3PUZF

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
486
structure length
481
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
total genus 126
structure length 481
sequence length 486
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puzF02
4YMVC 4KHZF 3TUIA 3PUXG 3PUWG 3RLFF 3PUZG 2R6GG 4JBWG 3PV0F 3PUVG 4YMTB 3PUYF 4YMUC 3PUWF 3PUXF 4JBWF 3PUZF 2R6GF 3PUVF 3TUJA 4KI0G 3TUZA 4YMSC 4KHZG 4XIGM 4XIGN 3RLFG 4YMWC 4TQUM 4TQUN 2ONKC 3PV0G 3D31C 4XTCM 4XTCN 3DHWA 4KI0F 3PUYG
chains in the Genus database with same CATH superfamily
2HPJA 5HEOA 2WU2A 4AXPA 4CXWA 5FVKA 4AQGA 2ZM8A 3WI3A 3AXJB 1T8BA 1J5ET 1M7KA 1KEYA 3I9WA 2V26A 4QWNB 3KBTA 4CZZB 2C5JA 2NR4A 4WYVA 4I55E 3RH3A 4A98A 4ZI3C 3KVAA 2VB6A 3QC9A 4LFCT 4EEDA 5JRCA 1KF6A 4LMKA 3S4UA 3ONJA 2CHNA 2XAQB 2E9XB 3EDVA 4LF7T 3AEEA 4O4IE 1N34T 3CX7B 4Q25A 4YJ3E 3T1YT 4YSZA 4LF8T 5JQGE 3PE0A 3UU4A 3Q9DA 2A3DA 4KBMB 3LG7A 1OEDE 5HWXA 2DNXA 3CK6A 3PUZG 3TLVA 2XAGB 3RQWA 4YHHT 4YMTB 2XZEA 1G8XA 5HYAA 4PW8A 3ZCIA 3LJCA 2W00A 4QX8B 4CN4A 3L39A 3ZEFB 2E2AA 3C4WA 3KVBA 2RA1A 2NTYA 4DBRA 4QXBB 4OX9T 3C51A 3RPUA 2CWOA 3EUHA 2MAWA 4MHCA 5HEJA 2WZHA 4DR5T 1R8IA 4XZCA 3NKZA 3HL6A 5JDQA 4M1PA 3ZLIA 3WAKA 1XNRT 1VRBA 5FVLA 4PFOA 4H9QC 3N9QA 3PUWF 3QUJA 3SFEA 4I4TE 2IDOB 4YT0A 3CQCB 4JI7T 2VK9A 3ZN0B 3N9NA 2XQ7A 4DIDB 3C4ZA 1HX1B 3QB5A 3TUZA 3ZYMA 3C98B 1I6ZA 1T72A 2IUBA 2K48A 1MMGA 2HHHT 5LGUB 3J9X1 1N36T 2IC6A 3JC6D 5FKYA 3FZLB 3UQ4A 4H9SE 1YW0A 2X9YA 2DI4A 3RYFE 1MIVA 1WRDA 3SWHA 1BR2A 4KX6A 3HKEE 3PUQA 3W15B 5JVDE 5AFUL 4HEAA 4ZZBA 4YY3T 3UFEA 4C90A 1HNZT 5HXSA 3RC8A 5FY0A 3BQLA 4O2AE 2QA7A 5L3BB 5J2UE 4CQIA 4TV9E 3VRAA 3UUMA 3PV0G 5FMNA 3UUBA 5JREA 2BS4A 1WCRA 5FY1A 4AQFA 2QGSA 4OK0A 1ZP0A 3JAEA 4UXNB 2LHRA 4K0KT 5L2LA 5L3DB 2YU1A 3V5UA 3AE7A 3OJAA 3P4QA 2IC9A 3BQKA 1D1CA 3NRYA 5JR9C 3DJBA 2Q9QC 1HNXT 2KLQA 3E0ZA 5DQVA 3TLSA 3ETUA 2NW9A 4DV4T 1S94A 1IAPA 5JDGA 1XMOT 2LT3A 3ZC1A 1LRZA 5EK3A 2W67A 4Z91A 4XTCM 3RYCE 4IDNA 4X5TA 2BS2A 3GN5A 4YFSA 3RKOA 1HX8A 3LFMA 4XAXB 3R84B 5FYMA 2D0TA 4ZI2D 2M67A 3N2KE 1B7TA 3D31C 2N2NA 3NBXX 4JEHB 5AQLB 2XASB 2VKJA 3LBXB 3NZPA 2EHOC 3OTOT 3UQ7A 4A56A 4U31A 1E7PA 2LSYA 5J0ZA 4IGUA 3C64A 3AE2A 4XTCN 4AKIA 4ZHQE 3TUIA 5IHYA 2NWBA 4U7IA 5DABA 5HEUA 3P7IA 2NP9A 4C91A 2BS3A 3H3AA 2X0LB 4ZI3D 2WAUA 4DV6T 1VCSA 3AE9A 5JR9B 3Q5XA 1FIOA 3P4SA 2M6BA 1ZEEA 4ILCA 4X1YE 1OEDC 2YDQA 3O1JA 4UEMA 3P4RA 1AJ3A 3ZT5A 2JPFA 2VWAA 4KI0G 2LRLA 4KHZG 1L0VA 3IHRA 4DNDA 2ES0A 4L9IA 4UV9B 1BR1A 3VKGA 2HH7A 2WMNA 3DHWA 1EZ3A 2H7VC 3CVRA 4GOUA 2ODUA 5E0OA 3RHWA 3K1SA 1QSDA 2W4XA 3IF8B 5KMGP 2WY2A 1XMQT 5AQQB 2C0SA 3NRXA 5HCJA 4TNVA 4GIWA 5LMNT 4CN6A 3V5SA 3KV5A 4PJJA 1IJ6A 4HFEA 3AA0B 3NVOA 3N2GE 3AA7B 4KP3C 4JV5T 5JDLA 2R6GF 1D1BA 3CX8B 1YKHB 5LYJE 3A8YC 4HWHA 4P09A 3IEEA 5HXHA 4PK4A 3JAFA 3RYIE 2FJAA 1IJ5A 4B6XA 2B76A 4QH5A 