3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
b'SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
4KHZF 4YMTB 3DHWA 3PUXF 3TUIA 3PUZF 4TQUN 3PUYG 3PUVG 3PUWG 4YMVC 4XIGM 3PUYF 4YMSC 3TUJA 4XTCM 3PUVF 3PUWF 4YMWC 4JBWG 3RLFG 3RLFF 4JBWF 3PV0G 4XIGN 3TUZA 4XTCN 3PV0F 4KHZG 3D31C 4KI0G 4YMUC 4TQUM 2R6GG 4KI0F 3PUXG 2ONKC 2R6GF 3PUZG
chains in the Genus database with same CATH superfamily
2B1EA 2H88A 3B13A 5LGUB 3QUJA 1M7KA 1XMQT 5FL1A 3Q5XA 4K0KT 4H9SE 3K1SA 1JNRA 5EK3A 2BG9B 2ZM8A 5F5WA 4KHZG 1KNPA 2QYWA 3PUSA 5JDMA 1MNDA 3CWZB 3PUWF 3Q2MA 3PU8A 1KEYA 4P09A 2BS2A 3RRCA 2LE8A 5HEGA 2YK0A 1M62A 5CGMA 1FJGT 3ZN1B 5IUXA 4QHOA 2D0UA 2M67A 4YTPA 1E1HB 3P8CD 1FMWA 1SHZC 2W00A 2W0GA 1B7TA 4GYRA 3N5LA 4H9PC 2XY8B 4C90A 4UF0B 3X1DA 2WDVA 2XQ5A 1L0VA 4EZ4A 1MIVA 5L3BB 1HNWT 2CWOA 2VK9A 3VKGA 1LVKA 3ZSSA 3ABVA 3AVSA 3QK6A 3AEEA 2BBJA 4TNVA 3P7IA 4QH1A 1JNZA 2BZBA 2V1DB 4DR2T 4CQIA 3O1HA 4JI2T 3P4RA 3PDYA 4HWIB 4CN6A 1N34T 1HX8A 1XMOT 2BBHA 4GIWA 4JBWG 4ILCA 2LHNA 4DR1T 4ZS3A 2E9XD 1S35A 3RPUA 1CHUA 4Z8XA 4A98A 1LKXA 4TX5A 2FJAA 3RYFE 4PJMA 4EZHA 4O4JE 3ZN0B 1W09A 3GA8A 1MIWA 2XSAA 4QXCB 4EAHA 3N2GE 2HH7A 3C4XA 5FNVE 2E8IA 1LVFA 1Y01A 5AQPB 3J9X1 2WAUA 5ABGA 5J0ZA 2VL0A 5CA1E 3HKBE 2K5BB 5C2TA 3QB5A 2UXDT 3I0QA 1WR6A 5DQWA 2OLTA 3C50A 4MALA 5FXWA 1T72A 4AKGA 3PUXF 5FL0A 1Y64B 1D0XA 1H7CA 4G63A 2YKSA 5FYMA 2X67A 3AEBA 4KP3C 2XQ9A 3D31C 1FIOA 4TZ4C 2IIUA 2R6GG 4HFBA 4QXBB 4ZEYA 3ZMSB 2KWHA 4JI3T 1HNZT 3JCFA 2ZM6T 1OWAA 3LG7A 5LMNT 4UV8B 3DJBA 2JIWA 2UUBT 2X0LB 3ZSTA 4IDOA 4U72A 5AQSB 5FXVA 3EUHA 2WSSV 3CX8B 2YDQA 4X20E 2JQQA 2ZM2A 1NENA 5C3JA 1I6ZA 2K24A 2E9XC 2V7IA 1BR4A 3GWHA 3RQWA 4JI5T 1IAPA 3ZJ1A 1SA0E 2EHOA 2IC6A 4YMSC 1YKHB 2WY2A 3CMLA 2IUBA 2W63A 3T1HT 4L9IA 5JH7E 2VKDA 3VHLA 4X62T 2JQHA 4IE5A 3WAKA 5JR9A 3PUWG 4XIGM 2XZEA 3RIAA 2CPTA 2XAJB 2YN6A 1I94T 3ZMTB 2XPKA 3FXEB 5EK4A 3OVUA 2LT3A 4IE7A 1ZKEA 2X0HA 4IT4A 3PJAJ 3KVAA 4DV4T 4P0BA 5AQMB 1GQEA 3L39A 3RYCE 1XDPA 1HR0T 2E9XB 2XM1A 3N2KE 3B57A 5EK2A 1U4QA 2CXLA 2A3DA 4NUVA 5LHGB 3P4PA 3SRZA 3FZHB 1XZYA 2KSRA 4QXHB 4I55E 3KVBA 5AQFB 1MMGA 4X66T 1IJ6A 2ZMAA 3TUJA 3VU7H 1UUSA 2XTLA 3LJCA 2D0TA 4ZS2A 1BR0A 2LM2A 2CA5A 4H9RC 3WAJA 4HN9A 2HN2A 5JTGA 4ZZCA 1R8IA 2PFVA 4OFZA 2W61A 4ILUA 4ISSA 4DV0T 4UEMA 2NW9A 3AEAA 2FBWA 4DBRA 4O4IE 3A8YC 2W4XA 3DP7A 4KI0G 4HEAA 2HPLA 2LOPA 2VL8A 1US7B 3K8PC 4ILAA 2MYSA 3C51A 1OEDA 4DUYT 2XHEB 1FMVA 4JBWF 3N9PA 1DU2A 3OYZA 1U5PA 1KF6A 2WBLA 5ABFA 2IW5B 2WDQA 5DJQC 2LM9A 4ZHQE 2SPCA 5IWAT 3OYXA 4UV9B 1W0BA 2AE9A 3AE4A 4IIJE 1J5ET 4U2YA 3JADA 3BK9A 2WU2A 1E7PA 4KBMB 4DMVA 5AQGB 4CN1A 4FJOA 2CWYA 2ODUA 2X68A 4WBOA 5FXZA 2WCAA 2BS4A 3EDVA 2N9DA 2KMFA 3ETVA 3FZFB 3OJAA 2LJLA 4U3CA 4AKRB 4NXMT 4DO0A 4L0RA 3SS1A 3EHZA 4DV3T 3NWIA 1D1AA 3EAMA 4AQFA 4X64T 1IJ5A 2DCFA 4NXNT 4IL4A 4AISA 