3PUVF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
494
structure length
490
Chain Sequence
b'WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 143
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puvF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puvF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puvF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puvF02
4TQUM 3PUZG 4JBWG 4TQUN 3TUZA 3PV0G 4XIGN 4XIGM 3TUJA 3PUYF 4KI0F 3PUXG 4KHZG 4YMUC 3RLFF 3D31C 2R6GF 3DHWA 4YMWC 2ONKC 4YMSC 3PUWF 4KI0G 3PUVF 3PUYG 3PUZF 4JBWF 4YMTB 3RLFG 3PV0F 2R6GG 3PUXF 4KHZF 4YMVC 3TUIA 4XTCN 4XTCM 3PUWG 3PUVG
chains in the Genus database with same CATH superfamily
4DVDA 4FJOA 3EI0A 4F8HA 5LJMA 5LG4A 1YW0A 2N2NA 4B3MT 2K5BB 4DR1T 4HWFA 3Q9DA 1T98A 4DIDB 2YDSA 3PUGA 2EHOA 2ES0A 2XZEA 3M3ZB 3IBPA 3ZMSB 4HFVA 3N9PA 1W09A 3KDSE 3N2GE 4QWNB 1IAPA 5LBQB 3AA7B 2M6IA 2UXDT 4PFPA 2UXCT 4YMTB 2ODUA 5HEJA 5L3GB 2N1GA 4IT4A 4YJ3E 4JBWG 1V9DA 3RIAA 1QUUA 1UX5A 2WM9A 3HKCE 2IC6A 5JTGA 1FIOA 3CIRA 4DR3T 3EDVA 3CKDA 3BK9A 3RIFA 4CN4A 3MKDA 1HNWT 5HXEA 2BBHA 4XTCN 4P09A 1ZKEA 3NKZA 2KLQA 3UU4A 1WR6A 4PAGA 3C64A 4ZS3A 4XZCA 2KMFA 2IIUA 3J9X1 1D0YA 3VKGA 2FJBA 2Y48B 5IHYA 3E08A 4HE8A 4EIWA 4LF7T 3LK3B 3EDUA 4AQGA 4B3ST 3I9YA 2QA7A 3BQIA 4TN7B 5J1GA 2CHOA 4EB6E 1T7SA 2ZM6T 1ZOYA 1ZV4X 4U7YA 4LF6T 3CWZB 5HXCA 1WLXA 2BG9E 3RRCA 2M67A 3PUVG 2W63A 4P0AA 2V7KA 3ZCJA 2JRKA 4PJJA 4PNIA 3FXEB 2XQ5A 4OHFA 5AQVB 2NP9A 3UULA 5LP6E 2X0YA 4L5GA 2PFVA 5LCYA 4OFZA 5DQWA 4OYKA 4L9IA 2QYWA 3N5LA 1R8IA 4TWHA 5LYJE 3ZKRA 4YJ2E 2YU2A 4UIGA 5FNVE 4DV2T 5HEOA 3SRZA 4LMJA 3RIUA 3LG7A 3GA8A 2W67A 1T8BA 3MK7C 2ZM0A 5LNKA 2JPFA 5ABGA 4X5TA 5AQRB 3WAKA 3B5MA 2BDEA 4H9RC 5J0ZA 2WZIA 4QH4A 4TQUM 4HN9A 2E5VA 2YU1A 1N32T 2YDRA 1D1BA 2ODVA 2F4VT 4U2YA 3RQWA 1KF6A 1FMWA 4JEUB 3PUWF 4WBOA 4MBQA 2A3DA 2FJDA 4YMVC 3R6NA 2WCAA 3PUAA 4P0BA 2CCQA 1MNDA 2D5UA 2KT9A 3K3QC 4B3RT 4CN1A 2KWHA 4COFA 1QSDA 5AQNB 3AECA 4YLHA 5ABEA 2A72A 5EZYE 1SUMB 1MIWA 3RKOA 2H7OA 2XM2A 2Y8DA 2K48A 2NOXA 4UF0B 4YY3T 4HFIA 2L3LA 3DJBA 4H9QC 1IZNB 3JC6C 4TV9E 4ZI3C 2CPTA 1LVFA 1HCIA 3ZT5A 3O1JA 2VVNA 3IF8B 2C0SA 5TAOA 2R6GF 5JDFA 4NPPA 2X9HA 2NTXA 3MZKB 2VKOA 3VU7H 4UF0A 5AFUL 4YT0A 5FY0A 1KNPA 5HAXA 4JI5T 2IDOB 5L2LA 4O2AE 4GKKT 1HNZT 1I6ZA 3H3MA 2XM1A 4ILAA 2UXNB 5HEUA 2LOSA 2XQ4A 3B57A 3N2KE 2VKDA 3LFMA 4B6XA 3BQLA 4UXNB 4KUMB 3F31A 3AEEA 4QHOA 4DR5T 4DO0A 4U72A 1G8XA 4QH5A 2JQQA 5FXXA 2DHRA 5EK2A 2CXDA 3P8CD 3GWHA 3SFEA 4CXWA 1MMAA 5F5WA 5FL0A 3TLVA 4OX9T 3RPUA 1Z8UA 2NR4A 4KHZF 5LMUT 4X20E 3UU5A 5JREA 3LDQB 3NZQA 2Y6XA 1NEKA 2P9BA 4LFAT 1E7PA 2UUBT 2JQ9A 3T1HT 4JLEA 4YTMA 2X9YA 4YMSC 3ZMTB 1WYBA 2LJLA 5AQSB 3PUVF 1XMQT 1HNXT 3RI5A 2XAGB 3TLSA 1BR4A 2XSBA 2LRKA 1IBKT 3ZSTA 5H6QB 3OVUA 2W0GA 4EV6A 5DQVA 3ZPOA 2V7LA 2W4XA 4ADZA 3NRXA 3ZT7A 2V7JA 3O4XE 4UVCB 1LVKA 