2LSJA 2XM2A 5AQSB 3AE8A 2WQYA 3UU6A 2NTXA 4CI3B 3AA6B 3ZCJA 5CA1E 4CXXA 3LK42 5ABFB 4DO0A 4OHFA 1OEDB 5JDMA 5DJQC 4MFRA 1N33T 5FXVA 1LVKA 2ZM6T 1JNZA 1IZNB 4QXHB 3ZYKA 3TKLB 3FBLA 2KNDA 4U2YA 3EI0A 3MXZA 2YDSA 3AEBA 4Z8XA 5HEHA 4L5GA 3AE6A 2RP4A 2ZLYA 3HKDE 1HTJF 5ABEA 5LG3A 4JUYA 1UURA 3OPCA 4EV6A 2XQ4A 2K9AA 2V6YA 2V5DA 3KV9A 4HTEA 5L47A 2WZIA 2LKGA 3UUNA 4YLHA 5IYZE 4UF0B 1QLBA 3EVYA 2LOPA 1UX5A 4HFHA 3MZKB 4U33A 5LBMA 2UXXB 5CGMA 1NEKA 2VKDA 2JJ9A 1VCTA 2BG9B 3DP7A 2OV9A 5EK4A 4E7SA 2V1DB 3LSVA 4E7ZA 4IE0A 3RKGA 2E8IA 1T7SA 5DQWA 5JDFA 2AXDS 2W63A 4GYRA 3PUGA 5LGTB 1NWMX 4PJMA 4X20E 2X68A 4AISA 2K5BB 2Q9QD 3RIUC 4G63A 3KBUA 3SS1A 2YDRA 3KV6A 4F8HA 4XIGM 3RX6A 3VR8A 4U2ZA 4JI5T 4HWIB 4IDOA 2MYSA 1KNZA 4DV0T 2WWUA 5L3GB 3A7MA 3GA8A 3JCFA 4I43B 3AAAB 3RLFF 4LF9T 1FEWA 4CN1A 3TLWA 3PTRB 3ZT6A 2VVSA 2EHOD 3N9MA 2PJQA 2CMRA 1OXZA 4XIGN 3PU3A 3FZHB 4X62T 4LMJA 4IE5A 2IW5B 3RGLA 4Z90A 3PU8A 5FL0A 1FMVA 2BBJA 1ZHCA 1UCUA 1O3XA 2DWGA 4PFPA 1D0YA 4P0BA 3LK3B 4X65T 3ZMSB 4B3MT 5ADXL 3UU8A 4LF5T 1SA0E 2CXFA 4HWDA 2Q9QA 4JBWG 2VURA 2VKHA 1XDOA 4WZXA 3PUYF 4EXTA 3UULA 2OA5A 5AQRB 3H37A 4YTMA 4IT4A 1Y01A 4HGAA 5CA0E 5LHIB 2N9DA 3VR9A 3AVRA 2BG9E 4OYKA 3CKDA 4CI2B 2W0GA 4IL4A 1E1HB 4BJMA 1NENA 5HAXA 2WS3A 2A72A 3UFGA 2CA5A 4ZI7E 2XUEA 3GMIA 1N32T 3F2EA 2K3WA 5LGNB 3BK9A 2BKOA 5LJNA 2LM2A 3AE5A 4IDZA 1LVFA 2KZ7B 2EHOA 1KK7A 3FHNA 3TLUA 5AQOB 5GONE 4TV8E 2J47A 3KINB 5AQFB 4UIGA 3KV4A 4DV3T 4L0RA 3U3IA 4YTPA 3ZMVB 3ZSSA 3L8RA 3O4XE 3PUXG 2UUAT 4X1IE 2CE7A 1WFDA 4BJNA 4GKKT 3ZYLA 5KX5E 4AKGA 4DR2T 2CEAA 3AVSA 5L4EA 5BR8T 2XQYA 5M4YA 4JI8T 3UUXB 2W61A 2XQ8A 2FJBA 4O4HE 2ODVA 4H63H 5F8PA 3QB5K 5C3JA 4I50E 1Z8UA 4YMSC 1W9RA 4JI4T 2LSGA 3CWZB 3PUVG 3SRZA 3EHZA 1SE7A 3L09A 2E9XD 4JI2T 5LHHB 2UUCT 4B3RT 3Q2MA 4ILUA 3ZMUB 3OYZA 4X66T 2L9QA 1XNQT 2ONKC 2X67A 2XPKA 3E22E 2Y48B 1NAFA 3AB3B 1BR4A 2BVMA 5HEGA 3SOLA 4U7YA 4NUUA 1HS7A 2XQ9A 3J7Yq 4JI6T 5AQGB 5JRCB 3A5XA 2ACZA 4QH1A 2D2SA 4NXMT 1S35A 3FZMB 5L4HA 1U5PA 3ZJ1A 2CHOA 3N9LA 3ANWA 4YJ2E 1KFYA 4OYJA 2K24A 3R6NA 4HFDA 4DV1T 3B13A 4K0UA 1HR0T 2C5IT 4H9RC 3AA1B 3ESLA 3AAIA 3AXJA 2W66A 5EZYE 2BKPA 2KSRA 4PK6A 4QKNA 1HNWT 3MJXA 3EABA 3PUZF 3AE1A 4TN7B 4PJLA 1HF8A 2PTFA 3M65A 1SHZC 3FZFB 3RQUA 2VL8A 2E5VA 4ZXLA 3Q5WA 2E9XA 3HI2A 3I0OA 4TX5A 4A97A 4N78D 5LBQB 3P8CD 3PUSA 2N1GA 2VQET 3ZKRA 2DCFA 2CBJA 2NOXA 3KDSE 3QNUA 3SFDA 2V7IA 2BDEA 4ILBA 4TWDA 4WW0A 2X9HA 2H3RA 4AQFC 2LE8A 3WAJA 5L3EB 3AECA 4WBOA 2KMFA 3ZSTA 4JBWF 4X1KE 3ZN1B 3AEDA 4YMWC 5HXRA 2QYWA 2XQ6A 4F6RC 3ZC0A 2JQQA 1H7CA 5FL1A 2XQ5A 4O4JE 3MKDA 4HFCA 2JMHA 2V5CA 2CRBA 2VVNA 2Y8DA 2UUBT 2FBWA 5LXTE 4ZS2A 5J1GA 5AQHB 3HKBE 1T98A 1MIWA 5CJ5A 2Y6XA 1W0BA 1ZOYA 2I0MA 5IUXA 3OVUA 4H63V 2BG9C 2DHRA 3ETVA 3RIUA 4DMWA 5FXXA 3MA9A 4ISSA 4B3TT 1XDPA 3RRCA 1I94T 4HWCA 2PBIA 2YOEA 2QVAA 2RPAA 2H88A 4QH4A 