2HPJA 2XAQB 4NPPA 4G2AA 4YLHA 3N9OA 5HXSA 3AAAB 3ZT7A 4YHHT 2FUPA 2JQKA 2CM0A 3PJAA 5FY0A 4IE4A 1D1CA 5HXHA 1WRDA 1X79A 5AQQB 4C91A 1W9RA 5LOVE 4GK5E 4DNDA 4B6XA 3SFDA 2VASA 4HWHA 3PTRB 5LBMA 2K3WA 4ADZA 4KX6A 3AE1A 3UU6A 4PJLA 4IL9A 3AE3A 2W62A 3CK6A 4BJMA 3IF8B 2V6XA 5F8PA 2C5IT 2RA1A 1OXZA 2PJQA 2M6IA 2WWVA 2X9XA 3ANWA 2EHOD 4AIUA 4GKKT 1NEKA 4UELA 4F6RC 3IBPA 5JDLA 2JRKA 2WS3A 2BVMA 2V6YA 3ZEFB 4KMCA 4ZI3C 2PG8A 5LBQB 5HEOA 2LOSA 4MHCA 4XBFB 2VQET 5AQLB 2LLYA 4YY3T 3RIUA 3WI3A 2A72A 3RKGA 3TUIA 4LF5T 2L3LA 1IBKT 2V8SV 2H3RA 5AFUL 4YJ2E 3E22E 4EYYR 3KBTA 3VKHA 4GOUA 3UU5A 3UUBA 5LG4A 2WZIA 4AI6A 4YJ3E 4TQUN 1BR2A 2YU2A 3E08A 2ZLYA 4XZCA 2Y8DA 2J1DG 4O2AE 2YU1A 2F4VT 2WWUA 2JMHA 2L8KA 3AA7B 3NZQA 4COFA 4I43B 1OEDE 5FKYA 2LKGA 4YTMA 4ERRA 2NW8A 5J2TE 2XSBA 3DTOA 3C98B 1UGOA 3MKDA 3RHWA 4LFCT 4Z91A 2X51A 4KI0F 3AEFA 4B3TT 4NIQA 5LCYA 4L5GA 2KXPB 2X9YA 5DQVA 2XQ3A 2UXXB 5JDNA 3AECA 3K3NA 2LSKA 3KBUA 3MA9A 5LHHB 5AQHB 5ADXL 5L3FB 2A9UA 5JVDE 5L4HA 2RPAA 3EVYA 4ANJA 1HF8A 5L4EA 3RC3A 4B3ST 2VURA 2CHOA 5L3GB 4PFOA 2NW7A 2XQ6A 2LRKA 2HN1A 3ZMUB 2CRBA 2QGSA 5LNKA 3LBXB 5JR9C 4KUMB 3AE5A 5AQUB 4DV6T 3RH3A 3UU8A 3HKCE 2OV9A 4IE0A 3AVRA 1UX4A 5LB7B 3MK7C 3ONLC 4YSYA 4HFCA 3R84B 2YEVC 4TV9E 1KNZA 1Z0PA 2MTQA 1J5WA 3T1YT 4OK0A 3GN5A 3HR0A 3OKQA 2PTFA 2ONKC 5BR8T 5FMNA 3KFWX 3TLTA 4LFBT 5FY7A 2A2FX 4IGUA 2V7LA 2MBGA 2EHOB 3MACA 4QH5A 3ZJ2A 3PUAA 3PV0G 1ZEEA 2WP9A 1YQ3A 5F3JA 5HXEA 4PJNA 1VOMA 3I9YA 4TV8E 5JDQA 4TN7B 4YHJA 5JR9B 2UUAT 5HCMA 3RLFF 4JI4T 3B5MA 3NBXX 3PUQA 3CX6B 1D0YA 2J4GA 3L09A 4JYAT 1MMAA 3M65A 5L3EB 2VVSA 4YTNA 5H6QB 2V5DA 4HFDA 2XQ7A 4HWFA 1OEDC 4J2CA 2D5UA 3RYIE 4CXYA 1HNXT 3TLWA 4HTEA 4O4LE 3AE8A 5IYZE 3AXJB 5HEHA 1D0ZA 4HFEA 2PBIA 3FHNA 2X66A 4HFVA 4U2ZA 3U3IA 5LJMA 2WM9A 3PURA 3UULA 3LK42 4YMUC 2DLRA 3TKLB 3V5SA 4O8SA 1XDOA 4ILBA 1X9BA 2MAWA 4ZI2D 5ETWA 1NAFA 1HX1B 3PU3A 5ABEA 5FVKA 5LXTE 2Z6EA 4EB6E 4OYJA 4B3RT 3BQLA 5EZYE 3FZMB 2I59A 1UX5A 3UU4A 3ONXA 2Q9QD 1KNRA 1OEDB 4P1NA 4YXDA 5LJNA 4A5XA 4AQFC 3CVRA 4GK0E 3N9MA 2CLYB 4XAXB 3RQUA 4DV1T 3JAEA 4DR3T 5LYJE 3TLSA 4LF9T 5ABFB 2KZ7B 2QRXA 2CEAA 3CX7B 4HWDA 4AQGA 2J47A 3PE0A 4JEHB 1EZ3A 3NZPA 3CKDA 4F8HA 4U7YA 2CMRA 2VB6A 4ASKA 2WZHA 4JV5T 4WW0A 5CB4E 2FJBA 4HFHA 2YDSA 4EGWA 4YMWC 4TNWA 5HWXA 3NRXA 3QNUA 4DV7T 4X5TA 4BA9A 1HG2A 2NTXA 2K9AA 2BS3A 2CCQA 5KDMC 2LSGA 4JEUB 4UVBB 1UK5A 1V9DA 4ISTA 2UUCT 3ZMVB 1G73A 4UVCB 5HEJA 4X1IE 4JI1T 1AJ3A 2DL1A 3ZPOA 4TQUM 1IZNB 3VRBA 2LRLA 1VRBA 4E7ZA 3FBLA 4LMKA 4JI8T 3VR9A 4UXNB 1E2AA 4K0UA 2RP4A 2X0YA 4HFIA 4TWFA 1HCIA 2W2UA 2E5LT 5FVLA 2ACXA 5FY1A 3A7MA 3PUVF 5JRCB 2LHRA 1T8BA 2OA5A 2VKOA 2X9WA 3CPZA 5L3CB 3S4UA 4BJNA 1O3XA 1YKEB 4WYVA 3ZKRA 2BVLA 2W66A 4YT0A 2IC9A 4EOZB 3AE7A 3RRWA 3RLFG 2UXCT 1KK7A 2YOEA 3LK2B 4EEBA 3PV0F 2Y48B 5JREA 2C5JA 4JI6T 4LF8T 3K3QC 