2WMOA 2UU9T 3RLFG 3KVAA 3EAMA 1KFYA 3C50A 5HCJA 1QLBA 2NTYA 3PUSA 1Y01A 3J7Yq 1HS7A 3LDQB 2FUPA 2IMLA 5HEUA 4AKHA 5EK3A 2HHHT 2CHOA 4EEBA 4PK4A 1J5ET 2CWOA 4UIGA 3PJAA 4DR2T 5HXHA 4HTEA 4O8SA 4X20E 2VK9A 5AQOB 2MBGA 2YKSA 3N2GE 1LVKA 5LHIB 4HEAA 2UUAT 5IHYA 3HI2A 4XIGN 3FXDB 1DU2A 3WI3A 3PUVF 2NP9A 5C8YE 4QH4A 4QX8B 2LE8A 4DV6T 2HN1A 4IDPA 1XWMA 5EZYE 2E5VA 2OLTA 5AQMB 4ISTA 1I6ZA 4PW8A 2L8KA 4ZHQE 2KWHA 3QUJA 1HX1B 3C4WA 1J1JA 1D1CA 3PUWG 2XPKA 2L9QA 3QC9A 5LNKA 2LOPA 3ZMVB 3AEDA 5EK4A 4DR4T 2DWKA 5LJMA 3BK9A 2W61A 1IJ5A 4L5GA 4O4IE 2WDQA 4WBNE 4YMTB 3PV0G 3C4XA 3UQ7A 4XBFB 3SS1A 4CN1A 4I43B 4DV0T 5L4EA 1KNRA 2XUEA 4AKRB 3OYXA 4PK5A 4UVAB 3O1HA 3N5LA
chains in the Genus database with same CATH topology
2R6GF 3RLFG 3D31C 3PUWG 4XIGM 4YMVC 4JBWF 3PUYG 3PUVG 4TQUM 3PUZF 4XTCN 4KHZG 3TUIA 4YMSC 4YMTB 3PV0G 4KI0G 2R6GG 3PUXF 4YMUC 3PUYF 4JBWG 4XIGN 3PUZG 4YMWC 3PUWF 4KI0F 3RLFF 3PUVF 2ONKC 4TQUN 3TUZA 4XTCM 4KHZF 3PUXG 3DHWA 3TUJA 3PV0F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G F;  3RLF G;  3D31 C;  3PUW G;  4XIG M;  4YMV C;  4JBW F;  3PUY G;  3PUV G;  4TQU M;  3PUZ F;  4XTC N;  4KHZ G;  3TUI A;  4YMS C;  4YMT B;  3PV0 G;  4KI0 G;  2R6G G;  3PUX F;  4YMU C;  3PUY F;  4JBW G;  4XIG N;  3PUZ G;  4YMW C;  3PUW F;  4KI0 F;  3RLF F;  3PUV F;  2ONK C;  4TQU N;  3TUZ A;  4XTC M;  4KHZ F;  3PUX G;  3DHW A;  3TUJ A;  3PV0 F; 
#chains in the Genus database with same CATH topology
 5ABF B;  1X79 A;  3ZMS B;  1UUR A;  2X9X A;  4UVC B;  3HR0 A;  2YIN A;  2KMF A;  2D0U A;  3ZLI A;  2ZLY A;  3NZP A;  4GYS A;  3ZCI A;  1WR6 A;  1NEK A;  4AXP A;  4AQG A;  3MZK B;  2X9W A;  1ZV4 X;  3KV9 A;  3TUJ A;  5CA0 E;  4DR5 T;  3F2E A;  3JC6 D;  3O4X E;  3P4S A;  4EV6 A;  4HWF A;  4GYR A;  3ZCJ A;  4P09 A;  5C2T A;  4U3C A;  2VKO A;  3QB5 A;  2XJ7 A;  5KXJ A;  4XTC N;  3RX6 A;  3AE5 A;  5F5W A;  1AJ3 A;  2R6G G;  4X65 T;  3JC6 C;  1OED B;  2VKJ A;  2VL8 A;  4HKA A;  2IIU A;  3RRW A;  2CRB A;  4JI1 T;  4LMK A;  4DR7 T;  2XHE B;  4LF9 T;  1OED C;  5LOV E;  2C5K T;  1JNR