2CLYB 4EOZB 2J1DG 4YMUC 3ZMZB 4GK5E 2VKOA 2X9WA 4U74A 3MACA 4B3ST 5BMVE 5LJMA 2J4GA 3DTOA 2YKSA 3ZPOA 2J62A 4J2CA 3PV0F 1MMDA 1VOMA 2WMOA 5FP3A 4DUYT 1QUUA 3AEAA 4UVAB 3JADA 3TUJA 3C4XA 2XSBA 4QXCB 2WM9A 5LHGB 3L3PA 4U72A 3I1AA 2YK0A 4HN9A 3GWHA 4DUZT 4IIJE 2V7MA 1KNRA 4UVBB 3O9XA 3ABVA 4H9NC 2WDQA 2YN6A 4A5XA 3PUVF 3RIFA 2FUPA 3TLTA 2XQ3A 3K3QC 2LSKA 3ZMTB 3ONLC 4GKJT 3GN5B 1IBMT 3RC3A 2HN1A 2DL1A 3P50A 4ZS3A 3VRBA 4UVCB 2CWYA 1D0ZA 2YU2A 5JDHA 2B1EA 2XM1A 5AQMB 3ZJ2A 2X66A 3FBZA 4EYYR 1BR0A 3HKCE 5CFBA 4MALA 4DR6T 4YMVC 4O4LE 1WYBA 2ZM2A 1WLXA 2XAJB 1YQ3A 3RRWA 3RF1A 2XAHB 3MK7C 2X0HA 4H9OC 1UGOA 4IE4A 5HXCA 3FB2A 3T8OA 3B5MA 4P0AA 4EEBA 1OWAA 4EAHA 2F4VT 2UXDT 2VQFT 4IE7A 3RYHE 4JI3T 2H7OA 4IL9A 2V7LA 2XSAA 1MNEA 4FI5A 5AQPB 1JNRA 2JQ9A 2I6HA 2WBLA 3LK2B 3PJAA 2XAFB 2MBGA 1YKEB 3LBXA 3PUAA 3B57A 5JTGA 4KUMB 1J1JA 3EDUA 3NZQA 1E2AA 1MIYA 4BA9A 4DR7T 3M3ZB 4O8SA 5L3FB 3U78A 4KI0F 4YSYA 4KHZF 3AE3A 5F3JA 3P4PA 5C8YE 2ZMAA 4NXNT 2MOZA 1W0AA 2P9BA 1US7B 1CUNA 2XHEB 4UV8B 2D5UA 2FJDA 4IDQA 2WB5A 2WP9A 5JR9A 1W09A 4EIWA 1HCIA 5ABHA 5HCMA 1KNPA 2JQKA 4H9PC 3NWIA 4G2AA 5AQVB 5LG4A 4EGWA 3CQXC 3O1IA 4DBQA 4TQUM 1V9DA 2KXPB 1YXRA 5KXJA 4AQYT 1G73A 4O2BE 2V6XA 1FMWA 4DV5T 4NIQA 4HFBA 1SUMB 5C2TA 2I59A 3C50A 1GQEA 3E08A 2JQHA 4I0UA 3CIRA 2VL0A 1IBKT 1Y64B 2R6GG 1X79A 2KWIB 4HFIA 3ONXA 3KFWX 4IDPA 4PJNA 4EZHA 3UU3A 3Q5EA 1UUSA 3HA4A 4AKHA 4TQUN 3N9PA 4EZ4A 5FXZA 3AAEB 2E5LT 4PAGA 2LKHA 3T1HT 4FJOA 2A2FX 5LB7B 5AQTB 2V6YB 3K3OA 4QHOA 5CB4E 4YTNA 5ABFA 3AEGA 1OEDA 2WDRA 2XTLA 4NUVA 3QK6A 4EB6E 4IHJE 2XY8B 3Q5DA 5JDNA 1DU2A 3P4WA 4DR4T 4WNKA 1LKXA 2LOSA 4GK0E 3X1DA 3ZT7A 1WR6A 3VU7H 4OFZA 4AIUA 1CHUA 1WR0A 2LHNA 5LP6E 2DLRA 2UXCT 2X0YA 4LMLA 4TZ4C 3OBVE 4ZOLE 4HKAA 3CMLA 2C5KT 5FXWA 5AQNB 4ILAA 4DMVA 5FY7A 2MPKA 2X51A 3HR0A 4LFAT 4V1Av 4JYAT 3IA3A 1UK5A 5AQKB 3RI5A 1MNDA 3PDYA 4UF0A 2DWKA 3F57A 4CXYA 5FNVE 4COFA 5TAOA 3H3MA 3PURA 4UR9A 2CPTA 2LLYA 1UX4A 3OYXA 5LMUT 2CXDA 4ZEYA 2OLTA 2YINA 2BG9A 3K3NA 1HFAA 5AQIB 1MMAA 2A9UA 2CBIA 5JH7E 2AE9A 2GK9A 3FXEB 4ERRA 1YD8G 4QX7B 3EAMA 2WDVA 2D9DA 4DV2T 5IWAT 4YHJA 1X9BA 2Z6EA 3IBPA 5F5WA 4U3CA 2JIWA 4DV7T 2IIUA 1WYCA 3CPZA 5H6RB 2JRKA 4JI1T 3PJAJ 2CLYC 3D0TA 3O1HA 1XZYA 4TWHA 4MBQA 3VHLA 3RLFG 4ASKA 1XWMA 1D0XA 3OKQA 4X64T 5ABGA 2UXBT 2Q9QB 2WSSV 4PNIA 4ANJA 5LA6E 4MLKA 2CM0A 1HG2A 2NW7A 5H6QB 4LF4T 4GYSA 2BBHA 4KMCA 2LRKA 4LF6T 2XJ7A 4IREA 3RIAA 2HN2A 3UT5E 3FXDB 2CCQA 2QRXA 2MTQA 2W62A 4YSXA 5J2TE 3JC6C 4TUYE 4AKLA 2LM9A 3K8PC 4JI0T 2W2UA 3PUYG 4BAYB 3FZKB 2EHOB 3PUWG 3UU5A 5L3CB 4JLEA 4ZZCA 4LFBT 3UTKA 4XBFB 4HE8A 2KT9A 3AE4A 2CXLA 1FJGT 2X9XA 2V7JA 3AEFA 2BZBA 2V7KA 5LOVE 4DR3T 1YQ4A 4AKRB 2WU5A 5ETWA 1D1AA 5LCYA 5LNKA 4TWFA 2LSIA 1ZV4X 3PUXF 1Z0PA 2IHR1 4P1NA 5AQJB 4EYUA 2M6IA 4NPPA 3G06A 3CX6B 1M62A 2KWHA 2PG8A 2FJEA 1IBLT 2LJLA 4TNWA 4JEUB 4KHPT 3N5LA 4YXDA 2D0UA 2LEHA 3I0QA 2H89A 3I9YA 4ISTA 4WBNE 2XQAA 4PK5A 3QOFA 4ADZA 4UELA 2L3LA 4HWFA 2L8KA 2G0UA 2ZM0A 2BVLA 2E9XC 2UXNB 1U4QA 5KDMC 2HPLA 2YEVC 2IAKA 3N9OA 5EK2A 2WCAA 1ZKEA 2VASA 3VKHA 1J5WA 2V8SV 2WWVA 3BQIA 2BKNA 4DR1T 2SPCA 2UU9T 4DVDA 3LDQB 4HFVA 2JMKA 2NW8A 4ZI2C 3N2OA 3CQGB 5AQUB 5HWYA 4AI6A 1HG5A 2ACXA 2IMLA 1MMNA 4CI1B 5A1LA 2PFVA 3ANWB 2KINB 3F31A 5HXEA 4IE6A
