3PUVF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 143
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puvF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puvF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puvF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puvF02
3PV0G 3PV0F 4TQUN 4KHZG 3PUVG 4KHZF 3PUVF 4TQUM 3D31C 4YMUC 4YMVC 3PUZG 3PUZF 4YMWC 3PUYG 4YMTB 3PUYF 3RLFG 3RLFF 4JBWG 4KI0G 4JBWF 4KI0F 3TUIA 4XIGN 4XIGM 3TUZA 2R6GG 3PUWF 2R6GF 3TUJA 2ONKC 3PUWG 4XTCN 4XTCM 3DHWA 3PUXG 3PUXF 4YMSC
chains in the Genus database with same CATH superfamily
3CQGB 3MA9A 4LFBT 4AKLA 2D2SA 2KWIB 3ETVA 4HWIB 1OXZA 4EYYR 3HL6A 4HEAA 2R6GG 2X0HA 5L3CB 5KDMC 1MIVA 3KFWX 3OVUA 4QWNB 5AFUL 2OA5A 2NWBA 4DV4T 3UFGA 5AQRB 5LG3A 2JJ9A 4LF7T 4DIDB 2UUAT 3TKLB 2XZEA 1LRZA 4PFPA 3Q5DA 4Z91A 4AISA 3FZHB 5HAXA 4U7YA 3AXJA 2CHNA 1D0ZA 3EUHA 3NZPA 3L3PA 2ES0A 2VWAA 1QSDA 1WYBA 5CGMA 3PUWG 2BG9B 2YKSA 2VKJA 3Q2MA 3CX7B 4YLHA 4CXXA 4DV5T 1KNRA 3KV9A 4TWHA 4DV3T 2Y48B 2VQET 3H3AA 4L0RA 2FJDA 3TUJA 4NXMT 3LFMA 2PTFA 3A8YC 4DR4T 2Q9QA 4TQUM 5JDNA 2V7KA 4TWFA 1UURA 3WI3A 2ACXA 3J7Yq 4DR6T 3C4ZA 3PU3A 4NIQA 4ADZA 3RIUC 3RIAA 3OTOT 1M62A 5H6RB 2XASB 3KBTA 5HXCA 3RF1A 5IHYA 1J5ET 4AXPA 2XM1A 4CZZB 2WY2A 3GN5A 4CI3B 3NZQA 5FXXA 4HFDA 1HNXT 2CBJA 4H63H 1KFYA 4AQYT 3K3NA 2MBGA 5FYMA 3AB3B 5EK3A 3ZYMA 3LBXB 1UCUA 1JNRA 3CK6A 3IBPA 3P4QA 3UTKA 4IDOA 4ZZCA 5JREA 4PJLA 3AE5A 4P0BA 3MACA 4YHJA 2CWYA 3IHRA 3DP7A 1KEYA 4LF6T 2XQYA 2IAKA 1SUMB 2H3RA 3MXZA 3UUXB 4JI5T 4TV8E 4JI4T 3P4SA 5J2UE 1ZV4X 4XTCN 4YY3T 4JI3T 3ZLIA 2XQ3A 3ZJ2A 2VKHA 2QYWA 3F57A 3CQCB 2XUEA 4A5XA 4EGWA 3BQIA 2CE7A 3U3IA 4YMVC 3CIRA 4ZXLA 4YSZA 1S94A 3DTOA 3FB2A 3EHZA 3GMIA 2UXBT 3PUYF 4OHFA 1J5WA 2WMOA 2LSYA 4I55E 2HHHT 3ABVA 3FBZA 1VCSA 3FZKB 3MZKB 4JUYA 3B57A 3N2OA 2DL1A 2JMKA 5AQJB 1XWMA 2V6YB 2VKOA 