A;  2ODV A;  4X1K E;  1IJ6 A;  2WS3 A;  3DHW A;  1SUM B;  1FMV A;  4A56 A;  4TWH A;  2V1D B;  2XAG B;  3PDY A;  4UV8 B;  4WBO A;  4EYY R;  5BR8 T;  2XZE A;  3PUW F;  3K8P C;  4GOU A;  3AE2 A;  3RRC A;  3FZM B;  1HFA A;  1MNE A;  2AE9 A;  4ZS3 A;  4WW0 A;  2ODU A;  1YD8 G;  1T8B A;  4YFS A;  3AVR A;  2KT9 A;  3AB3 B;  4O2A E;  3G06 A;  2VVN A;  2J47 A;  4BJN A;  2QRX A;  2LHR A;  3CK6 A;  4PFP A;  4Q25 A;  3VKG A;  4LF5 T;  2UXC T;  5FMN A;  2WY2 A;  3F31 A;  4WNK A;  4AQF C;  1HX8 A;  1MIY A;  3PV0 F;  2F4V T;  5TAO A;  2LT3 A;  5DAB A;  2WMN A;  1XDP A;  4PAG A;  2HN2 A;  3KV5 A;  4UXN B;  2V7I A;  3AE8 A;  3CX8 B;  3UTK A;  4X1Y E;  5KX5 E;  3ZT6 A;  2XSA A;  3N9P A;  1CHU A;  4X66 T;  2WZH A;  3ANW A;  4Z90 A;  5L4H A;  5AFU L;  1XMQ T;  2X67 A;  2ZM8 A;  4JI3 T;  5LMU T;  3JAF A;  3BQL A;  2EHO D;  3UUB A;  1VRB A;  3SRZ A;  3EDV A;  5KDM C;  2VQE T;  4O4L E;  4DV5 T;  4EGW A;  3U3I A;  3TUI A;  3EI0 A;  2OV9 A;  2PTF A;  3P50 A;  5JH7 E;  4EZH A;  3ZPO A;  2DWG A;  2ACX A;  3PUA A;  1V9D A;  5J1G A;  3ZJ1 A;  3T8O A;  3IA3 A;  3A8Y C;  3LJC A;  2Q9Q C;  4PJM A;  4KUM B;  4JLE A;  4JI2 T;  3FZH B;  2V6Y A;  3PUQ A;  4TWD A;  4MBQ A;  2LSY A;  2EHO C;  2RA1 A;  3CQG B;  4YXD A;  2X0H A;  4B6X A;  4YJ2 E;  4TUY E;  5J2T E;  1WCR A;  2Q9Q A;  4X64 T;  2KSR A;  5LBQ B;  1U4Q A;  3JCF A;  3FZF B;  3D0T A;  5AQG B;  4ADZ A;  5L3E B;  1MMG A;  2EHO A;  2I0M A;  2CPT A;  2JPF A;  4P0A A;  1JNZ A;  2PG8 A;  2A3D A;  3Q5W A;  4IL9 A;  3FZK B;  3JAD A;  4CXX A;  3C51 A;  2MOZ A;  2XQA A;  3I0O A;  2KZ7 B;  4DV7 T;  4FJO A;  4TNW A;  4IHJ E;  4OFZ A;  1NEN A;  2QA7 A;  3DJB A;  2JRK A;  4U7Y A;  1US7 B;  4UEL A;  4HFE A;  1ZHC A;  4ZEY A;  1X9B A;  3RQU A;  2JMH A;  5LB7 B;  3P4R A;  1XZY A;  2NOX A;  2X51 A;  4TNV A;  3ZT5 A;  4FI5 A;  5LGT B;  4UV9 B;  3KDS E;  5HEJ A;  3ZYK A;  5LHG B;  1MND A;  1LRZ A;  5JR9 B;  2VKD A;  5BMV E;  4EED A;  4AI6 A;  2ACZ A;  2IUB A;  3UU4 A;  5CJ5 A;  4IE6 A;  4DMW A;  4JBW G;  2LSG A;  2XQ9 A;  4ILA A;  5JR9 C;  3AVS A;  