chains in the Genus database with same CATH topology
4YMVC 4KHZF 3TUIA 3PUXG 3PUWG 3RLFF 3PUZG 2R6GG 4JBWG 3PV0F 3PUVG 4YMTB 3PUYF 4YMUC 3PUWF 3PUXF 4JBWF 3PUZF 2R6GF 3PUVF 3TUJA 4KI0G 3TUZA 4YMSC 4KHZG 4XIGM 4XIGN 3RLFG 4YMWC 4TQUM 4TQUN 2ONKC 3PV0G 3D31C 4XTCM 4XTCN 3DHWA 4KI0F 3PUYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMV C;  4KHZ F;  3TUI A;  3PUX G;  3PUW G;  3RLF F;  3PUZ G;  2R6G G;  4JBW G;  3PV0 F;  3PUV G;  4YMT B;  3PUY F;  4YMU C;  3PUW F;  3PUX F;  4JBW F;  3PUZ F;  2R6G F;  3PUV F;  3TUJ A;  4KI0 G;  3TUZ A;  4YMS C;  4KHZ G;  4XIG M;  4XIG N;  3RLF G;  4YMW C;  4TQU M;  4TQU N;  2ONK C;  3PV0 G;  3D31 C;  4XTC M;  4XTC N;  3DHW A;  4KI0 F;  3PUY G; 
#chains in the Genus database with same CATH topology
 2HPJ A;  5HEO A;  2WU2 A;  4AXP A;  4CXW A;  5FVK A;  4AQG A;  2ZM8 A;  3WI3 A;  3AXJ B;  1T8B A;  1J5E T;  1M7K A;  1KEY A;  3I9W A;  2V26 A;  4QWN B;  3KBT A;  4CZZ B;  2C5J A;  2NR4 A;  4WYV A;  4I55 E;  3RH3 A;  4A98 A;  4ZI3 C;  3KVA A;  2VB6 A;  3QC9 A;  4LFC T;  4EED A;  5JRC A;  1KF6 A;  4LMK A;  3S4U A;  3ONJ A;  2CHN A;  2XAQ B;  2E9X B;  3EDV A;  4LF7 T;  3AEE A;  4O4I E;  1N34 T;  3CX7 B;  4Q25 A;  4YJ3 E;  3T1Y T;  4YSZ A;  4LF8 T;  5JQG E;  3PE0 A;  3UU4 A;  3Q9D A;  2A3D A;  4KBM B;  3LG7 A;  1OED E;  5HWX A;  2DNX A;  3CK6 A;  3PUZ G;  3TLV A;  2XAG B;  3RQW A;  4YHH T;  4YMT B;  2XZE A;  1G8X A;  5HYA A;  4PW8 A;  3ZCI A;  3LJC A;  2W00 A;  4QX8 B;  4CN4 A;  3L39 A;  3ZEF B;  2E2A A;  3C4W A;  3KVB A;  2RA1 A;  2NTY A;  4DBR A;  4QXB B;  4OX9 T;  3C51 A;  3RPU A;  2CWO A;  3EUH A;  2MAW A;  4MHC A;  5HEJ A;  2WZH A;  4DR5 T;  1R8I A;  4XZC A;  3NKZ A;  3HL6 A;  5JDQ A;  4M1P A;  3ZLI A;  3WAK A;  1XNR T;  1VRB A;  5FVL A;  4PFO A;  4H9Q C;  3N9Q A;  3PUW F;  3QUJ A;  3SFE A;  4I4T E;  2IDO B;  4YT0 A;  3CQC B;  4JI7 T;  2VK9 A;  3ZN0 B;  3N9N A;  2XQ7 A;  4DID B;  3C4Z A;  1HX1 B;  3QB5 A;  3TUZ A;  3ZYM A;  3C98 B;  1I6Z A;  1T72 A;  2IUB A;  2K48 A;  1MMG A;  2HHH T;  5LGU B;  3J9X 1;  1N36 T;  2IC6 A;  3JC6 D;  5FKY A;  3FZL B;  3UQ4 A;  4H9S E;  1YW0 A;  2X9Y A;  2DI4 A;  3RYF E;  1MIV A;  1WRD A;  3SWH A;  1BR2 A;  4KX6 A;  3HKE E;  3PUQ A;  3W15 B;  5JVD E;  5AFU L;  4HEA A;  4ZZB A;  4YY3 T;  3UFE A;  4C90 A;  1HNZ T;  5HXS A;  3RC8 A;  5FY0 A;  3BQL A;  4O2A E;  2QA7 A;  5L3B B;  5J2U E;  4CQI A;  4TV9 E;  3VRA A;  3UUM A;  3PV0 G;  5FMN