2Q9QD 1IJ6A 4O4IE 3I9YA 3F31A 3CQXC 1G8XA 2LSKA 4IDQA 2LE8A 1SHZC 3QNUA 3Q5XA 2H89A 3AE4A 1FMWA 3OYZA 1J1JA 5HEHA 3QK6A 3PV0G 1D1AA 5LYJE 4OYJA 2L3LA 1ZHCA 4YTPA 2NTXA 1YXRA 1WCRA 3DJBA 2LM2A 3N9QA 3C50A 5ETWA 2V1DB 2YEVC 5CB4E 4CQIA 3AVRA 3P7IA 2K3WA 4YFSA 1HNWT 5HXHA 1N36T 2QVAA 2L9QA 3LJCA 4TN7B 5LHHB 1XNQT 3NKZA 3P4PA 4YTMA 2IC6A 3TLSA 4UXNB 2NR4A 3EDVA 2LM9A 3N2KE 3RQUA 2FJAA 4TNVA 4UV8B 2ZM0A 1NENA 4YMWC 4QXHB 5AQVB 2KNDA 5J1GA 3UUMA 5LGTB 2X9XA 4HGAA 2IIUA 4Q25A 1WLXA 2WAUA 4YMUC 4EEBA 5ABHA 4K0KT 4V1Av 5JR9A 4DV2T 2YK0A 4LF4T 5LB7B 3T8OA 5ABGA 2LRKA 4N78D 4IDNA 2BBJA 4WZXA 4QH1A 4TQUN 5JDQA 3RGLA 4TX5A 5LBQB 3PUZG 4PNIA 2BKNA 2IDOB 5CA0E 1E7PA 2FUPA 3ESLA 3L09A 3EVYA 3T1YT 3AAEB 5L2LA 4P1NA 4ZS3A 3C51A 4LF5T 4IIJE 2Q9QC 5LCYA 2C5IT 4WBOA 3I9WA 2HPJA 3N9OA 3AVSA 2VQFT 2W62A 5JVDE 4UV9B 4BAYB 2X67A 1CUNA 3R6NA 4X66T 4XIGM 4DNDA 2WM9A 4X1YE 5AQUB 4LF9T 1YQ4A 1FIOA 1MIYA 4EAHA 2WSSV 3I1AA 1HTJF 1NWMX 4E7SA 3PUVF 4KMCA 4WW0A 4ZZBA 2LLYA 2FJEA 1FMVA 3RLFG 3HKEE 4DO0A 5LGUB 4QX8B 4H9SE 2W66A 3ZMUB 2PFVA 2V26A 4HFEA 2HN1A 2X9HA 5AQPB 1WR0A 2E9XA 4X62T 2YN6A 4DR5T 3P4RA 2CXDA 4IE0A 5AQIB 1LVFA 3ETUA 2M6IA 2WZHA 3JCFA 3UU3A 4H63V 1Z8UA 2UXNB 5LNKA 1BR4A 5HEOA 3UU6A 3N9MA 3ZT5A 3ZT6A 5FP3A 4DR2T 5J0ZA 3H37A 1HS7A 5L4HA 3HA4A 2M6BA 3PU8A 5DQVA 2BKOA 3QB5K 1N34T 2K24A 5KX5E 1UX5A 2BVLA 2W2UA 3W15B 1HG2A 3QB5A 1I94T 5ABFA 2JRKA 3AA6B 4J2CA 1V9DA 3VKGA 1FEWA 3ANWA 5JH7E 1MMNA 2EHOA 2V5CA 4U33A 1HR0T 3B5MA 4A98A 2YU1A 4ERRA 2BDEA 4DV6T 4MLKA 2UXCT 2D0TA 4AKHA 3ZC1A 4KUMB 5HXSA 2W0GA 2UUBT 3PJAJ 2BS3A 3P8CD 2V6XA 3PUXF 2X0YA 2ACZA 4DMVA 2KMFA 5HWXA 3O4XE 4UIGA 5L47A 2J1DG 4JI0T 4IE4A 4O4HE 3PE0A 3LK42 4EEDA 2CLYB 3LK2B 1EZ3A 5L4EA 4YSYA 4YTNA 4KI0F 1HF8A 4HKAA 3U78A 5AQGB 3RI5A 4TUYE 1GQEA 1BR0A 2WZIA 1US7B 4PJJA 2N1GA 4XBFB 5FXWA 3FXDB 4IDPA 4NUVA 4GKJT 4YSXA 3M3ZB 