2W2U A;  4DID B;  2D2S A;  1HNW T;  4M1P A;  1YKH B;  3AE6 A;  3ESL A;  4YT0 A;  3ZT7 A;  2QGS A;  3P4P A;  5FL0 A;  1CUN A;  3OVU A;  5LMN T;  1N34 T;  4GK0 E;  3UFG A;  5FXZ A;  2K24 A;  2Y48 B;  1GQE A;  1HF8 A;  3FXE B;  2H7V C;  4HN9 A;  2CA5 A;  3RH3 A;  2JQ9 A;  4DV1 T;  3UU8 A;  4H9O C;  2BG9 B;  4XIG M;  4HFV A;  5ABG A;  2JMK A;  4LML A;  4HWH A;  3LBX B;  2M6I A;  2CXL A;  2IDO B;  4OX9 T;  3AXJ B;  2IC6 A;  3ZMT B;  2BG9 C;  5JDF A;  2V8S V;  2CHN A;  2VAS A;  1MMD A;  5HWX A;  3MXZ A;  2KWI B;  3PTR B;  4TV9 E;  4K0U A;  5JDH A;  2X66 A;  2LRK A;  2NW8 A;  5J0Z A;  1BR0 A;  5FP3 A;  4KI0 G;  3RC3 A;  4JEH B;  3KBT A;  3AE4 A;  1UCU A;  2YEV C;  4ZI2 D;  2KND A;  3ZN1 B;  4GKK T;  5FY7 A;  5M4Y A;  4B3T T;  3IF8 B;  3N2K E;  3ZMU B;  2Z6E A;  4TQU M;  4I50 E;  4COF A;  4YMS C;  3SWH A;  1J5W A;  2X9H A;  5HCM A;  4QH1 A;  3KV6 A;  5AQL B;  3A7M A;  2K48 A;  3LK3 B;  2YDR A;  1YKE B;  4UEM A;  3JAE A;  3UFE A;  2H7O A;  4ZI2 C;  3RIA A;  3N9N A;  3GN5 B;  3RGL A;  4E7Z A;  4L9I A;  2CWY A;  1MIV A;  3LG7 A;  3RYI E;  3AAA B;  2ONK C;  3CVR A;  2WCA A;  1WLX A;  4JI7 T;  2XQ8 A;  5LJN A;  3PUX F;  5ABH A;  4OK0 A;  2JQH A;  3TLV A;  4ZS2 A;  4TQU N;  4XAX B;  4JI6 T;  3RYC E;  4ZZB A;  4OYJ A;  4JI0 T;  2LM9 A;  5LG3 A;  2WWV A;  3RHW A;  4JBW F;  2XSB A;  4XZC A;  3WAK A;  5DQV A;  1HNX T;  1KNP A;  3BQI A;  3PUZ G;  4XTC M;  4LFB T;  2ZM6 T;  4U72 A;  5LBM A;  3DTO A;  3P4W A;  4YHJ A;  3ZC1 A;  5L3F B;  5F3J A;  4V1A v;  3AEE A;  1D0X A;  3AA0 B;  5JDQ A;  5L3B B;  2BVM A;  4UF0 B;  4ISS A;  4QWN B;  5H6R B;  4OYK A;  3ZMZ B;  2LHN A;  4PJN A;  4HFD A;  1FJG T;  3AAE B;  3ETV A;  4EAH A;  4H9S E;  4DUZ T;  4CQI A;  2IAK A;  5GON E;  5ABF A;  5L3D B;  3RLF F;  4LMJ A;  4KI0 F;  2CBI A;  3I0Q A;  2OA5 A;  2XAJ B;  5FXX A;  2DI4 A;  3B57 A;  4YTN A;  4K0K T;  1I94 T;  4YTP A;  3UUL A;  2YDQ A;  4EYU A;  2ZMA A;  3OYZ A;  4IT4 A;  2NW9 A;  5CA1 E;  2LKH A;  5E0O A;  1UX5 A;  4U2Z A;  3EUH A;  1N33 T;  3LSV A;  2X0L B;  4I0U A;  4BA9 A;  5CGM