A;  3UUB A;  5JRE A;  2BS4 A;  1WCR A;  5FY1 A;  4AQF A;  2QGS A;  4OK0 A;  1ZP0 A;  3JAE A;  4UXN B;  2LHR A;  4K0K T;  5L2L A;  5L3D B;  2YU1 A;  3V5U A;  3AE7 A;  3OJA A;  3P4Q A;  2IC9 A;  3BQK A;  1D1C A;  3NRY A;  5JR9 C;  3DJB A;  2Q9Q C;  1HNX T;  2KLQ A;  3E0Z A;  5DQV A;  3TLS A;  3ETU A;  2NW9 A;  4DV4 T;  1S94 A;  1IAP A;  5JDG A;  1XMO T;  2LT3 A;  3ZC1 A;  1LRZ A;  5EK3 A;  2W67 A;  4Z91 A;  4XTC M;  3RYC E;  4IDN A;  4X5T A;  2BS2 A;  3GN5 A;  4YFS A;  3RKO A;  1HX8 A;  3LFM A;  4XAX B;  3R84 B;  5FYM A;  2D0T A;  4ZI2 D;  2M67 A;  3N2K E;  1B7T A;  3D31 C;  2N2N A;  3NBX X;  4JEH B;  5AQL B;  2XAS B;  2VKJ A;  3LBX B;  3NZP A;  2EHO C;  3OTO T;  3UQ7 A;  4A56 A;  4U31 A;  1E7P A;  2LSY A;  5J0Z A;  4IGU A;  3C64 A;  3AE2 A;  4XTC N;  4AKI A;  4ZHQ E;  3TUI A;  5IHY A;  2NWB A;  4U7I A;  5DAB A;  5HEU A;  3P7I A;  2NP9 A;  4C91 A;  2BS3 A;  3H3A A;  2X0L B;  4ZI3 D;  2WAU A;  4DV6 T;  1VCS A;  3AE9 A;  5JR9 B;  3Q5X A;  1FIO A;  3P4S A;  2M6B A;  1ZEE A;  4ILC A;  4X1Y E;  1OED C;  2YDQ A;  3O1J A;  4UEM A;  3P4R A;  1AJ3 A;  3ZT5 A;  2JPF A;  2VWA A;  4KI0 G;  2LRL A;  4KHZ G;  1L0V A;  3IHR A;  4DND A;  2ES0 A;  4L9I A;  4UV9 B;  1BR1 A;  3VKG A;  2HH7 A;  2WMN A;  3DHW A;  1EZ3 A;  2H7V C;  3CVR A;  4GOU A;  2ODU A;  5E0O A;  3RHW A;  3K1S A;  1QSD A;  2W4X A;  3IF8 B;  5KMG P;  2WY2 A;  1XMQ T;  5AQQ B;  2C0S A;  3NRX A;  5HCJ A;  4TNV A;  4GIW A;  5LMN T;  4CN6 A;  3V5S A;  3KV5 A;  4PJJ A;  1IJ6 A;  4HFE A;  3AA0 B;  3NVO A;  3N2G E;  3AA7 B;  4KP3 C;  4JV5 T;  5JDL A;  2R6G F;  1D1B A;  3CX8 B;  1YKH B;  5LYJ E;  3A8Y C;  4HWH A;  4P09 A;  3IEE A;  5HXH A;  4PK4 A;  3JAF A;  3RYI E;  2FJA A;  1IJ5 A;  4B6X A;  2B76 A;  4QH5 A;  2LSJ A;  2XM2 A;  5AQS B;  3AE8 A;  2WQY A;  3UU6 A;  2NTX A;  4CI3 B;  3AA6 B;  3ZCJ A;  5CA1 E;  4CXX A;  3LK4 2;  5ABF B;  4DO0 A;  4OHF A;  1OED B;  5JDM A;  5DJQ C;  4MFR A;  1N33 T;  5FXV A;  1LVK A;  2ZM6 T;  1JNZ A;  1IZN B;  4QXH B;  3ZYK A;  3TKL B;  3FBL A;  2KND A;  4U2Y A;  3EI0 A;  3MXZ A;  2YDS A;  3AEB A;  4Z8X A;  5HEH A;  4L5G A;  3AE6 A;  2RP4 A;  2ZLY A;  3HKD E;  1HTJ F;  5ABE A;  5LG3 A;  4JUY A;  1UUR A;  3OPC A;  4EV6 A;  2XQ4 A;  2K9A A;  2V6Y A;  2V5D A;  3KV9 A;  4HTE A;  5L47 A;  2WZI A;  2LKG A;  3UUN A;  4YLH A;  5IYZ E;  4UF0 B;  1QLB A;  3EVY A;  2LOP A;  1UX5 A;  4HFH A;  3MZK B;  4U33 A;  5LBM A;  2UXX B;  5CGM A;  1NEK A;  2VKD A;  2JJ9 A;  1VCT A;  2BG9 B;  3DP7 A;  2OV9 A;  5EK4 A;  4E7S A;  2V1D B;  3LSV A;  4E7Z A;  4IE0 A;  3RKG A;  2E8I A;  1T7S A;  5DQW A;  5JDF A;  2AXD S;  2W63 A;  4GYR A;  3PUG A;  5LGT B;  1NWM X;  4PJM A;  4X20 E;  2X68 A;  4AIS A;  2K5B B;  2Q9Q D;  3RIU C;  4G63 A;  3KBU A;  3SS1 A;  2YDR A;  3KV6 A;  4F8H A;  4XIG M;  3RX6 A;  3VR8 A;  4U2Z A;  4JI5 T;  4HWI B;  