4JI7T 4X65T 4CI1B 3ETUA 4OX9T 2V6YB 2XASB 4U74A 4LFAT 5AQRB 4EXTA 1MMDA 3QOFA 2KWIB 4DBQA 5LHIB 4MLKA 4MBQA 5M4YA 2QVAA 2C0SA 4FI5A 1S94A 2XM2A 3UUNA 3TLVA 3UT5E 3DHWA 3N9LA 3K3OA 3ZT6A 4OHFA 5J2UE 3EDUA 2K48A 1WFDA 1N33T 1QUUA 2XQAA 2E2AA 4O4HE 2KT9A 3F57A 3RX6A 3L8RA 4YFSA 2LKHA 3UFGA 4CI2B 3AEDA 2WDRA 4Z90A 3RC8A 2Q9QA 3TLUA 1T7SA 2LSYA 3P50A 2I6HA 1WCRA 3P4SA 4NUUA 2Y6XA 2NWBA 2IMLA 1W0AA 3AAIA 3C4WA 3P4WA 3SFEA 5FP3A 4DUZT 4A56A 3PUZG 3HKEE 5LGTB 2LEHA 3OPCA 2DWKA 3AA6B 3FZKB 3MXZA 5KX5E 4H63H 1QSDA 2P9BA 2LSJA 5HXRA 3UU3A 4AKIA 1WYCA 2BG9A 3FBZA 3RF1A 3CIRA 4HWCA 1HG5A 3H3AA 4LMLA 3UFEA 4GKJT 2N1GA 3CQGB 3AE9A 2M6BA 2CBIA 1HS7A 2IAKA 4TUYE 3RYHE 4ZXLA 2WQYA 4LMJA 2E5VA 3BQIA 3OBVE 3H3MA 3RGLA 2XUEA 3MZKB 4AKLA 4PK5A 1N36T 2VQFT 4IE6A 2AXDS 4UF0A 2BDEA 4PK6A 3ESLA 1N32T 3AEGA 2EHOC 5L2LA 2L9QA 4IDZA 4CXWA 4HKAA 3GN5B 1XWMA 1ZP0A 5HAXA 1Z8UA 3W15B 2H7VC 3NKZA 1IBMT 2CXFA 5AQOB 2BKPA 1MIYA 3LDQB 4I0UA 3NVOA 2UXBT 5IHYA 3VR8A 2XQ8A 4TWDA 5E0OA 5LP6E 4A97A 5CFBA 4UVAB 3Q5WA 2ES0A 4PAGA 1IBLT 4EEDA 3PUVG 4XTCM 1YQ4A 4KHPT 3VRAA 4JLEA 2H7OA 3HKDE 1FEWA 1NWMX 3IA3A 3T8OA 3U78A 5HCJA 2VKJA 5AQIB 4WZXA 3N9NA 2X9HA 3EABA 4H63V 3RIFA 4M1PA 4HE8A 2XQ4A 5ABHA 4PW8A 3RKOA 3A5XA 3ZLIA 5HYAA 5J1GA 3FXDB 3V5UA 2JPFA 2GK9A 2KLQA 4U33A 2UXNB 2V7KA 3LFMA 2KNDA 4YMVC 4YSXA 3IEEA 3LBXA 2YINA 2WB5A 2BKOA 1WYBA 2XAGB 2JJ9A 3O9XA 3KV9A 1HFAA 2CBJA 1J1JA 4DR6T 2V7JA 2JQ9A 2XAFB 5AQJB 4PJJA 2D2SA 3LSVA 5HEUA 2V7MA 4V1Av 3NRYA 3KDSE 4AQYT 4O2BE 3JAFA 5JQGE 1BR1A 3N2OA 3SWHA 2CLYC 3O1JA 3BQKA 2VKHA 3PUYF 3RI5A 4E7SA 4AKHA 2IHR1 3IHRA 3UUXB 4U7IA 3KV4A 3ZMZB 3AE6A 1SE7A 3ZCJA 5JDHA 3JC6D 3Q9DA 4QH4A 1YXRA 3M3ZB 3EI0A 2C5KT 1QLBA 1CUNA 4WNKA 5CJ5A 3AA0B 2NOXA 4DV5T 4CN4A 5AQKB 2CE7A 3TUZA 3ZT5A 4IDNA 2WMOA 2XQYA 1HTJF 2J62A 1VCTA 2NR4A 4X1YE 4KHZF 1WLXA 2LSIA 3G06A 5C8YE 4LF4T 4ZI7E 1G8XA 4DVDA 3AAEB 3F31A 2ZM0A 3AA1B 2D9DA 5FXXA 4X1KE 2BG9E 4ZZBA 3UUMA 5AQTB 4QKNA 4H9NC 4IDQA 3AXJA 3ZYLA 3H37A 3PUGA 5A1LA 5JDGA 3PUZF 3UQ7A 2B76A 3HL6A 4GYSA 4DR7T 2CXDA 5HWYA 2ODVA 1T98A 2CHNA 4XTCN 4DR4T 1KFYA 4Q25A 2XAHB 2NTYA 4P0AA 5L3DB 5H6RB 1UCUA 2NP9A 4H9QC 2V26A 3UQ4A 3CQCB 5DABA 3I0OA 4QWNB 2ACZA 2E9XA 3FZLB 3QB5K 3ZC0A 2BKNA 2WMNA 1XNRT 3AE2A 3P4QA 5LGNB 4OYKA 4UIGA 2G0UA 1LRZA 3R6NA 1D1BA 3F2EA 2WU5A 2VVNA 4DIDB 3KV5A 4EYUA 3GMIA 3UTKA 4YSZA 4I4TE 5TAOA 4CXXA 3E0ZA 4IDPA 4DMWA 4B3MT 4U31A 3ZC1A 2UU9T 2N2NA 3O1IA 3FB2A 4YMTB 3JC6C 3ZYMA 5JDFA 4TWHA 4ZI2C 1ZOYA 1YW0A 4DR5T 3LK3B 1UURA 4QX8B 3Q5EA 5GONE 3MJXA 4UR9A 3O4XE 4CI3B 3PUXG 3SOLA 2YDRA 3I9WA 3AB3B 3QC9A 4IREA 3HA4A 5AQNB 4LF6T 2Q9QC 3C4ZA 3N9QA 3RIUC 4ZI3D 3Q5DA 4PK4A 3C64A 3D0TA 1ZV4X 4BAYB 2V5CA 4LF7T 4EV6A 3KV6A 3L3PA 1VCSA 2IDOB 1MMNA 2QA7A 3OTOT 2VWAA 5AQVB 1YD8G 3ZYKA 3CQXC 3I1AA 4WBNE 2XJ7A 4N78D 1MNEA 5LMUT 5L47A 4HGAA 4XIGN 1WR0A 3ANWB 4ZOLE 2KINB 3ZCIA 2R6GF 4PNIA 2BG9C 2H89A 2JMKA 5KXJA 3J7Yq 4IHJE 2DHRA 2HHHT 4I50E 4H9OC 2DI4A 4JI0T 5LG3A 5BMVE 2W67A 4MFRA 1XNQT 2MOZA 3ONJA 1SUMB 2DWGA 2Q9QB 5JRCA 2MPKA 4CZZB 2FJEA 3PUYG 4AXPA 5HXCA 4EIWA 4DV2T 5LA6E 3HI2A 2I0MA 5KMGP 4PFPA 5CA0E 2DNXA 1ZHCA 3KINB 4QX7B 2FJDA 4JUYA