A;  2L3L A;  2BS2 A;  3FZL B;  4EXT A;  3H3A A;  5LXT E;  4ZI7 E;  4HGA A;  1YQ3 A;  1OED A;  5FXV A;  2Y6X A;  2LSI A;  3PUG A;  5HYA A;  2NTX A;  2WSS V;  3HKB E;  1N32 T;  4B3R T;  3MK7 C;  3ONJ A;  1EZ3 A;  2WZI A;  3DP7 A;  2E9X B;  1WR0 A;  2WP9 A;  4OHF A;  5ABE A;  1LKX A;  2NW7 A;  3K3N A;  2NWB A;  4CN6 A;  5HEH A;  3UUN A;  3VR9 A;  4KBM B;  4YTM A;  3U78 A;  3R84 B;  2B1E A;  3P7I A;  4DVD A;  3ZJ2 A;  3LK4 2;  5JRE A;  3Q5X A;  2QVA A;  2BS3 A;  2B76 A;  3MA9 A;  4JI4 T;  3HL6 A;  4AQF A;  4A5X A;  4NPP A;  2M6B A;  2C5J A;  3L09 A;  1SA0 E;  3AA7 B;  2WAU A;  4ZI3 D;  3FBL A;  4DR6 T;  4QXC B;  2XQ7 A;  3ZKR A;  5JDL A;  2WM9 A;  5DJQ C;  1VCS A;  5FL1 A;  3ZSS A;  4H9Q C;  3RYF E;  3TKL B;  3AEF A;  4CI3 B;  2KIN B;  3AEG A;  3FBZ A;  3GA8 A;  4NXN T;  3QNU A;  3AA1 B;  4ZI3 C;  2ES0 A;  3C4Z A;  4ANJ A;  3AA6 B;  2FJD A;  2LKG A;  4IE7 A;  4QH5 A;  5AQR B;  2R6G F;  2H3R A;  3CX6 B;  4Z91 A;  2GK9 A;  5H6Q B;  1D0Y A;  3O1J A;  5AQI B;  2LLY A;  4UVB B;  3TLU A;  2XM2 A;  4KX6 A;  3M65 A;  1E1H B;  2P9B A;  3UQ4 A;  1W09 A;  2XQY A;  4KHP T;  2HPL A;  4X62 T;  3PJA J;  2A9U A;  2DCF A;  2RP4 A;  3NRX A;  2H88 A;  3H3M A;  2E2A A;  4HWC A;  4B3M T;  3Q9D A;  4IIJ E;  4P1N A;  1UK5 A;  4H9P C;  1MIW A;  4CI1 B;  5L3G B;  2MTQ A;  1KEY A;  3RQW A;  5JRC B;  3ZST A;  4DO0 A;  2UUB T;  3HKD E;  3UU3 A;  3HKE E;  3CKD A;  4CXY A;  2YN6 A;  4A97 A;  4JI8 T;  4AKG A;  2V7L A;  2V5D A;  3CPZ A;  2X9Y A;  3A5X A;  1MMN A;  4MLK A;  1Z0P A;  3P4Q A;  2CCQ A;  2WB5 A;  3AE7 A;  3NWI A;  4HFC A;  1YW0 A;  2C5I T;  4ZZC A;  3KBU A;  5AQU B;  2CXF A;  4YSY A;  5LCY A;  2LJL A;  3AEA A;  5FYM A;  1HR0 T;  5HXC A;  4UR9 A;  4J2C A;  3EVY A;  1W0A A;  5LP6 E;  5HAX A;  3PUR A;  1R8I A;  5AQH B;  2K5B B;  3O1I A;  2D5U A;  1YQ4 A;  2W66 A;  1ZKE A;  4JV5 T;  2H89 A;  2J1D G;  4DV2 T;  4DV3 T;  1OWA A;  3AAI A;  1H7C A;  5HWY A;  3Q5E A;  3V5S A;  3ZC0 A;  2UXN B;  2YDS A;  2WDR A;  4IDO A;  3MAC A;  5EK2 A;  4IL4 A;  2WU2 A;  1IAP A;  2M67 A;  3L39 