1G73A 2XQYA 1Y64B 4IGUA 2WMOA 1VCSA 4XIGN 3AE4A 4EYYR 1Y01A 2LT3A 1JNRA 2NW9A 4JI7T 1HG5A 4DV7T 2VQET 2I6HA 4J2CA 2ZM2A 1FJGT 2FJEA 5LHHB 3B13A 4A97A 2CHNA 3WI3A 4O4IE 3VKHA 3TUJA 3L09A 1YKHB 3CX6B 3FZKB 4ERRA 3DHWA 3ESLA 2FJAA 4QXCB 3ZC0A 3EAMA 2LEHA 2A2FX 4I4TE 1IBLT 4IIJE 3ZLIA 4AQFC 2CLYC 4HGAA 3AE1A 4OYJA 3ZJ1A 4PJLA 1WCRA 4EXTA 5KMGP 1KFYA 3AXJB 2V6XA 2QRXA 2OA5A 3AA0B 4TNWA 3HKDE 3RHWA 2V26A 2MYSA 3SS1A 5AQLB 3L8RA 3T1YT 4QX8B 2ZMAA 3AAIA 1I94T 4ASKA 3QC9A 1KEYA 2PTFA 4ILUA 2CXLA 1BR2A 5CGMA 4WYVA 4BJMA 4LF5T 3AE2A 2VURA 3J7Yq 1FMVA 5JDNA 2OLTA 3RH3A 5KX5E 3AXJA 1MIYA 4I0UA 1YQ3A 2HN1A 4TNVA 3UQ7A 3P4RA 4IL9A 2DWKA 4BAYB 2WB5A 2LOPA 3KFWX 2SPCA 5BR8T 4AQYT 2QVAA 3PUZF 4JUYA 2W00A 4JI1T 4K0KT 5LOVE 4PJMA 4UV9B 4JI3T 3TUIA 3AEDA 2XAQB 3GMIA 3PTRB 3JC6D 3P7IA 4ZI3D 2XUEA 2LKGA 5LJNA 2Q9QB 4LMLA 4MFRA 3PUSA 1US7B 2LSGA 4ZZBA 2M6BA 4HWIB 5H6RB 4WBNE 2H88A 4IDZA 2X9WA 1IJ5A 2V5CA 1HR0T 5HXSA 4MLKA 4HFEA 5LBMA 1MMDA 4DUYT 2WU2A 4ZEYA 5AQGB 5L3CB 2R6GG 3UUBA 4Z91A 3X1DA 4OK0A 4XAXB 1HTJF 4G2AA 2L8KA 4E7ZA 3IA3A 2Q9QA 3VHLA 4JI8T 3SWHA 3KVBA 5AQIB 3ZMZB 2HPJA 3AAAB 4K0UA 4HEAA 2XAJB 3PE0A 3QB5A 3CK6A 4X1KE 3Q2MA 2E2AA 4JEHB 2HN2A 2LHRA 1S35A 2VQFT 3KBTA 3D31C 1WR0A 3KBUA 2E9XD 3MJXA 1JNZA 2WDRA 4HFHA 1H7CA 2LSYA 5C3JA 2MTQA 3KVAA 2IW5B 5IWAT 3JAEA 4KHZG 5M4YA 1HS7A 2X0HA 4YSZA 3AAEB 2BG9C 4V1Av 3EHZA 4PK5A 4ZI2D 2H89A 5IYZE 3E22E 2WAUA 1OEDB 4AISA 2WZHA 3EUHA 5FYMA 1BR0A 4U7IA 4JI6T 4UVAB 5JR9B 5BMVE 2LLYA 3UFEA 3C51A 2LSJA 3RF1A 5HXHA 2BVMA 5HYAA 5FMNA 3UUNA 4HWHA 1OXZA 3ZMUB 4U33A 5KDMC 2X67A 4HFBA 3ONLC 3TLUA 1OEDA 3OPCA 4X1YE 2C5IT 4F6RC 4UR9A 2MPKA 4MALA 3C98B 3RX6A 3RIUC 2XQ8A 2LSIA 3ZT6A 4NUUA 1AJ3A 5LG3A 5JR9A 1UX4A 3UUMA 1CHUA 2LSKA 3MACA 3FBLA 1KNRA 3OKQA 4DR7T 1YXRA 2WBLA 4H9NC 1MIVA 4QKNA 5FVKA 4GK0E 3UQ4A 4DV4T 5FY1A 3CQCB 2VK9A 2XTLA 4HTEA 1S94A 4EZ4A 2JJ9A 5AQKB 3VR9A 5AQMB 4CQIA 3TUZA 3S4UA 3AVSA 4YHHT 3ZYKA 4A98A 2UU9T 5L3BB 1D0XA 4IE5A 4PFOA 2X66A 4U2ZA 4DR6T 3DTOA 1FEWA 3PDYA 3A7MA 2YEVC 3SFDA 3LK42 2PG8A 4QH1A 4KI0G 4IHJE 2ACZA 3UTKA 1Z0PA 1W9RA 2WY2A 1YQ4A 2X51A 2J1DG 3RC8A 1ZEEA 4UELA 5E0OA 5CB4E 4KP3C 1MMGA 3PUZG 3U78A 2KNDA 2W66A 4EEDA 1XNRT 4DMWA 4YSXA 4DV5T 5LB7B 2N9DA 3I9WA 2CA5A 2B76A 3AA1B 3IHRA 4IE0A 1LKXA 4M1PA 2EHOD 4PJNA 5JDHA 2GK9A 2X68A 3RRWA 4ZHQE 3PJAJ 5KXJA 3ZYMA 5CA0E 2IMLA 3MA9A 2NW8A 3ZJ2A 1HX1B 4WZXA 4JV5T 3N9OA 5HEHA 2C5JA 4A56A 2V5DA 4IDNA 1CUNA 2D2SA 4ISTA 4UVBB 4TWDA 3LJCA 2E9XC 1LRZA 5AQTB 5HXRA 5AQOB 1WFDA 1E2AA 4UEMA 4YFSA 5EK4A 4AKIA 3PUQA 4U31A 2V6YB 2WS3A 4KX6A 4ILBA 4DBRA 3K8PC 2OV9A 4PK4A 1E1HB 3ZCIA 2DLRA 4HFDA 1D0ZA 4GKJT 1VOMA 2XAFB 2D0TA 1OWAA 3RLFG 3VRBA 4ZI2C 4CI2B 5JDLA 4L0RA 3PV0G 3O9XA 2CBJA 1U4QA 4YHJA 4TZ4C 2V6YA 5CFBA 1EZ3A 4HKAA 5DABA 4HWDA 1XWMA 2LHNA 3TKLB 3D0TA 3NVOA 3ONJA 2XY8B 1IBMT 3Q5EA 5AQUB 1XMOT 4JI2T 4X1IE 5C8YE 2NWBA 