chains in the Genus database with same CATH topology
4KHZF 4YMTB 3DHWA 3PUXF 3TUIA 3PUZF 4TQUN 3PUYG 3PUVG 3PUWG 4YMVC 4XIGM 3PUYF 4YMSC 3TUJA 4XTCM 3PUVF 3PUWF 4YMWC 4JBWG 3RLFG 3RLFF 4JBWF 3PV0G 4XIGN 3TUZA 4XTCN 3PV0F 4KHZG 3D31C 4KI0G 4YMUC 4TQUM 2R6GG 4KI0F 3PUXG 2ONKC 2R6GF 3PUZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ F;  4YMT B;  3DHW A;  3PUX F;  3TUI A;  3PUZ F;  4TQU N;  3PUY G;  3PUV G;  3PUW G;  4YMV C;  4XIG M;  3PUY F;  4YMS C;  3TUJ A;  4XTC M;  3PUV F;  3PUW F;  4YMW C;  4JBW G;  3RLF G;  3RLF F;  4JBW F;  3PV0 G;  4XIG N;  3TUZ A;  4XTC N;  3PV0 F;  4KHZ G;  3D31 C;  4KI0 G;  4YMU C;  4TQU M;  2R6G G;  4KI0 F;  3PUX G;  2ONK C;  2R6G F;  3PUZ G; 
#chains in the Genus database with same CATH topology
 2B1E A;  2H88 A;  3B13 A;  5LGU B;  3QUJ A;  1M7K A;  1XMQ T;  5FL1 A;  3Q5X A;  4K0K T;  4H9S E;  3K1S A;  1JNR A;  5EK3 A;  2BG9 B;  2ZM8 A;  5F5W A;  4KHZ G;  1KNP A;  2QYW A;  3PUS A;  5JDM A;  1MND A;  3CWZ B;  3PUW F;  3Q2M A;  3PU8 A;  1KEY A;  4P09 A;  2BS2 A;  3RRC A;  2LE8 A;  5HEG A;  2YK0 A;  1M62 A;  5CGM A;  1FJG T;  3ZN1 B;  5IUX A;  4QHO A;  2D0U A;  2M67 A;  4YTP A;  1E1H B;  3P8C D;  1FMW A;  1SHZ C;  2W00 A;  2W0G A;  1B7T A;  4GYR A;  3N5L A;  4H9P C;  2XY8 B;  4C90 A;  4UF0 B;  3X1D A;  2WDV A;  2XQ5 A;  1L0V A;  4EZ4 A;  1MIV A;  5L3B B;  1HNW T;  2CWO A;  2VK9 A;  3VKG A;  1LVK A;  3ZSS A;  3ABV A;  3AVS A;  3QK6 A;  3AEE A;  2BBJ A;  4TNV A;  3P7I A;  4QH1 A;  1JNZ A;  2BZB A;  2V1D B;  4DR2 T;  4CQI A;  3O1H A;  4JI2 T;  3P4R A;  3PDY A;  4HWI B;  4CN6 A;  1N34 T;  1HX8 A;  1XMO T;  2BBH A;  4GIW A;  4JBW G;  4ILC A;  2LHN A;  4DR1 T;  4ZS3 A;  2E9X D;  1S35 A;  3RPU A;  1CHU A;  4Z8X A;  4A98 A;  1LKX A;  4TX5 A;  2FJA A;  3RYF E;  4PJM A;  4EZH A;  4O4J E;  3ZN0 B;  1W09 A;  3GA8 A;  1MIW A;  2XSA A;  4QXC B;  4EAH A;  3N2G E;  2HH7 A;  3C4X A;  5FNV E;  2E8I A;  1LVF A;  1Y01 A;  5AQP B;  3J9X 1;  2WAU A;  5ABG A;  5J0Z A;  2VL0 A;  5CA1 E;  3HKB E;  2K5B B;  5C2T A;  3QB5 A;  2UXD T;  3I0Q A;  1WR6 A;  5DQW A;  2OLT A;  3C50 A;  4MAL A;  5FXW A;  1T72 A;  4AKG A;  3PUX F;  5FL0 A;  1Y64 B;  1D0X A;  1H7C A;  4G63 A;  2YKS A;  5FYM A;  2X67 A;  3AEB A;  4KP3 C;  2XQ9 A;  3D31 C;  1FIO A;  4TZ4 C;  2IIU A;  2R6G G;  4HFB A;  4QXB B;  4ZEY A;  3ZMS B;  2KWH A;  4JI3 T;  1HNZ T;  3JCF A;  2ZM6 T;  1OWA A;  3LG7 A;  5LMN T;  4UV8 B;  3DJB A;  2JIW A;  2UUB T;  2X0L B;  3ZST A;  4IDO A;  4U72 A;  5AQS B;  5FXV