A;  4ERR A;  3UUX B;  1XNQ T;  3VR8 A;  4AQY T;  1M7K A;  2BKP A;  2A72 A;  1Y64 B;  2SPC A;  2N2N A;  4JUY A;  1D1B A;  1YXR A;  5LYJ E;  5JR9 A;  2I6H A;  4IE5 A;  4TV8 E;  4LF7 T;  4I55 E;  3IEE A;  4IRE A;  2QYW A;  2K9A A;  2YU1 A;  3MKD A;  3ONL C;  3ETU A;  2W63 A;  2BKN A;  5JQG E;  2JQQ A;  1HG2 A;  2ZM0 A;  5L47 A;  1WYC A;  5ETW A;  4ZOL E;  3LFM A;  4EIW A;  2WWU A;  3F57 A;  2LEH A;  3D31 C;  2JIW A;  2XQ6 A;  3VRB A;  4HWD A;  2YOE A;  4DMV A;  3VHL A;  1E2A A;  2W67 A;  4AIS A;  4NIQ A;  4YJ3 E;  2BG9 A;  3N2O A;  3E22 E;  2V6X A;  3LBX A;  2A2F X;  1IBK T;  3UU6 A;  3PUY G;  3AXJ A;  2E8I A;  1VOM A;  1BR1 A;  2FBW A;  4LF4 T;  2FJA A;  2G0U A;  4QXH B;  1T72 A;  4NUU A;  2J4G A;  2V26 A;  4YMW C;  5JDN A;  5HEO A;  3C64 A;  5ADX L;  4PJL A;  3CQC B;  1B7T A;  3SFD A;  4EZ4 A;  4CI2 B;  1NWM X;  1W9R A;  2DHR A;  4IDQ A;  4IDZ A;  2XAF B;  3RI5 A;  4ASK A;  2UXD T;  5HEG A;  5L3C B;  2V7J A;  5IWA T;  4DR1 T;  2ZM2 A;  3GMI A;  3VRA A;  2PFV A;  3K3O A;  2BBJ A;  3FHN A;  5LHH B;  2DNX A;  4WZX A;  2BDE A;  4X1I E;  1OXZ A;  3NBX X;  4F6R C;  4KHZ G;  4LF8 T;  2PJQ A;  1N36 T;  4CXW A;  4Z8X A;  4YHH T;  3ZEF B;  4U7I A;  3OPC A;  1S35 A;  3ZYL A;  4QHO A;  3I1A A;  2W4X A;  3GN5 A;  3SFE A;  2VB6 A;  4JI5 T;  1HTJ F;  1OED E;  5CFB A;  2DL1 A;  2CE7 A;  4TN7 B;  4N78 D;  2LM2 A;  4IE4 A;  4ILB A;  4U2Y A;  1XDO A;  5HXS A;  3GWH A;  4AKL A;  3VU7 H;  3T1Y T;  3CIR A;  5FVK A;  3BQK A;  2YU2 A;  2LSK A;  2XY8 B;  4PFO A;  4TWF A;  2VVS A;  1HCI A;  4QKN A;  1KNZ A;  3N9M A;  3PU3 A;  2CBJ A;  4NXM T;  2CMR A;  4HFH A;  2LOS A;  4GK5 E;  1G8X A;  4U74 A;  1FIO A;  1S94 A;  5FY1 A;  1WRD A;  4H9R C;  3I9W A;  4YMV C;  4IDN A;  1ZOY A;  2WBL A;  4IE0 A;  4ZXL A;  2NR4 A;  4H63 H;  4HFB A;  3QB5 K;  4BAY B;  4MFR A;  3AE9 A;  4IGU A;  2N1G A;  5A1L A;  3V5U A;  3J9X 1;  4AIU A;  1HG5 A;  5LGU B;  3HA4 A;  2XAH B;  3UT5 E;  1IZN B;  3CML A;  4UF0 A;  5FNV E;  2KXP B;  3N9O A;  1QSD A;  4BJM A;  3K3Q C;  3IBP A;  5AQT B;  2RPA A;  5HXR A;  