3NWIA 2JQHA 2CLYB 2FUPA 3ZSSA 3CQXC 1D1AA 3AA6B 5AQPB 1XNQT 3AE5A 3QOFA 5CJ5A 4ANJA 2D9DA 3LBXB 4NIQA 3TLTA 3VR8A 3N2OA 1BR1A 5JVDE 4EGWA 2AE9A 2K24A 3WAJA 4O2BE 2BBJA 4PW8A 3P4WA 2ZM8A 3NRYA 5HWYA 2CMRA 3MXZA 3N9NA 3FB2A 2RA1A 3PURA 1UURA 4AQFA 4X66T 3AEGA 2YINA 3N9QA 4EYUA 1W0AA 4LFCT 3ONXA 5AQFB 4WNKA 3FZFB 3LBXA 1MNEA 4YMWC 2HPLA 3HI2A 2J62A 3UT5E 4CN6A 4QXHB 3JCFA 2YKSA 2KSRA 4EAHA 2DL1A 2W2UA 1KK7A 3AEFA 4KI0F 1M7KA 4BA9A 3N9LA 3P4QA 2IHR1 1XDPA 5ABFB 5FXVA 2V7IA 2I59A 5ABHA 2VKHA 3T8OA 2WWVA 3RC3A 1W0BA 3ETVA 2PJQA 3K3OA 5J2UE 2WU5A 2BZBA 4DV0T 3QK6A 3UFGA 2BVLA 4MHCA 2IAKA 4I50E 4TX5A 1NAFA 2VVSA 2L9QA 2EHOC 1UK5A 5LHIB 2HH7A 3QB5K 4Z8XA 2WWUA 5ABFA 2VL8A 3GN5B 4P1NA 2NW7A 2XQ7A 2LM2A 1N34T 5J2TE 2VB6A 4AKHA 3L39A 4KHPT 4ISSA 4B3TT 2LE8A 4I55E 2RPAA 2DCFA 2Q9QC 4NXMT 2YOEA 5F3JA 1HF8A 5FY7A 3I1AA 2DWGA 5IUXA 3ZN1B 2BS4A 2BKNA 3AB3B 2V7MA 3NBXX 3A5XA 3BQKA 3PUYF 4X64T 4I43B 3GN5A 3RLFF 3PU8A 3RGLA 3LK2B 2YK0A 5LGNB 2BKOA 2QGSA 3O1IA 2BG9B 1M62A 5AQHB 3PV0F 4AIUA 1WYCA 4DBQA 2I0MA 4XTCM 4ZOLE 2XQAA 1X79A 2DI4A 4EEBA 5DJQC 4LF9T 3KV5A 4YMUC 5FP3A 4GYSA 5L47A 2IC9A 4IREA 1HFAA 3RYCE 3UUXB 3RYFE 1J5WA 3ABVA 3KINB 4LF4T 3C4WA 3HL6A 3OYZA 2CRBA 2H7VC 4O4LE 1QLBA 4DNDA 4DV6T 2BG9A 5LMNT 3AVRA 4LF8T 4DV3T 5LXTE 2XPKA 4BJNA 4X62T 3CQGB 2UXXB 4TUYE 4JI4T 3FHNA 2X0LB 4Q25A 3IEEA 2WP9A 1XZYA 5ETWA 1NWMX 1YD8G 4O4HE 4C91A 3N9MA 2VL0A 4YTPA 2WDVA 3LSVA 3OTOT 4O4JE 1OEDC 2CM0A 4IE4A 1OEDE 5CA1E 1VCTA 1X9BA 3G06A 5HWXA 4H9OC 5JR9C 5L4EA 2XHEB 3HKEE 3PUXF 4FI5A 3JADA 2UXBT 4DV1T 2KWIB 3CMLA 3V5UA 2LRLA 3FZHB 4TV8E 5FKYA 4TQUN 2XQ3A 4TWFA 4GK5E 2WDQA 4U3CA 4X65T 3OJAA 4HFCA 2MOZA 3P4PA 4ZXLA 2JMKA 3W15B 5JH7E 2CWOA 3RQUA 3I0QA 5JDGA 2BS3A 4HWCA 5A1LA 3HR0A 4QXBB 5C2TA 2XJ7A 4PK6A 2V1DB 3EABA 2XAHB 5LGTB 3ZYLA 5FXZA 4IDOA 3OYXA 3ETUA 2MBGA 2CBIA 4UV8B 2XQ6A 2WQYA 1DU2A 3OBVE 3RKGA 2UUCT 4ZZCA 3ZN0B 4Z90A 4DMVA 3Q5DA 5LGUB 2JQKA 1YKEB 3EVYA 3Q5WA 2JMHA 3RYHE 1HG2A 5FL1A 4EZHA 1WRDA 2LM9A 1SHZC 3AE9A 2AXDS 5EK3A 2NTYA 2J47A 2CXFA 4NUVA 1J5ET 4H63H 1NENA 4YTNA 2BS2A 2E9XB 3H3AA 1UUSA 2FBWA 4DR2T 4JBWF 2XSAA 5JDQA 3UU3A 2KZ7B 2E5LT 4A5XA 5L3FB 2G0UA 2K9AA 4CZZB 3AEBA 4ZS2A 1U5PA 3U3IA 2ONKC 3ANWB 2Q9QD 3E0ZA 3KV4A 3VRAA 4LMKA 4CI3B 5FVLA 5L3DB 1ZHCA 4YSYA 4GOUA 3L3PA 3O1HA 3CX7B 2E9XA 4H9SE 1SE7A 2CEAA 4E7SA 2RP4A 4JI0T 1MMNA 4XBFB 4IE7A 5JQGE 2C5KT 4DR4T 3PUYG 3R84B 4QX7B 5L4HA 4AXPA 2YDQA 2BKPA 5LHGB 3FXDB 3DP7A 3K3NA 3NZPA 1SA0E 3ANWA 3ZEFB 1D1CA 1L0VA 1XDOA 4GIWA 2E8IA 5ADXL 3UU6A 4DUZT 4AKGA 5FXWA 2CE7A 3HKBE 3KV9A 2XQ9A 4ILCA 1N33T 2VASA 1T72A 2IUBA 5F8PA 3ZMVB 4U74A 3AE3A 2UUAT 2K3WA 1B7TA 3V5SA 4IDQA 2X9XA 1UCUA 2MAWA 1HX8A 4XIGM 3Q5XA 3FZMB 3RYIE 2W61A 5LA6E 5JRCB 3CX8B 4IL4A 5JDMA 1GQEA 2KXPB 5L3EB 3C4XA 5HCMA 2VWAA 3JAFA 3F57A 2J4GA 2YN6A 2VKJA 3P4SA 4NXNT 3UU8A 1J1JA 3PU3A 4G63A 5HEGA 2HHHT 