4IDO A;  2MYS A;  1KNZ A;  4DV0 T;  2WWU A;  5L3G B;  3A7M A;  3GA8 A;  3JCF A;  4I43 B;  3AAA B;  3RLF F;  4LF9 T;  1FEW A;  4CN1 A;  3TLW A;  3PTR B;  3ZT6 A;  2VVS A;  2EHO D;  3N9M A;  2PJQ A;  2CMR A;  1OXZ A;  4XIG N;  3PU3 A;  3FZH B;  4X62 T;  4LMJ A;  4IE5 A;  2IW5 B;  3RGL A;  4Z90 A;  3PU8 A;  5FL0 A;  1FMV A;  2BBJ A;  1ZHC A;  1UCU A;  1O3X A;  2DWG A;  4PFP A;  1D0Y A;  4P0B A;  3LK3 B;  4X65 T;  3ZMS B;  4B3M T;  5ADX L;  3UU8 A;  4LF5 T;  1SA0 E;  2CXF A;  4HWD A;  2Q9Q A;  4JBW G;  2VUR A;  2VKH A;  1XDO A;  4WZX A;  3PUY F;  4EXT A;  3UUL A;  2OA5 A;  5AQR B;  3H37 A;  4YTM A;  4IT4 A;  1Y01 A;  4HGA A;  5CA0 E;  5LHI B;  2N9D A;  3VR9 A;  3AVR A;  2BG9 E;  4OYK A;  3CKD A;  4CI2 B;  2W0G A;  4IL4 A;  1E1H B;  4BJM A;  1NEN A;  5HAX A;  2WS3 A;  2A72 A;  3UFG A;  2CA5 A;  4ZI7 E;  2XUE A;  3GMI A;  1N32 T;  3F2E A;  2K3W A;  5LGN B;  3BK9 A;  2BKO A;  5LJN A;  2LM2 A;  3AE5 A;  4IDZ A;  1LVF A;  2KZ7 B;  2EHO A;  1KK7 A;  3FHN A;  3TLU A;  5AQO B;  5GON E;  4TV8 E;  2J47 A;  3KIN B;  5AQF B;  4UIG A;  3KV4 A;  4DV3 T;  4L0R A;  3U3I A;  4YTP A;  3ZMV B;  3ZSS A;  3L8R A;  3O4X E;  3PUX G;  2UUA T;  4X1I E;  2CE7 A;  1WFD A;  4BJN A;  4GKK T;  3ZYL A;  5KX5 E;  4AKG A;  4DR2 T;  2CEA A;  3AVS A;  5L4E A;  5BR8 T;  2XQY A;  5M4Y A;  4JI8 T;  3UUX B;  2W61 A;  2XQ8 A;  2FJB A;  4O4H E;  2ODV A;  4H63 H;  5F8P A;  3QB5 K;  5C3J A;  4I50 E;  1Z8U A;  4YMS C;  1W9R A;  4JI4 T;  2LSG A;  3CWZ B;  3PUV G;  3SRZ A;  3EHZ A;  1SE7 A;  3L09 A;  2E9X D;  4JI2 T;  5LHH B;  2UUC T;  4B3R T;  3Q2M A;  4ILU A;  3ZMU B;  3OYZ A;  4X66 T;  2L9Q A;  1XNQ T;  2ONK C;  2X67 A;  2XPK A;  3E22 E;  2Y48 B;  1NAF A;  3AB3 B;  1BR4 A;  2BVM A;  5HEG A;  3SOL A;  4U7Y A;  4NUU A;  1HS7 A;  2XQ9 A;  3J7Y q;  4JI6 T;  5AQG B;  5JRC B;  3A5X A;  2ACZ A;  4QH1 A;  2D2S A;  4NXM T;  1S35 A;  3FZM B;  5L4H A;  1U5P A;  3ZJ1 A;  2CHO A;  3N9L A;  3ANW A;  4YJ2 E;  1KFY A;  4OYJ A;  2K24 A;  3R6N A;  4HFD A;  4DV1 T;  3B13 A;  4K0U A;  1HR0 T;  2C5I T;  4H9R C;  3AA1 B;  3ESL A;  3AAI A;  3AXJ A;  2W66 A;  5EZY E;  2BKP A;  2KSR A;  4PK6 A;  4QKN A;  1HNW T;  3MJX A;  3EAB A;  3PUZ F;  3AE1 A;  4TN7 B;  4PJL A;  1HF8 A;  2PTF A;  3M65 A;  1SHZ C;  3FZF B;  3RQU A;  2VL8 A;  2E5V A;  4ZXL A;  3Q5W A;  2E9X A;  3HI2 A;  3I0O A;  4TX5 A;  4A97 A;  4N78 D;  5LBQ B;  3P8C D;  3PUS A;  2N1G A;  2VQE T;  3ZKR A;  2DCF A;  2CBJ A;  2NOX A;  3KDS E;  3QNU A;  3SFD A;  2V7I A;  2BDE A;  4ILB A;  4TWD A;  4WW0 A;  2X9H A;  2H3R A;  4AQF C;  2LE8 A;  3WAJ A;  5L3E B;  3AEC A;  4WBO A;  2KMF A;  3ZST A;  4JBW F;  4X1K E;  3ZN1 B;  3AED A;  4YMW C;  5HXR A;  2QYW A;  2XQ6 A;  4F6R C;  3ZC0 A;  2JQQ A;  1H7C A;  5FL1 A;  2XQ5 A;  4O4J E;  3MKD A;  4HFC A;  2JMH A;  2V5C A;  2CRB A;  2VVN A;  2Y8D A;  2UUB