A;  3EUH A;  2WSS V;  3CX8 B;  2YDQ A;  4X20 E;  2JQQ A;  2ZM2 A;  1NEN A;  5C3J A;  1I6Z A;  2K24 A;  2E9X C;  2V7I A;  1BR4 A;  3GWH A;  3RQW A;  4JI5 T;  1IAP A;  3ZJ1 A;  1SA0 E;  2EHO A;  2IC6 A;  4YMS C;  1YKH B;  2WY2 A;  3CML A;  2IUB A;  2W63 A;  3T1H T;  4L9I A;  5JH7 E;  2VKD A;  3VHL A;  4X62 T;  2JQH A;  4IE5 A;  3WAK A;  5JR9 A;  3PUW G;  4XIG M;  2XZE A;  3RIA A;  2CPT A;  2XAJ B;  2YN6 A;  1I94 T;  3ZMT B;  2XPK A;  3FXE B;  5EK4 A;  3OVU A;  2LT3 A;  4IE7 A;  1ZKE A;  2X0H A;  4IT4 A;  3PJA J;  3KVA A;  4DV4 T;  4P0B A;  5AQM B;  1GQE A;  3L39 A;  3RYC E;  1XDP A;  1HR0 T;  2E9X B;  2XM1 A;  3N2K E;  3B57 A;  5EK2 A;  1U4Q A;  2CXL A;  2A3D A;  4NUV A;  5LHG B;  3P4P A;  3SRZ A;  3FZH B;  1XZY A;  2KSR A;  4QXH B;  4I55 E;  3KVB A;  5AQF B;  1MMG A;  4X66 T;  1IJ6 A;  2ZMA A;  3TUJ A;  3VU7 H;  1UUS A;  2XTL A;  3LJC A;  2D0T A;  4ZS2 A;  1BR0 A;  2LM2 A;  2CA5 A;  4H9R C;  3WAJ A;  4HN9 A;  2HN2 A;  5JTG A;  4ZZC A;  1R8I A;  2PFV A;  4OFZ A;  2W61 A;  4ILU A;  4ISS A;  4DV0 T;  4UEM A;  2NW9 A;  3AEA A;  2FBW A;  4DBR A;  4O4I E;  3A8Y C;  2W4X A;  3DP7 A;  4KI0 G;  4HEA A;  2HPL A;  2LOP A;  2VL8 A;  1US7 B;  3K8P C;  4ILA A;  2MYS A;  3C51 A;  1OED A;  4DUY T;  2XHE B;  1FMV A;  4JBW F;  3N9P A;  1DU2 A;  3OYZ A;  1U5P A;  1KF6 A;  2WBL A;  5ABF A;  2IW5 B;  2WDQ A;  5DJQ C;  2LM9 A;  4ZHQ E;  2SPC A;  5IWA T;  3OYX A;  4UV9 B;  1W0B A;  2AE9 A;  3AE4 A;  4IIJ E;  1J5E T;  4U2Y A;  3JAD A;  3BK9 A;  2WU2 A;  1E7P A;  4KBM B;  4DMV A;  5AQG B;  4CN1 A;  4FJO A;  2CWY A;  2ODU A;  2X68 A;  4WBO A;  5FXZ A;  2WCA A;  2BS4 A;  3EDV A;  2N9D A;  2KMF A;  3ETV A;  3FZF B;  3OJA A;  2LJL A;  4U3C A;  4AKR B;  4NXM T;  4DO0 A;  4L0R A;  3SS1 A;  3EHZ A;  4DV3 T;  3NWI A;  1D1A A;  3EAM A;  4AQF A;  4X64 T;  1IJ5 A;  2DCF A;  4NXN T;  4IL4 A;  4AIS A;  2HPJ A;  2XAQ B;  4NPP A;  4G2A A;  4YLH A;  3N9O A;  5HXS A;  3AAA B;  3ZT7 A;  4YHH T;  2FUP A;  2JQK A;  2CM0 A;  3PJA A;  5FY0 A;  4IE4 A;  1D1C A;  5HXH A;  1WRD A;  1X79 A;  5AQQ B;  4C91 A;  1W9R A;  5LOV E;  4GK5 E;  4DND A;  4B6X A;  3SFD A;  2VAS A;  4HWH A;  3PTR B;  5LBM A;  2K3W A;  4ADZ A;  4KX6 A;  3AE1 A;  3UU6 A;  4PJL A;  4IL9 A;  3AE3 A;  2W62 A;  3CK6 A;  4BJM A;  3IF8 B;  2V6X A;  5F8P A;  2C5I T;  2RA1 A;  1OXZ A;  2PJQ A;  2M6I A;  2WWV A;  2X9X A;  3ANW A;  2EHO D;  4AIU A;  4GKK T;  1NEK A;  4UEL A;  4F6R C;  3IBP A;  5JDL A;  2JRK A;  2WS3 A;  2BVM A;  2V6Y A;  3ZEF B;  4KMC A;  4ZI3 C;  2PG8 A;  5LBQ B;  5HEO A;  2LOS A;  4MHC A;  4XBF B;  2VQE T;  5AQL B;  2LLY A;  4YY3 T;  3RIU A;  3WI3 A;  2A72 A;  3RKG A;  3TUI A;  4LF5 T;  2L3L A;  1IBK T;  2V8S V;  2H3R A;  5AFU L;  4YJ2 E;  3E22 E;  4EYY R;  3KBT A;  3VKH A;  4GOU A;  3UU5 A;  3UUB A;  5LG4 A;  2WZI A;  4AI6 A;  