2Z6EA 4CXXA 4AKRB 2H3RA 3H37A 4JYAT 4LFBT 3CPZA 4N78D 1KNZA 2WSSV 1IJ6A 3HA4A 2DNXA 3TLWA 3AE7A 3KV6A 4YXDA 3I0OA 5JRCA 2ACXA 3PUXG 3A8YC 3P50A 3SOLA 2B1EA 3K1SA 4CXYA 5HCJA 3QUJA 4CI1B 4C90A 2WMNA 1O3XA 2JIWA 3F2EA 5AQQB 3C50A 4IE6A 2ZLYA 4WW0A 1UGOA 3M65A 2V8SV 2KINB 3CVRA 2CWYA 2W62A 4AKLA 4ZI7E 4H9PC 4H63V 1N36T 2XASB 3PJAA 4AI6A 3PUWG 5GONE 4O8SA 3FBZA 4IDPA 4KBMB 4EOZB 2A9UA 2EHOB 1VRBA 5AQJB 3FZLB 2PBIA 1ZP0A 2D0UA 3AE6A 3C4ZA 2LKHA 3ZC1A 4KMCA 3AEAA 4GYRA 3AE8A 3QNUA
chains in the Genus database with same CATH topology
4TQUM 3PUZG 4JBWG 4TQUN 3TUZA 3PV0G 4XIGN 4XIGM 3TUJA 3PUYF 4KI0F 3PUXG 4KHZG 4YMUC 3RLFF 3D31C 2R6GF 3DHWA 4YMWC 2ONKC 4YMSC 3PUWF 4KI0G 3PUVF 3PUYG 3PUZF 4JBWF 4YMTB 3RLFG 3PV0F 2R6GG 3PUXF 4KHZF 4YMVC 3TUIA 4XTCN 4XTCM 3PUWG 3PUVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU M;  3PUZ G;  4JBW G;  4TQU N;  3TUZ A;  3PV0 G;  4XIG N;  4XIG M;  3TUJ A;  3PUY F;  4KI0 F;  3PUX G;  4KHZ G;  4YMU C;  3RLF F;  3D31 C;  2R6G F;  3DHW A;  4YMW C;  2ONK C;  4YMS C;  3PUW F;  4KI0 G;  3PUV F;  3PUY G;  3PUZ F;  4JBW F;  4YMT B;  3RLF G;  3PV0 F;  2R6G G;  3PUX F;  4KHZ F;  4YMV C;  3TUI A;  4XTC N;  4XTC M;  3PUW G;  3PUV G; 
#chains in the Genus database with same CATH topology
 4DVD A;  4FJO A;  3EI0 A;  4F8H A;  5LJM A;  5LG4 A;  1YW0 A;  2N2N A;  4B3M T;  2K5B B;  4DR1 T;  4HWF A;  3Q9D A;  1T98 A;  4DID B;  2YDS A;  3PUG A;  2EHO A;  2ES0 A;  2XZE A;  3M3Z B;  3IBP A;  3ZMS B;  4HFV A;  3N9P A;  1W09 A;  3KDS E;  3N2G E;  4QWN B;  1IAP A;  5LBQ B;  3AA7 B;  2M6I A;  2UXD T;  4PFP A;  2UXC T;  4YMT B;  2ODU A;  5HEJ A;  5L3G B;  2N1G A;  4IT4 A;  4YJ3 E;  4JBW G;  1V9D A;  3RIA A;  1QUU A;  1UX5 A;  2WM9 A;  3HKC E;  2IC6 A;  5JTG A;  1FIO A;  3CIR A;  4DR3 T;  3EDV A;  3CKD A;  3BK9 A;  3RIF A;  4CN4 A;  3MKD A;  1HNW T;  5HXE A;  2BBH A;  4XTC N;  4P09 A;  1ZKE A;  3NKZ A;  2KLQ A;  3UU4 A;  1WR6 A;  4PAG A;  3C64 A;  4ZS3 A;  4XZC A;  2KMF A;  2IIU A;  3J9X 1;  1D0Y A;  3VKG A;  2FJB A;  2Y48 B;  5IHY A;  3E08 A;  4HE8 A;  4EIW A;  4LF7 T;  3LK3 B;  3EDU A;  4AQG A;  4B3S T;  3I9Y A;  2QA7 A;  3BQI A;  4TN7 B;  5J1G A;  2CHO A;  4EB6 E;  1T7S A;  2ZM6 T;  1ZOY A;  1ZV4 X;  4U7Y A;  4LF6 T;  3CWZ B;  5HXC A;  1WLX A;  2BG9 E;  3RRC A;  2M67 A;  3PUV G;  2W63 A;  4P0A A;  2V7K A;  3ZCJ A;  2JRK A;  4PJJ A;  4PNI A;  3FXE B;  2XQ5 A;  4OHF A;  5AQV B;  2NP9 A;  3UUL A;  5LP6 E;  2X0Y A;  4L5G A;  2PFV A;  5LCY A;  4OFZ A;  5DQW A;  4OYK A;  4L9I A;  2QYW A;  3N5L A;  1R8I A;  4TWH A;  5LYJ E;  3ZKR A;  4YJ2 E;  2YU2 A;  4UIG A;  5FNV E;  4DV2 T;  5HEO A;  3SRZ A;  4LMJ A;  3RIU A;  3LG7 A;  3GA8 A;  2W67 A;  1T8B A;  3MK7 C;  2ZM0 A;  5LNK A;  2JPF A;  5ABG A;  4X5T A;  5AQR B;  3WAK A;  3B5M A;  2BDE A;  4H9R C;  5J0Z A;  2WZI A;  4QH4 A;  4TQU M;  4HN9 A;  2E5V A;  