2D5UA 5AQLB 2N9DA 4XAXB 1D0YA 2XAFB 5FXZA 4DR1T 3RYFE 5KMGP 3SWHA 5HXRA 3F2EA 2WDVA 2E9XD 2CXLA 5BR8T 3VR8A 2GK9A 3IEEA 4NPPA 5FY0A 3AA7B 4FI5A 3MJXA 2I6HA 3RYIE 2BG9A 2VL0A 5HYAA 2ZM6T 3Q9DA 5FKYA 1IBKT 5AQSB 3PUWF 4HTEA 2NP9A 3ZCIA 3SFDA 2JQQA 4X64T 4IL9A 1KNZA 2H88A 1SE7A 4MBQA 2KXPB 2BS4A 2IMLA 3FXEB 4DR3T 3AEFA 4JI1T 4UELA 2KZ7B 4G63A 2JMHA 2EHOD 4ILBA 4X65T 2W00A 3ZSSA 3K3OA 2V7MA 2PG8A 4UVCB 4ZEYA 3WAJA 3MK7C 1W9RA 3UULA 5LBMA 5JR9C 2W67A 4CN6A 4H9NC 5IYZE 4WYVA 4JI7T 3PUYG 5LMNT 1QUUA 5FXVA 5FVLA 1IBLT 3PUQA 3UU8A 4DMWA 4PK4A 5AQNB 3Q5WA 3GWHA 3CX8B 5F5WA 2WBLA 4LMLA 2UXXB 2P9BA 1IZNB 4B3ST 5HEUA 2BS2A 5HEJA 5JDFA 4Z90A 2Y6XA 4K0UA 2C0SA 4XIGN 5FVKA 4I0UA 5C2TA 3N9PA 2VKDA 4HFHA 3LBXA 2LKHA 4PJNA 4P0AA 4OYKA 2A2FX 3PUSA 3E0ZA 2CHOA 3IA3A 5DJQC 4UR9A 5C3JA 1XDOA 2CBIA 3PUGA 4TNWA 2IC9A 5AQTB 5L3DB 4HFIA 2E5VA 4E7ZA 3NVOA 3TLTA 3RYCE 2JQKA 1E2AA 4LFCT 3AE7A 3VR9A 3GA8A 3LSVA 4X1IE 5LP6E 2CM0A 3CKDA 3AA1B 4ZI3D 2WU5A 4IE5A 3BK9A 4GK0E 2RP4A 3ZYLA 2VB6A 2E9XC 2XAGB 2XQ9A 1LVKA 1T8BA 3TLWA 4OK0A 3KDSE 5JRCB 2UU9T 3CMLA 3PURA 3BQKA 4AQFC 2WDQA 5CJ5A 3RX6A 3P4WA 4H9RC 1SA0E 3C4XA 5JDHA 3ONLC 1DU2A 2CWOA 5A1LA 4HWDA 1G73A 2V6YA 5F3JA 5FNVE 2WDRA 1XDPA 4HWCA 4LF8T 2B1EA 5LXTE 4B3RT 1HNZT 2XAHB 2LSIA 4YHHT 1FJGT 3RRWA 5GONE 1UX4A 5L3BB 5CA1E 2J4GA 3AAAB 4JBWF 2EHOC 3KV4A 3TLVA 5ABEA 4QX7B 3NBXX 5AQOB 5FL1A 1OEDB 3AEAA 3I0QA 3QC9A 3ZMZB 5JRCA 5HXEA 1UK5A 2BG9E 4IGUA 3RC8A 3AEDA 2LHNA 3K3QC 3V5SA 2X9YA 4TV9E 3DHWA 3N2GE 3A5XA 5ADXL 4GYSA 2N2NA 4ZI7E 2NW9A 1XMQT 4O2AE 5DQWA 2AE9A 2J47A 1HX8A 3RYHE 3V5UA 1YW0A 2NW7A 3ZMSB 4I50E 4U2YA 3FHNA 2XQAA 5AQKB 2CMRA 2RA1A 1MMAA 4EV6A 4OX9T 2DWKA 3PUVG 4HE8A 2VK9A 3RC3A 4JEUB 3VU7H 3K1SA 1OEDA 3PJAA 3TUZA 2V7IA 2SPCA 4KP3C 5JDGA 1XNRT 3EAMA 3VKHA 3RPUA 4QH4A 3ZEFB 2XQ6A 1VCTA 4UF0B 4PK5A 3UT5E 2ZMAA 5C8YE 2C5KT 4WBNE 2QGSA 