4YJ3 E;  4TQU N;  1BR2 A;  2YU2 A;  3E08 A;  2ZLY A;  4XZC A;  2Y8D A;  2J1D G;  4O2A E;  2YU1 A;  2F4V T;  2WWU A;  2JMH A;  2L8K A;  3AA7 B;  3NZQ A;  4COF A;  4I43 B;  1OED E;  5FKY A;  2LKG A;  4YTM A;  4ERR A;  2NW8 A;  5J2T E;  2XSB A;  3DTO A;  3C98 B;  1UGO A;  3MKD A;  3RHW A;  4LFC T;  4Z91 A;  2X51 A;  4KI0 F;  3AEF A;  4B3T T;  4NIQ A;  5LCY A;  4L5G A;  2KXP B;  2X9Y A;  5DQV A;  2XQ3 A;  2UXX B;  5JDN A;  3AEC A;  3K3N A;  2LSK A;  3KBU A;  3MA9 A;  5LHH B;  5AQH B;  5ADX L;  5L3F B;  2A9U A;  5JVD E;  5L4H A;  2RPA A;  3EVY A;  4ANJ A;  1HF8 A;  5L4E A;  3RC3 A;  4B3S T;  2VUR A;  2CHO A;  5L3G B;  4PFO A;  2NW7 A;  2XQ6 A;  2LRK A;  2HN1 A;  3ZMU B;  2CRB A;  2QGS A;  5LNK A;  3LBX B;  5JR9 C;  4KUM B;  3AE5 A;  5AQU B;  4DV6 T;  3RH3 A;  3UU8 A;  3HKC E;  2OV9 A;  4IE0 A;  3AVR A;  1UX4 A;  5LB7 B;  3MK7 C;  3ONL C;  4YSY A;  4HFC A;  3R84 B;  2YEV C;  4TV9 E;  1KNZ A;  1Z0P A;  2MTQ A;  1J5W A;  3T1Y T;  4OK0 A;  3GN5 A;  3HR0 A;  3OKQ A;  2PTF A;  2ONK C;  5BR8 T;  5FMN A;  3KFW X;  3TLT A;  4LFB T;  5FY7 A;  2A2F X;  4IGU A;  2V7L A;  2MBG A;  2EHO B;  3MAC A;  4QH5 A;  3ZJ2 A;  3PUA A;  3PV0 G;  1ZEE A;  2WP9 A;  1YQ3 A;  5F3J A;  5HXE A;  4PJN A;  1VOM A;  3I9Y A;  4TV8 E;  5JDQ A;  4TN7 B;  4YHJ A;  5JR9 B;  2UUA T;  5HCM A;  3RLF F;  4JI4 T;  3B5M A;  3NBX X;  3PUQ A;  3CX6 B;  1D0Y A;  2J4G A;  3L09 A;  4JYA T;  1MMA A;  3M65 A;  5L3E B;  2VVS A;  4YTN A;  5H6Q B;  2V5D A;  4HFD A;  2XQ7 A;  4HWF A;  1OED C;  4J2C A;  2D5U A;  3RYI E;  4CXY A;  1HNX T;  3TLW A;  4HTE A;  4O4L E;  3AE8 A;  5IYZ E;  3AXJ B;  5HEH A;  1D0Z A;  4HFE A;  2PBI A;  3FHN A;  2X66 A;  4HFV A;  4U2Z A;  3U3I A;  5LJM A;  2WM9 A;  3PUR A;  3UUL A;  3LK4 2;  4YMU C;  2DLR A;  3TKL B;  3V5S A;  4O8S A;  1XDO A;  4ILB A;  1X9B A;  2MAW A;  4ZI2 D;  5ETW A;  1NAF A;  1HX1 B;  3PU3 A;  5ABE A;  5FVK A;  5LXT E;  2Z6E A;  4EB6 E;  4OYJ A;  4B3R T;  3BQL A;  5EZY E;  3FZM B;  2I59 A;  1UX5 A;  3UU4 A;  3ONX A;  2Q9Q D;  1KNR A;  1OED B;  4P1N A;  4YXD A;  5LJN A;  4A5X A;  4AQF C;  3CVR A;  4GK0 E;  3N9M A;  2CLY B;  4XAX B;  3RQU A;  4DV1 T;  3JAE A;  4DR3 T;  5LYJ E;  3TLS A;  4LF9 T;  5ABF B;  2KZ7 B;  2QRX A;  2CEA A;  3CX7 B;  4HWD A;  4AQG A;  2J47 A;  3PE0 A;  4JEH B;  1EZ3 A;  3NZP A;  3CKD A;  4F8H A;  4U7Y A;  2CMR A;  2VB6 A;  4ASK A;  2WZH A;  4JV5 T;  4WW0 A;  5CB4 E;  2FJB A;  4HFH A;  2YDS A;  4EGW A;  4YMW C;  4TNW A;  5HWX A;  3NRX A;  3QNU A;  4DV7 T;  4X5T A;  4BA9 A;  1HG2 A;  2NTX A;  2K9A A;  2BS3 A;  2CCQ A;  5KDM C;  2LSG A;  4JEU B;  4UVB B;  1UK5 A;  1V9D A;  4IST A;  2UUC T;  3ZMV B;  1G73 A;  4UVC B;  5HEJ A;  4X1I E;  4JI1 T;  1AJ3 A;  2DL1 A;  3ZPO A;  4TQU M;  1IZN B;  3VRB A;  2LRL A;  1VRB A;  4E7Z A;  3FBL A;  4LMK A;  4JI8 T;  3VR9 