3PUY F;  3CX7 B;  2XAS B;  4DND A;  3ZYM A;  3TUZ A;  3RKO A;  4MAL A;  3SOL A;  2BZB A;  2JJ9 A;  5FXW A;  2X68 A;  3TLW A;  3OTO T;  2DLR A;  3M3Z B;  4YMU C;  1WFD A;  2AXD S;  3KIN B;  2XQ5 A;  1KF6 A;  2IHR 1;  1QUU A;  3AEC A;  3CWZ B;  3Q2M A;  2E9X D;  5AQN B;  1VCT A;  3UUM A;  3EHZ A;  1IBL T;  1D0Z A;  2BVL A;  2D0T A;  2IC9 A;  4NUV A;  4KHZ F;  2LRL A;  1UGO A;  2W0G A;  4G2A A;  2BS4 A;  4P0B A;  4WYV A;  4YLH A;  3ABV A;  3LK2 B;  3OJA A;  3H37 A;  4HWI B;  2E9X C;  3KFW X;  2N9D A;  3OKQ A;  4MHC A;  1FMW A;  4DBQ A;  3QOF A;  2XQ3 A;  1KK7 A;  4TZ4 C;  1UX4 A;  1SHZ C;  3PUZ F;  4GKJ T;  4YY3 T;  3KVB A;  3KV4 A;  2E9X A;  5CB4 E;  1XMO T;  3C98 B;  3O9X A;  4LFA T;  3UU5 A;  3ANW B;  4DR3 T;  5AQK B;  1T7S A;  3TLS A;  2WDV A;  2PBI A;  4L0R A;  2UXB T;  1WYB A;  2BKO A;  2V5C A;  3HKC E;  5AQJ B;  2MYS A;  2XAQ B;  4CN4 A;  2V7K A;  3N9Q A;  5AQS B;  5L2L A;  2YK0 A;  2VQF T;  2K3W A;  4EOZ B;  4EB6 E;  2Q9Q D;  2VUR A;  1L0V A;  1NAF A;  4B3S T;  1U5P A;  2V6Y B;  2I59 A;  4H63 V;  2D9D A;  5IYZ E;  3ONX A;  4E7S A;  3W15 B;  2Q9Q B;  4X5T A;  2XTL A;  1IBM T;  3R6N A;  5AQF B;  2HPJ A;  1ZEE A;  2V7M A;  2EHO B;  1M62 A;  5JVD E;  2FJE A;  3RYH E;  2CM0 A;  1HNZ T;  4C91 A;  4ILU A;  5F8P A;  2UXX B;  1ZP0 A;  2X0Y A;  2HH7 A;  3CQX C;  4QX7 B;  3MJX A;  3X1D A;  3NVO A;  3B13 A;  4LF6 T;  5AQV B;  4HFI A;  2CLY B;  3T1H T;  1T98 A;  3B5M A;  2BBH A;  2C0S A;  4TX5 A;  3N9L A;  2XQ4 A;  3EDU A;  3AEB A;  3NRY A;  4YSZ A;  2CLY C;  4PNI A;  2BG9 E;  3RF1 A;  3IHR A;  1E7P A;  4A98 A;  4KP3 C;  4YSX A;  3FB2 A;  1G73 A;  5JRC A;  3I9Y A;  3RIU C;  4DBR A;  3PUV G;  5DQW A;  4LFC T;  1FEW A;  4ILC A;  3Q5D A;  2E5L T;  5FY0 A;  3VKH A;  2FJB A;  3L8R A;  3RIU A;  4H9N C;  5HXE A;  5LG4 A;  2VWA A;  5JDM A;  1MMA A;  3PE0 A;  3QK6 A;  2J62 A;  4KMC A;  3RIF A;  2KLQ A;  4PK6 A;  1UUS A;  3K1S A;  3AE3 A;  3P8C D;  3E08 A;  4F8H A;  4JYA T;  3PUX G;  3NKZ A;  2XM1 A;  3L3P A;  2LSJ A;  5LGN B;  4O4J E;  3EAB A;  5AQQ B;  1O3X A;  2W62 