T;  2FBW A;  5LXT E;  4ZS2 A;  5J1G A;  5AQH B;  3HKB E;  1T98 A;  1MIW A;  5CJ5 A;  2Y6X A;  1W0B A;  1ZOY A;  2I0M A;  5IUX A;  3OVU A;  4H63 V;  2BG9 C;  2DHR A;  3ETV A;  3RIU A;  4DMW A;  5FXX A;  3MA9 A;  4ISS A;  4B3T T;  1XDP A;  3RRC A;  1I94 T;  4HWC A;  2PBI A;  2YOE A;  2QVA A;  2RPA A;  2H88 A;  4QH4 A;  2CLY B;  4EOZ B;  2J1D G;  4YMU C;  3ZMZ B;  4GK5 E;  2VKO A;  2X9W A;  4U74 A;  3MAC A;  4B3S T;  5BMV E;  5LJM A;  2J4G A;  3DTO A;  2YKS A;  3ZPO A;  2J62 A;  4J2C A;  3PV0 F;  1MMD A;  1VOM A;  2WMO A;  5FP3 A;  4DUY T;  1QUU A;  3AEA A;  4UVA B;  3JAD A;  3TUJ A;  3C4X A;  2XSB A;  4QXC B;  2WM9 A;  5LHG B;  3L3P A;  4U72 A;  3I1A A;  2YK0 A;  4HN9 A;  3GWH A;  4DUZ T;  4IIJ E;  2V7M A;  1KNR A;  4UVB B;  3O9X A;  3ABV A;  4H9N C;  2WDQ A;  2YN6 A;  4A5X A;  3PUV F;  3RIF A;  2FUP A;  3TLT A;  2XQ3 A;  3K3Q C;  2LSK A;  3ZMT B;  3ONL C;  4GKJ T;  3GN5 B;  1IBM T;  3RC3 A;  2HN1 A;  2DL1 A;  3P50 A;  4ZS3 A;  3VRB A;  4UVC B;  2CWY A;  1D0Z A;  2YU2 A;  5JDH A;  2B1E A;  2XM1 A;  5AQM B;  3ZJ2 A;  2X66 A;  3FBZ A;  4EYY R;  1BR0 A;  3HKC E;  5CFB A;  4MAL A;  4DR6 T;  4YMV C;  4O4L E;  1WYB A;  2ZM2 A;  1WLX A;  2XAJ B;  1YQ3 A;  3RRW A;  3RF1 A;  2XAH B;  3MK7 C;  2X0H A;  4H9O C;  1UGO A;  4IE4 A;  5HXC A;  3FB2 A;  3T8O A;  3B5M A;  4P0A A;  4EEB A;  1OWA A;  4EAH A;  2F4V T;  2UXD T;  2VQF T;  4IE7 A;  3RYH E;  4JI3 T;  2H7O A;  4IL9 A;  2V7L A;  2XSA A;  1MNE A;  4FI5 A;  5AQP B;  1JNR A;  2JQ9 A;  2I6H A;  2WBL A;  3LK2 B;  3PJA A;  2XAF B;  2MBG A;  1YKE B;  3LBX A;  3PUA A;  3B57 A;  5JTG A;  4KUM B;  1J1J A;  3EDU A;  3NZQ A;  1E2A A;  1MIY A;  4BA9 A;  4DR7 T;  3M3Z B;  4O8S A;  5L3F B;  3U78 A;  4KI0 F;  4YSY A;  4KHZ F;  3AE3 A;  5F3J A;  3P4P A;  5C8Y E;  2ZMA A;  4NXN T;  2MOZ A;  1W0A A;  2P9B A;  1US7 B;  1CUN A;  2XHE B;  4UV8 B;  2D5U A;  2FJD A;  4IDQ A;  2WB5 A;  2WP9 A;  5JR9 A;  1W09 A;  4EIW A;  1HCI A;  5ABH A;  5HCM A;  1KNP A;  2JQK A;  4H9P C;  3NWI A;  4G2A A;  5AQV B;  5LG4 A;  4EGW A;  3CQX C;  3O1I A;  4DBQ A;  4TQU M;  1V9D A;  2KXP B;  1YXR A;  5KXJ A;  4AQY T;  1G73 A;  4O2B E;  2V6X A;  1FMW A;  4DV5 T;  4NIQ A;  4HFB A;  1SUM B;  5C2T A;  2I59 A;  3C50 A;  1GQE A;  3E08 A;  2JQH A;  4I0U A;  3CIR A;  2VL0 A;  1IBK T;  1Y64 B;  2R6G G;  1X79 A;  2KWI B;  4HFI A;  3ONX A;  3KFW X;  4IDP A;  4PJN A;  4EZH A;  3UU3 A;  3Q5E A;  1UUS A;  3HA4 A;  4AKH A;  4TQU N;  3N9P A;  4EZ4 A;  5FXZ A;  3AAE B;  2E5L T;  4PAG A;  2LKH A;  3T1H T;  4FJO A;  2A2F X;  5LB7 B;  5AQT B;  2V6Y B;  3K3O A;  4QHO A;  5CB4 E;  4YTN A;  5ABF A;  3AEG A;  1OED A;  2WDR A;  2XTL A;  4NUV A;  3QK6 A;  4EB6 E;  4IHJ E;  2XY8 B;  3Q5D A;  5JDN A;  1DU2 A;  3P4W A;  4DR4 T;  4WNK A;  1LKX A;  2LOS A;  4GK0 E;  3X1D A;  3ZT7 A;  1WR6 A;  3VU7 H;  4OFZ A;  