A;  4UXN B;  1E2A A;  4K0U A;  2RP4 A;  2X0Y A;  4HFI A;  4TWF A;  1HCI A;  2W2U A;  2E5L T;  5FVL A;  2ACX A;  5FY1 A;  3A7M A;  3PUV F;  5JRC B;  2LHR A;  1T8B A;  2OA5 A;  2VKO A;  2X9W A;  3CPZ A;  5L3C B;  3S4U A;  4BJN A;  1O3X A;  1YKE B;  4WYV A;  3ZKR A;  2BVL A;  2W66 A;  4YT0 A;  2IC9 A;  4EOZ B;  3AE7 A;  3RRW A;  3RLF G;  2UXC T;  1KK7 A;  2YOE A;  3LK2 B;  4EEB A;  3PV0 F;  2Y48 B;  5JRE A;  2C5J A;  4JI6 T;  4LF8 T;  3K3Q C;  4JI7 T;  4X65 T;  4CI1 B;  3ETU A;  4OX9 T;  2V6Y B;  2XAS B;  4U74 A;  4LFA T;  5AQR B;  4EXT A;  1MMD A;  3QOF A;  2KWI B;  4DBQ A;  5LHI B;  4MLK A;  4MBQ A;  5M4Y A;  2QVA A;  2C0S A;  4FI5 A;  1S94 A;  2XM2 A;  3UUN A;  3TLV A;  3UT5 E;  3DHW A;  3N9L A;  3K3O A;  3ZT6 A;  4OHF A;  5J2U E;  3EDU A;  2K48 A;  1WFD A;  1N33 T;  1QUU A;  2XQA A;  2E2A A;  4O4H E;  2KT9 A;  3F57 A;  3RX6 A;  3L8R A;  4YFS A;  2LKH A;  3UFG A;  4CI2 B;  3AED A;  2WDR A;  4Z90 A;  3RC8 A;  2Q9Q A;  3TLU A;  1T7S A;  2LSY A;  3P50 A;  2I6H A;  1WCR A;  3P4S A;  4NUU A;  2Y6X A;  2NWB A;  2IML A;  1W0A A;  3AAI A;  3C4W A;  3P4W A;  3SFE A;  5FP3 A;  4DUZ T;  4A56 A;  3PUZ G;  3HKE E;  5LGT B;  2LEH A;  3OPC A;  2DWK A;  3AA6 B;  3FZK B;  3MXZ A;  5KX5 E;  4H63 H;  1QSD A;  2P9B A;  2LSJ A;  5HXR A;  3UU3 A;  4AKI A;  1WYC A;  2BG9 A;  3FBZ A;  3RF1 A;  3CIR A;  4HWC A;  1HG5 A;  3H3A A;  4LML A;  3UFE A;  4GKJ T;  2N1G A;  3CQG B;  3AE9 A;  2M6B A;  2CBI A;  1HS7 A;  2IAK A;  4TUY E;  3RYH E;  4ZXL A;  2WQY A;  4LMJ A;  2E5V A;  3BQI A;  3OBV E;  3H3M A;  3RGL A;  2XUE A;  3MZK B;  4AKL A;  4PK5 A;  1N36 T;  2VQF T;  4IE6 A;  2AXD S;  4UF0 A;  2BDE A;  4PK6 A;  3ESL A;  1N32 T;  3AEG A;  2EHO C;  5L2L A;  2L9Q A;  4IDZ A;  4CXW A;  4HKA A;  3GN5 B;  1XWM A;  1ZP0 A;  5HAX A;  1Z8U A;  3W15 B;  2H7V C;  3NKZ A;  1IBM T;  2CXF A;  5AQO B;  2BKP A;  1MIY A;  3LDQ B;  4I0U A;  3NVO A;  2UXB T;  5IHY A;  3VR8 A;  2XQ8 A;  4TWD A;  5E0O A;  5LP6 E;  4A97 A;  5CFB A;  4UVA B;  3Q5W A;  2ES0 A;  4PAG A;  1IBL T;  4EED A;  3PUV G;  4XTC M;  1YQ4 A;  4KHP T;  3VRA A;  4JLE A;  2H7O A;  3HKD E;  1FEW A;  1NWM X;  3IA3 A;  3T8O A;  3U78 A;  5HCJ A;  2VKJ A;  5AQI B;  4WZX A;  3N9N A;  2X9H A;  3EAB A;  4H63 V;  3RIF A;  4M1P A;  4HE8 A;  2XQ4 A;  5ABH A;  4PW8 A;  3RKO A;  3A5X A;  3ZLI A;  5HYA A;  5J1G A;  3FXD B;  3V5U A;  2JPF A;  2GK9 A;  2KLQ A;  4U33 A;  2UXN B;  2V7K A;  3LFM A;  2KND A;  4YMV C;  4YSX A;  3IEE A;  3LBX A;  2YIN A;  2WB5 A;  2BKO A;  1WYB A;  2XAG B;  2JJ9 A;  3O9X A;  3KV9 A;  1HFA A;  2CBJ A;  1J1J A;  4DR6 T;  2V7J A;  2JQ9 A;  2XAF B;  5AQJ B;  4PJJ A;  2D2S A;  3LSV A;  5HEU A;  2V7M A;  4V1A v;  3NRY A;  3KDS E;  4AQY T;  4O2B E;  3JAF A;  5JQG E;  1BR1 A;  3N2O A;  3SWH A;  2CLY C;  3O1J A;  3BQK A;  2VKH A;  3PUY F;  