2YU1 A;  1N32 T;  2YDR A;  1D1B A;  2ODV A;  2F4V T;  4U2Y A;  3RQW A;  1KF6 A;  1FMW A;  4JEU B;  3PUW F;  4WBO A;  4MBQ A;  2A3D A;  2FJD A;  4YMV C;  3R6N A;  2WCA A;  3PUA A;  4P0B A;  2CCQ A;  1MND A;  2D5U A;  2KT9 A;  3K3Q C;  4B3R T;  4CN1 A;  2KWH A;  4COF A;  1QSD A;  5AQN B;  3AEC A;  4YLH A;  5ABE A;  2A72 A;  5EZY E;  1SUM B;  1MIW A;  3RKO A;  2H7O A;  2XM2 A;  2Y8D A;  2K48 A;  2NOX A;  4UF0 B;  4YY3 T;  4HFI A;  2L3L A;  3DJB A;  4H9Q C;  1IZN B;  3JC6 C;  4TV9 E;  4ZI3 C;  2CPT A;  1LVF A;  1HCI A;  3ZT5 A;  3O1J A;  2VVN A;  3IF8 B;  2C0S A;  5TAO A;  2R6G F;  5JDF A;  4NPP A;  2X9H A;  2NTX A;  3MZK B;  2VKO A;  3VU7 H;  4UF0 A;  5AFU L;  4YT0 A;  5FY0 A;  1KNP A;  5HAX A;  4JI5 T;  2IDO B;  5L2L A;  4O2A E;  4GKK T;  1HNZ T;  1I6Z A;  3H3M A;  2XM1 A;  4ILA A;  2UXN B;  5HEU A;  2LOS A;  2XQ4 A;  3B57 A;  3N2K E;  2VKD A;  3LFM A;  4B6X A;  3BQL A;  4UXN B;  4KUM B;  3F31 A;  3AEE A;  4QHO A;  4DR5 T;  4DO0 A;  4U72 A;  1G8X A;  4QH5 A;  2JQQ A;  5FXX A;  2DHR A;  5EK2 A;  2CXD A;  3P8C D;  3GWH A;  3SFE A;  4CXW A;  1MMA A;  5F5W A;  5FL0 A;  3TLV A;  4OX9 T;  3RPU A;  1Z8U A;  2NR4 A;  4KHZ F;  5LMU T;  4X20 E;  3UU5 A;  5JRE A;  3LDQ B;  3NZQ A;  2Y6X A;  1NEK A;  2P9B A;  4LFA T;  1E7P A;  2UUB T;  2JQ9 A;  3T1H T;  4JLE A;  4YTM A;  2X9Y A;  4YMS C;  3ZMT B;  1WYB A;  2LJL A;  5AQS B;  3PUV F;  1XMQ T;  1HNX T;  3RI5 A;  2XAG B;  3TLS A;  1BR4 A;  2XSB A;  2LRK A;  1IBK T;  3ZST A;  5H6Q B;  3OVU A;  2W0G A;  4EV6 A;  5DQV A;  3ZPO A;  2V7L A;  2W4X A;  4ADZ A;  3NRX A;  3ZT7 A;  2V7J A;  3O4X E;  4UVC B;  1LVK A;  1G73 A;  2XQY A;  1Y64 B;  4IGU A;  2WMO A;  1VCS A;  4XIG N;  3AE4 A;  4EYY R;  1Y01 A;  2LT3 A;  1JNR A;  2NW9 A;  4JI7 T;  1HG5 A;  4DV7 T;  2VQE T;  2I6H A;  4J2C A;  2ZM2 A;  1FJG T;  2FJE A;  5LHH B;  3B13 A;  4A97 A;  2CHN A;  3WI3 A;  4O4I E;  3VKH A;  3TUJ A;  3L09 A;  1YKH B;  3CX6 B;  3FZK B;  4ERR A;  3DHW A;  3ESL A;  2FJA A;  4QXC B;  3ZC0 A;  3EAM A;  2LEH A;  2A2F X;  4I4T E;  1IBL T;  4IIJ E;  3ZLI A;  4AQF C;  2CLY C;  4HGA A;  3AE1 A;  4OYJ A;  3ZJ1 A;  4PJL A;  1WCR A;  4EXT A;  5KMG P;  1KFY A;  3AXJ B;  2V6X A;  2QRX A;  2OA5 A;  3AA0 B;  4TNW A;  3HKD E;  3RHW A;  2V26 A;  2MYS A;  3SS1 A;  5AQL B;  3L8R A;  3T1Y T;  4QX8 B;  2ZMA A;  3AAI A;  1I94 T;  4ASK A;  3QC9 A;  1KEY A;  2PTF A;  4ILU A;  2CXL A;  1BR2 A;  5CGM A;  4WYV A;  4BJM A;  4LF5 T;  3AE2 A;  2VUR A;  3J7Y q;  1FMV A;  5JDN A;  2OLT A;  3RH3 A;  5KX5 E;  3AXJ A;  1MIY A;  4I0U A;  1YQ3 A;  2HN1 A;  4TNV A;  3UQ7 A;  3P4R A;  4IL9 A;  2DWK A;  4BAY B;  2WB5 A;  2LOP A;  3KFW X;  2SPC A;  5BR8 T;  4AQY T;  2QVA A;  3PUZ F;  4JUY A;  2W00 A;  4JI1 T;  4K0K T;  5LOV E;  4PJM A;  4UV9 B;  4JI3 T;  3TUI A;  3AED A;  2XAQ B;  3GMI A;  3PTR B;  3JC6 D;  3P7I A;  4ZI3 D;  2XUE