4AIU A;  1CHU A;  1WR0 A;  2LHN A;  5LP6 E;  2DLR A;  2UXC T;  2X0Y A;  4LML A;  4TZ4 C;  3OBV E;  4ZOL E;  4HKA A;  3CML A;  2C5K T;  5FXW A;  5AQN B;  4ILA A;  4DMV A;  5FY7 A;  2MPK A;  2X51 A;  3HR0 A;  4LFA T;  4V1A v;  4JYA T;  3IA3 A;  1UK5 A;  5AQK B;  3RI5 A;  1MND A;  3PDY A;  4UF0 A;  2DWK A;  3F57 A;  4CXY A;  5FNV E;  4COF A;  5TAO A;  3H3M A;  3PUR A;  4UR9 A;  2CPT A;  2LLY A;  1UX4 A;  3OYX A;  5LMU T;  2CXD A;  4ZEY A;  2OLT A;  2YIN A;  2BG9 A;  3K3N A;  1HFA A;  5AQI B;  1MMA A;  2A9U A;  2CBI A;  5JH7 E;  2AE9 A;  2GK9 A;  3FXE B;  4ERR A;  1YD8 G;  4QX7 B;  3EAM A;  2WDV A;  2D9D A;  4DV2 T;  5IWA T;  4YHJ A;  1X9B A;  2Z6E A;  3IBP A;  5F5W A;  4U3C A;  2JIW A;  4DV7 T;  2IIU A;  1WYC A;  3CPZ A;  5H6R B;  2JRK A;  4JI1 T;  3PJA J;  2CLY C;  3D0T A;  3O1H A;  1XZY A;  4TWH A;  4MBQ A;  3VHL A;  3RLF G;  4ASK A;  1XWM A;  1D0X A;  3OKQ A;  4X64 T;  5ABG A;  2UXB T;  2Q9Q B;  2WSS V;  4PNI A;  4ANJ A;  5LA6 E;  4MLK A;  2CM0 A;  1HG2 A;  2NW7 A;  5H6Q B;  4LF4 T;  4GYS A;  2BBH A;  4KMC A;  2LRK A;  4LF6 T;  2XJ7 A;  4IRE A;  3RIA A;  2HN2 A;  3UT5 E;  3FXD B;  2CCQ A;  2QRX A;  2MTQ A;  2W62 A;  4YSX A;  5J2T E;  3JC6 C;  4TUY E;  4AKL A;  2LM9 A;  3K8P C;  4JI0 T;  2W2U A;  3PUY G;  4BAY B;  3FZK B;  2EHO B;  3PUW G;  3UU5 A;  5L3C B;  4JLE A;  4ZZC A;  4LFB T;  3UTK A;  4XBF B;  4HE8 A;  2KT9 A;  3AE4 A;  2CXL A;  1FJG T;  2X9X A;  2V7J A;  3AEF A;  2BZB A;  2V7K A;  5LOV E;  4DR3 T;  1YQ4 A;  4AKR B;  2WU5 A;  5ETW A;  1D1A A;  5LCY A;  5LNK A;  4TWF A;  2LSI A;  1ZV4 X;  3PUX F;  1Z0P A;  2IHR 1;  4P1N A;  5AQJ B;  4EYU A;  2M6I A;  4NPP A;  3G06 A;  3CX6 B;  1M62 A;  2KWH A;  2PG8 A;  2FJE A;  1IBL T;  2LJL A;  4TNW A;  4JEU B;  4KHP T;  3N5L A;  4YXD A;  2D0U A;  2LEH A;  3I0Q A;  2H89 A;  3I9Y A;  4IST A;  4WBN E;  2XQA A;  4PK5 A;  3QOF A;  4ADZ A;  4UEL A;  2L3L A;  4HWF A;  2L8K A;  2G0U A;  2ZM0 A;  2BVL A;  2E9X C;  2UXN B;  1U4Q A;  5KDM C;  2HPL A;  2YEV C;  2IAK A;  3N9O A;  5EK2 A;  2WCA A;  1ZKE A;  2VAS A;  3VKH A;  1J5W A;  2V8S V;  2WWV A;  3BQI A;  2BKN A;  4DR1 T;  2SPC A;  2UU9 T;  4DVD A;  3LDQ B;  4HFV A;  2JMK A;  2NW8 A;  4ZI2 C;  3N2O A;  3CQG B;  5AQU B;  5HWY A;  4AI6 A;  1HG5 A;  2ACX A;  2IML A;  1MMN A;  4CI1 B;  5A1L A;  2PFV A;  3ANW B;  2KIN B;  3F31 A;  5HXE A;  4IE6 A; 
#chains in the Genus database with same CATH homology
 4YMV C;  4KHZ F;  3TUI A;  3PUX G;  3PUW G;  3RLF F;  3PUZ G;  2R6G G;  4JBW G;  3PV0 F;  3PUV G;  4YMT B;  3PUY F;  4YMU C;  3PUW F;  3PUX F;  4JBW F;  3PUZ F;  2R6G F;  3PUV F;  3TUJ A;  4KI0 G;  3TUZ A;  4YMS C;  4KHZ G;  4XIG M;  4XIG N;  3RLF G;  4YMW C;  4TQU M;  4TQU N;  2ONK C;  3PV0 G;  3D31 C;  4XTC M;  4XTC N;  3DHW A;  4KI0 F;  3PUY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...