3RI5 A;  4E7S A;  4AKH A;  2IHR 1;  3IHR A;  3UUX B;  4U7I A;  3KV4 A;  3ZMZ B;  3AE6 A;  1SE7 A;  3ZCJ A;  5JDH A;  3JC6 D;  3Q9D A;  4QH4 A;  1YXR A;  3M3Z B;  3EI0 A;  2C5K T;  1QLB A;  1CUN A;  4WNK A;  5CJ5 A;  3AA0 B;  2NOX A;  4DV5 T;  4CN4 A;  5AQK B;  2CE7 A;  3TUZ A;  3ZT5 A;  4IDN A;  2WMO A;  2XQY A;  1HTJ F;  2J62 A;  1VCT A;  2NR4 A;  4X1Y E;  4KHZ F;  1WLX A;  2LSI A;  3G06 A;  5C8Y E;  4LF4 T;  4ZI7 E;  1G8X A;  4DVD A;  3AAE B;  3F31 A;  2ZM0 A;  3AA1 B;  2D9D A;  5FXX A;  4X1K E;  2BG9 E;  4ZZB A;  3UUM A;  5AQT B;  4QKN A;  4H9N C;  4IDQ A;  3AXJ A;  3ZYL A;  3H37 A;  3PUG A;  5A1L A;  5JDG A;  3PUZ F;  3UQ7 A;  2B76 A;  3HL6 A;  4GYS A;  4DR7 T;  2CXD A;  5HWY A;  2ODV A;  1T98 A;  2CHN A;  4XTC N;  4DR4 T;  1KFY A;  4Q25 A;  2XAH B;  2NTY A;  4P0A A;  5L3D B;  5H6R B;  1UCU A;  2NP9 A;  4H9Q C;  2V26 A;  3UQ4 A;  3CQC B;  5DAB A;  3I0O A;  4QWN B;  2ACZ A;  2E9X A;  3FZL B;  3QB5 K;  3ZC0 A;  2BKN A;  2WMN A;  1XNR T;  3AE2 A;  3P4Q A;  5LGN B;  4OYK A;  4UIG A;  2G0U A;  1LRZ A;  3R6N A;  1D1B A;  3F2E A;  2WU5 A;  2VVN A;  4DID B;  3KV5 A;  4EYU A;  3GMI A;  3UTK A;  4YSZ A;  4I4T E;  5TAO A;  4CXX A;  3E0Z A;  4IDP A;  4DMW A;  4B3M T;  4U31 A;  3ZC1 A;  2UU9 T;  2N2N A;  3O1I A;  3FB2 A;  4YMT B;  3JC6 C;  3ZYM A;  5JDF A;  4TWH A;  4ZI2 C;  1ZOY A;  1YW0 A;  4DR5 T;  3LK3 B;  1UUR A;  4QX8 B;  3Q5E A;  5GON E;  3MJX A;  4UR9 A;  3O4X E;  4CI3 B;  3PUX G;  3SOL A;  2YDR A;  3I9W A;  3AB3 B;  3QC9 A;  4IRE A;  3HA4 A;  5AQN B;  4LF6 T;  2Q9Q C;  3C4Z A;  3N9Q A;  3RIU C;  4ZI3 D;  3Q5D A;  4PK4 A;  3C64 A;  3D0T A;  1ZV4 X;  4BAY B;  2V5C A;  4LF7 T;  4EV6 A;  3KV6 A;  3L3P A;  1VCS A;  2IDO B;  1MMN A;  2QA7 A;  3OTO T;  2VWA A;  5AQV B;  1YD8 G;  3ZYK A;  3CQX C;  3I1A A;  4WBN E;  2XJ7 A;  4N78 D;  1MNE A;  5LMU T;  5L47 A;  4HGA A;  4XIG N;  1WR0 A;  3ANW B;  4ZOL E;  2KIN B;  3ZCI A;  2R6G F;  4PNI A;  2BG9 C;  2H89 A;  2JMK A;  5KXJ A;  3J7Y q;  4IHJ E;  2DHR A;  2HHH T;  4I50 E;  4H9O C;  2DI4 A;  4JI0 T;  5LG3 A;  5BMV E;  2W67 A;  4MFR A;  1XNQ T;  2MOZ A;  3ONJ A;  1SUM B;  2DWG A;  2Q9Q B;  5JRC A;  2MPK A;  4CZZ B;  2FJE A;  3PUY G;  4AXP A;  5HXC A;  4EIW A;  4DV2 T;  5LA6 E;  3HI2 A;  2I0M A;  5KMG P;  4PFP A;  5CA0 E;  2DNX A;  1ZHC A;  3KIN B;  4QX7 B;  2FJD A;  4JUY A; 
#chains in the Genus database with same CATH homology
 4KHZ F;  4YMT B;  3DHW A;  3PUX F;  3TUI A;  3PUZ F;  4TQU N;  3PUY G;  3PUV G;  3PUW G;  4YMV C;  4XIG M;  3PUY F;  4YMS C;  3TUJ A;  4XTC M;  3PUV F;  3PUW F;  4YMW C;  4JBW G;  3RLF G;  3RLF F;  4JBW F;  3PV0 G;  4XIG N;  3TUZ A;  4XTC N;  3PV0 F;  4KHZ G;  3D31 C;  4KI0 G;  4YMU C;  4TQU M;  2R6G G;  4KI0 F;  3PUX G;  2ONK C;  2R6G F;  3PUZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...