A;  2LKG A;  5LJN A;  2Q9Q B;  4LML A;  4MFR A;  3PUS A;  1US7 B;  2LSG A;  4ZZB A;  2M6B A;  4HWI B;  5H6R B;  4WBN E;  2H88 A;  4IDZ A;  2X9W A;  1IJ5 A;  2V5C A;  1HR0 T;  5HXS A;  4MLK A;  4HFE A;  5LBM A;  1MMD A;  4DUY T;  2WU2 A;  4ZEY A;  5AQG B;  5L3C B;  2R6G G;  3UUB A;  4Z91 A;  3X1D A;  4OK0 A;  4XAX B;  1HTJ F;  4G2A A;  2L8K A;  4E7Z A;  3IA3 A;  2Q9Q A;  3VHL A;  4JI8 T;  3SWH A;  3KVB A;  5AQI B;  3ZMZ B;  2HPJ A;  3AAA B;  4K0U A;  4HEA A;  2XAJ B;  3PE0 A;  3QB5 A;  3CK6 A;  4X1K E;  3Q2M A;  2E2A A;  4JEH B;  2HN2 A;  2LHR A;  1S35 A;  2VQF T;  3KBT A;  3D31 C;  1WR0 A;  3KBU A;  2E9X D;  3MJX A;  1JNZ A;  2WDR A;  4HFH A;  1H7C A;  2LSY A;  5C3J A;  2MTQ A;  3KVA A;  2IW5 B;  5IWA T;  3JAE A;  4KHZ G;  5M4Y A;  1HS7 A;  2X0H A;  4YSZ A;  3AAE B;  2BG9 C;  4V1A v;  3EHZ A;  4PK5 A;  4ZI2 D;  2H89 A;  5IYZ E;  3E22 E;  2WAU A;  1OED B;  4AIS A;  2WZH A;  3EUH A;  5FYM A;  1BR0 A;  4U7I A;  4JI6 T;  4UVA B;  5JR9 B;  5BMV E;  2LLY A;  3UFE A;  3C51 A;  2LSJ A;  3RF1 A;  5HXH A;  2BVM A;  5HYA A;  5FMN A;  3UUN A;  4HWH A;  1OXZ A;  3ZMU B;  4U33 A;  5KDM C;  2X67 A;  4HFB A;  3ONL C;  3TLU A;  1OED A;  3OPC A;  4X1Y E;  2C5I T;  4F6R C;  4UR9 A;  2MPK A;  4MAL A;  3C98 B;  3RX6 A;  3RIU C;  2XQ8 A;  2LSI A;  3ZT6 A;  4NUU A;  1AJ3 A;  5LG3 A;  5JR9 A;  1UX4 A;  3UUM A;  1CHU A;  2LSK A;  3MAC A;  3FBL A;  1KNR A;  3OKQ A;  4DR7 T;  1YXR A;  2WBL A;  4H9N C;  1MIV A;  4QKN A;  5FVK A;  4GK0 E;  3UQ4 A;  4DV4 T;  5FY1 A;  3CQC B;  2VK9 A;  2XTL A;  4HTE A;  1S94 A;  4EZ4 A;  2JJ9 A;  5AQK B;  3VR9 A;  5AQM B;  4CQI A;  3TUZ A;  3S4U A;  3AVS A;  4YHH T;  3ZYK A;  4A98 A;  2UU9 T;  5L3B B;  1D0X A;  4IE5 A;  4PFO A;  2X66 A;  4U2Z A;  4DR6 T;  3DTO A;  1FEW A;  3PDY A;  3A7M A;  2YEV C;  3SFD A;  3LK4 2;  2PG8 A;  4QH1 A;  4KI0 G;  4IHJ E;  2ACZ A;  3UTK A;  1Z0P A;  1W9R A;  2WY2 A;  1YQ4 A;  2X51 A;  2J1D G;  3RC8 A;  1ZEE A;  4UEL A;  5E0O A;  5CB4 E;  4KP3 C;  1MMG A;  3PUZ G;  3U78 A;  2KND A;  2W66 A;  4EED A;  1XNR T;  4DMW A;  4YSX A;  4DV5 T;  5LB7 B;  2N9D A;  3I9W A;  2CA5 A;  2B76 A;  3AA1 B;  3IHR A;  4IE0 A;  1LKX A;  4M1P A;  2EHO D;  4PJN A;  5JDH A;  2GK9 A;  2X68 A;  3RRW A;  4ZHQ E;  3PJA J;  5KXJ A;  3ZYM A;  5CA0 E;  2IML A;  3MA9 A;  2NW8 A;  3ZJ2 A;  1HX1 B;  4WZX A;  4JV5 T;  3N9O A;  5HEH A;  2C5J A;  4A56 A;  2V5D A;  4IDN A;  1CUN A;  2D2S A;  4IST A;  4UVB B;  4TWD A;  3LJC A;  2E9X C;  1LRZ A;  5AQT B;  5HXR A;  5AQO B;  1WFD A;  1E2A A;  4UEM A;  4YFS A;  5EK4 A;  4AKI A;  3PUQ A;  4U31 A;  2V6Y B;  2WS3 A;  4KX6 A;  4ILB A;  4DBR A;  3K8P C;  2OV9 A;  4PK4 A;  1E1H B;  3ZCI A;  2DLR A;  4HFD A;  1D0Z A;  4GKJ T;  1VOM A;  2XAF B;  2D0T A;  1OWA A;  3RLF G;  3VRB A;  4ZI2 C;  4CI2 B;  5JDL A;  4L0R A;  3PV0 G;  3O9X A;  2CBJ A;  1U4Q A;  4YHJ A;  