A;  4U31 A;  4O4H E;  5JDG A;  3E0Z A;  5C3J A;  4CZZ B;  4DUY T;  2MPK A;  2W00 A;  4I4T E;  2IW5 B;  2UUC T;  5IUX A;  1W0B A;  5KMG P;  2WQY A;  4AKI A;  3S4U A;  3WAJ A;  3RKG A;  1SE7 A;  4O2B E;  5FKY A;  2Y8D A;  3AE1 A;  4HE8 A;  3OBV E;  4U33 A;  3PU8 A;  1BR4 A;  2VL0 A;  4JEU B;  3RC8 A;  4DV4 T;  2CXD A;  4C90 A;  3RPU A;  5LA6 E;  1D1A A;  5JTG A;  1Z8U A;  5AQP B;  2WU5 A;  3TLT A;  2JQK A;  2CEA A;  4QXB B;  3ZN0 B;  4G63 A;  4GIW A;  1XNR T;  5FVL A;  2MAW A;  1LVF A;  1BR2 A;  5J2U E;  4PJJ A;  2VKH A;  3NZQ A;  2WMO A;  2UU9 T;  3RLF G;  3KVA A;  3EAM A;  1KFY A;  3C50 A;  5HCJ A;  1QLB A;  2NTY A;  3PUS A;  1Y01 A;  3J7Y q;  1HS7 A;  3LDQ B;  2FUP A;  2IML A;  5HEU A;  4AKH A;  5EK3 A;  2HHH T;  2CHO A;  4EEB A;  4PK4 A;  1J5E T;  2CWO A;  4UIG A;  3PJA A;  4DR2 T;  5HXH A;  4HTE A;  4O8S A;  4X20 E;  2VK9 A;  5AQO B;  2MBG A;  2YKS A;  3N2G E;  1LVK A;  5LHI B;  4HEA A;  2UUA T;  5IHY A;  3HI2 A;  4XIG N;  3FXD B;  1DU2 A;  3WI3 A;  3PUV F;  2NP9 A;  5C8Y E;  4QH4 A;  4QX8 B;  2LE8 A;  4DV6 T;  2HN1 A;  4IDP A;  1XWM A;  5EZY E;  2E5V A;  2OLT A;  5AQM B;  4IST A;  1I6Z A;  4PW8 A;  2L8K A;  4ZHQ E;  2KWH A;  3QUJ A;  1HX1 B;  3C4W A;  1J1J A;  1D1C A;  3PUW G;  2XPK A;  2L9Q A;  3QC9 A;  5LNK A;  2LOP A;  3ZMV B;  3AED A;  5EK4 A;  4DR4 T;  2DWK A;  5LJM A;  3BK9 A;  2W61 A;  1IJ5 A;  4L5G A;  4O4I E;  2WDQ A;  4WBN E;  4YMT B;  3PV0 G;  3C4X A;  3UQ7 A;  4XBF B;  3SS1 A;  4CN1 A;  4I43 B;  4DV0 T;  5L4E A;  1KNR A;  2XUE A;  4AKR B;  3OYX A;  4PK5 A;  4UVA B;  3O1H A;  3N5L A; 
#chains in the Genus database with same CATH homology
 2R6G F;  3RLF G;  3D31 C;  3PUW G;  4XIG M;  4YMV C;  4JBW F;  3PUY G;  3PUV G;  4TQU M;  3PUZ F;  4XTC N;  4KHZ G;  3TUI A;  4YMS C;  4YMT B;  3PV0 G;  4KI0 G;  2R6G G;  3PUX F;  4YMU C;  3PUY F;  4JBW G;  4XIG N;  3PUZ G;  4YMW C;  3PUW F;  4KI0 F;  3RLF F;  3PUV F;  2ONK C;  4TQU N;  3TUZ A;  4XTC M;  4KHZ F;  3PUX G;  3DHW A;  3TUJ A;  3PV0 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...