4TZ4 C;  2V6Y A;  5CFB A;  1EZ3 A;  4HKA A;  5DAB A;  4HWD A;  1XWM A;  2LHN A;  3TKL B;  3D0T A;  3NVO A;  3ONJ A;  2XY8 B;  1IBM T;  3Q5E A;  5AQU B;  1XMO T;  4JI2 T;  4X1I E;  5C8Y E;  2NWB A;  3NWI A;  2JQH A;  2CLY B;  2FUP A;  3ZSS A;  3CQX C;  1D1A A;  3AA6 B;  5AQP B;  1XNQ T;  3AE5 A;  3QOF A;  5CJ5 A;  4ANJ A;  2D9D A;  3LBX B;  4NIQ A;  3TLT A;  3VR8 A;  3N2O A;  1BR1 A;  5JVD E;  4EGW A;  2AE9 A;  2K24 A;  3WAJ A;  4O2B E;  2BBJ A;  4PW8 A;  3P4W A;  2ZM8 A;  3NRY A;  5HWY A;  2CMR A;  3MXZ A;  3N9N A;  3FB2 A;  2RA1 A;  3PUR A;  1UUR A;  4AQF A;  4X66 T;  3AEG A;  2YIN A;  3N9Q A;  4EYU A;  1W0A A;  4LFC T;  3ONX A;  5AQF B;  4WNK A;  3FZF B;  3LBX A;  1MNE A;  4YMW C;  2HPL A;  3HI2 A;  2J62 A;  3UT5 E;  4CN6 A;  4QXH B;  3JCF A;  2YKS A;  2KSR A;  4EAH A;  2DL1 A;  2W2U A;  1KK7 A;  3AEF A;  4KI0 F;  1M7K A;  4BA9 A;  3N9L A;  3P4Q A;  2IHR 1;  1XDP A;  5ABF B;  5FXV A;  2V7I A;  2I59 A;  5ABH A;  2VKH A;  3T8O A;  2WWV A;  3RC3 A;  1W0B A;  3ETV A;  2PJQ A;  3K3O A;  5J2U E;  2WU5 A;  2BZB A;  4DV0 T;  3QK6 A;  3UFG A;  2BVL A;  4MHC A;  2IAK A;  4I50 E;  4TX5 A;  1NAF A;  2VVS A;  2L9Q A;  2EHO C;  1UK5 A;  5LHI B;  2HH7 A;  3QB5 K;  4Z8X A;  2WWU A;  5ABF A;  2VL8 A;  3GN5 B;  4P1N A;  2NW7 A;  2XQ7 A;  2LM2 A;  1N34 T;  5J2T E;  2VB6 A;  4AKH A;  3L39 A;  4KHP T;  4ISS A;  4B3T T;  2LE8 A;  4I55 E;  2RPA A;  2DCF A;  2Q9Q C;  4NXM T;  2YOE A;  5F3J A;  1HF8 A;  5FY7 A;  3I1A A;  2DWG A;  5IUX A;  3ZN1 B;  2BS4 A;  2BKN A;  3AB3 B;  2V7M A;  3NBX X;  3A5X A;  3BQK A;  3PUY F;  4X64 T;  4I43 B;  3GN5 A;  3RLF F;  3PU8 A;  3RGL A;  3LK2 B;  2YK0 A;  5LGN B;  2BKO A;  2QGS A;  3O1I A;  2BG9 B;  1M62 A;  5AQH B;  3PV0 F;  4AIU A;  1WYC A;  4DBQ A;  2I0M A;  4XTC M;  4ZOL E;  2XQA A;  1X79 A;  2DI4 A;  4EEB A;  5DJQ C;  4LF9 T;  3KV5 A;  4YMU C;  5FP3 A;  4GYS A;  5L47 A;  2IC9 A;  4IRE A;  1HFA A;  3RYC E;  3UUX B;  3RYF E;  1J5W A;  3ABV A;  3KIN B;  4LF4 T;  3C4W A;  3HL6 A;  3OYZ A;  2CRB A;  2H7V C;  4O4L E;  1QLB A;  4DND A;  4DV6 T;  2BG9 A;  5LMN T;  3AVR A;  4LF8 T;  4DV3 T;  5LXT E;  2XPK A;  4BJN A;  4X62 T;  3CQG B;  2UXX B;  4TUY E;  4JI4 T;  3FHN A;  2X0L B;  4Q25 A;  3IEE A;  2WP9 A;  1XZY A;  5ETW A;  1NWM X;  1YD8 G;  4O4H E;  4C91 A;  3N9M A;  2VL0 A;  4YTP A;  2WDV A;  3LSV A;  3OTO T;  4O4J E;  1OED C;  2CM0 A;  4IE4 A;  1OED E;  5CA1 E;  1VCT A;  1X9B A;  3G06 A;  5HWX A;  4H9O C;  5JR9 C;  5L4E A;  2XHE B;  3HKE E;  3PUX F;  4FI5 A;  3JAD A;  2UXB T;  4DV1 T;  2KWI B;  3CML A;  3V5U A;  2LRL A;  3FZH B;  4TV8 E;  5FKY A;  4TQU N;  2XQ3 A;  4TWF A;  4GK5 E;  2WDQ A;  4U3C A;  4X65 T;  3OJA A;  4HFC A;  2MOZ A;  3P4P A;  4ZXL A;  2JMK A;  3W15 B;  5JH7 E;  2CWO A;  3RQU A;  3I0Q A;  5JDG A;  2BS3 A;  4HWC A;  5A1L A;  3HR0 A;  4QXB B;  5C2T A;  2XJ7 A;  4PK6 A;  2V1D B;  3EAB A;  2XAH B;  5LGT B;  3ZYL A;  5FXZ A;  4IDO A;  3OYX A;  3ETU A;  2MBG A;  2CBI A;  4UV8 B;  2XQ6 A;  2WQY A;  1DU2 A;  3OBV E;  3RKG A;  2UUC T;  4ZZC A;  3ZN0 B;  4Z90 A;  4DMV A;  3Q5D A;  5LGU B;  2JQK A;  1YKE B;  3EVY A;  3Q5W A;  2JMH A;  3RYH E;  1HG2 A;  5FL1 A;  4EZH A;  1WRD A;  2LM9 A;  1SHZ C;  3AE9 A;  2AXD S;  5EK3 A;  2NTY A;  2J47 A;  2CXF A;  4NUV A;  1J5E T;  4H63 H;  1NEN A;  4YTN A;  2BS2 A;  2E9X B;  3H3A A;  1UUS A;  2FBW A;  4DR2 T;  4JBW F;  2XSA A;  5JDQ A;  3UU3 A;  2KZ7 B;  2E5L T;  4A5X A;  5L3F B;  2G0U A;  2K9A A;  4CZZ B;  3AEB A;  4ZS2 A;  1U5P A;  3U3I A;  2ONK C;  3ANW B;  2Q9Q D;  3E0Z A;  3KV4 A;  3VRA A;  4LMK A;  4CI3 B;  5FVL A;  5L3D B;  1ZHC A;  4YSY A;  4GOU A;  3L3P A;  3O1H A;  3CX7 B;  2E9X A;  4H9S E;  1SE7 A;  2CEA A;  4E7S A;  2RP4 A;  4JI0 T;  1MMN A;  4XBF B;  4IE7 A;  5JQG E;  2C5K T;  4DR4 T;  3PUY G;  3R84 B;  4QX7 B;  5L4H A;  4AXP A;  2YDQ A;  2BKP A;  5LHG B;  3FXD B;  3DP7 A;  3K3N A;  3NZP A;  1SA0 E;  3ANW A;  3ZEF B;  1D1C A;  1L0V A;  1XDO A;  4GIW A;  2E8I A;  5ADX L;  3UU6 A;  4DUZ T;  4AKG A;  5FXW A;  2CE7 A;  3HKB E;  3KV9 A;  2XQ9 A;  4ILC A;  1N33 T;  2VAS A;  1T72 A;  2IUB A;  5F8P A;  3ZMV B;  4U74 A;  3AE3 A;  2UUA T;  2K3W A;  1B7T A;  3V5S A;  4IDQ A;  2X9X A;  1UCU A;  2MAW A;  1HX8 A;  4XIG M;  3Q5X A;  3FZM B;  3RYI E;  2W61 A;  5LA6 E;  5JRC B;  3CX8 B;  4IL4 A;  5JDM A;  1GQE A;  2KXP B;  5L3E B;  3C4X A;  5HCM A;  2VWA A;  3JAF A;  3F57 A;  2J4G A;  2YN6 A;  2VKJ A;  3P4S A;  4NXN T;  3UU8 A;  1J1J A;  3PU3 A;  4G63 A;  5HEG A;  2HHH T;  2Z6E A;  4CXX A;  4AKR B;  2H3R A;  3H37 A;  4JYA T;  4LFB T;  3CPZ A;  4N78 D;  1KNZ A;  2WSS V;  1IJ6 A;  3HA4 A;  2DNX A;  3TLW A;  3AE7 A;  3KV6 A;  4YXD A;  3I0O A;  5JRC A;  2ACX A;  3PUX G;  3A8Y C;  3P50 A;  3SOL A;  2B1E A;  3K1S A;  4CXY A;  5HCJ A;  3QUJ A;  4CI1 B;  4C90 A;  2WMN A;  1O3X A;  2JIW A;  3F2E A;  5AQQ B;  3C50 A;  4IE6 A;  2ZLY A;  4WW0 A;  1UGO A;  3M65 A;  2V8S V;  2KIN B;  3CVR A;  2CWY A;  2W62 A;  4AKL A;  4ZI7 E;  4H9P C;  4H63 V;  1N36 T;  2XAS B;  3PJA A;  4AI6 A;  3PUW G;  5GON E;  4O8S A;  3FBZ A;  4IDP A;  4KBM B;  4EOZ B;  2A9U A;  2EHO B;  1VRB A;  5AQJ B;  3FZL B;  2PBI A;  1ZP0 A;  2D0U A;  3AE6 A;  3C4Z A;  2LKH A;  3ZC1 A;  4KMC A;  3AEA A;  4GYR A;  3AE8 A;  3QNU A; 
#chains in the Genus database with same CATH homology
 4TQU M;  3PUZ G;  4JBW G;  4TQU N;  3TUZ A;  3PV0 G;  4XIG N;  4XIG M;  3TUJ A;  3PUY F;  4KI0 F;  3PUX G;  4KHZ G;  4YMU C;  3RLF F;  3D31 C;  2R6G F;  3DHW A;  4YMW C;  2ONK C;  4YMS C;  3PUW F;  4KI0 G;  3PUV F;  3PUY G;  3PUZ F;  4JBW F;  4YMT B;  3RLF G;  3PV0 F;  2R6G G;  3PUX F;  4KHZ F;  4YMV C;  3TUI A;  4XTC N;  4XTC M;  3PUW G;  3PUV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...