4ZI3C 2CLYC 3JC6D 3H3MA 3KINB 3ZYKA 4L9IA 3FZFB 5M4YA 4DUZT 2E2AA 4KHZF 5AQQB 2B76A 1W0AA 2BG9C 4CN1A 1O3XA 1WFDA 1N33T 2CA5A 1U4QA 1HX1B 2X66A 1IAPA 1KF6A 5L3FB 1Y01A 2PBIA 4IDZA 4DBQA 2CXFA 2VVNA 2V7JA 3CWZB 4EOZB 3SS1A 2A3DA 2LHRA 3QUJA 4UF0A 1YKHB 2D0UA 1M7KA 2DCFA 3HKDE 4O8SA 1WR6A 1JNZA 5J2TE 4H9PC 2NW8A 3NWIA 1WYCA 3SFEA 4HWFA 1HFAA 4HFBA 2DNXA 5EZYE 1W0BA 4EYUA 1YD8G 3PUXG 5HCMA 2D9DA 2QRXA 4EB6E 2VASA 4IT4A 5JDLA 4O4JE 1T72A 3O9XA 4KI0G 2KLQA 3PUAA 4PW8A 1L0VA 2FBWA 4C90A 1MMDA 3UFEA 4C91A 3ZMTB 4Z8XA 2YDQA 1HG5A 4GIWA 4X1KE 2WB5A 3AE8A 2WWVA 5AQMB 5FY1A 4JYAT 2H7OA 4AIUA 4JEHB 2WU2A 5LHIB 4ZHQE 2HH7A 5LMUT 5IUXA 4QH5A 4B6XA 2WQYA 4U72A 3ZCJA 5JTGA 2MOZA 4A56A 2K5BB 1D0XA 4NUUA 3ZN1B 2CRBA 2Q9QB 5L3EB 2Z6EA 3T1HT 1MMGA 2JPFA 4YMSC 4I4TE 2MPKA 3FZLB 4AKGA 4A97A 5EK2A 1S35A 3E22E 4DV7T 2YINA 3IF8B 2C5JA 2MAWA 3SRZA 3AE2A 2JQHA 2VL8A 3JC6C 4CI2B 4H9QC 2LRLA 3X1DA 2R6GF 2MTQA 1NEKA 2L8KA 2BKPA 3CX6B 4O4LE 2ZM2A 3GN5B 4U2ZA 2X51A 1OEDE 5TAOA 3UQ4A 4BJNA 4KBMB 5LJMA 3ZPOA 2KWHA 2CCQA 4F8HA 4AQGA 4TZ4C 4KHPT 2WP9A 4QHOA 4I43B 3OKQA 2YU2A 3OBVE 4B3TT 2ODVA 5LHGB 3JAFA 4U74A 4GYRA 4IHJE 4M1PA 4ILUA 1UGOA 4IL4A 3HKCE 2A9UA 2HPLA 3KBUA 5HCJA 3O1HA 3LK3B 2LKGA 4DV0T 2IHR1 4DV1T 5AQHB 2XJ7A 5BMVE 2KSRA 3C4WA 2XHEB 4ISTA 4UVAB 2BBHA 2V5DA 3O1IA 1T98A 3AEBA 3I0OA 5EK4A 3RHWA 3EDUA 3UU5A 4COFA 3ZJ1A 1ZEEA 3LDQB 3VRAA 4CXYA 4KX6A 4BJMA 3ZSTA 2MYSA 1N32T 4BA9A 3D31C 4ANJA 2XQ8A 4JI2T 1OEDC 3E08A 3ZC0A 2E5LT 2DLRA 5AQFB 4HN9A 1WRDA 1CHUA 5DABA 4EZ4A 2DI4A 2A72A 2W63A 4YJ2E 2ONKC 3ONJA 5IWAT 1MNEA 3HKBE 1H7CA 2LT3A 3A7MA 1ZOYA 2LEHA 3AE3A 4X5TA 3MKDA 2OV9A 4UEMA 4LMJA 5HWYA 3FZMB 2ZM8A 2I59A 3RQWA 4IREA 5FY7A 2KINB 4TWDA 3AEEA 1BR2A 5LG4A 3J9X1 2KT9A 3AA0B 4QKNA 4YJ3E 4DR7T 3BQLA 1KK7A 4FJOA 2I0MA 3AEGA 2M67A 4ASKA 4YT0A 5HEGA 1IJ5A 3ZMVB 4CN4A 3ZKRA 4WNKA 3OPCA 4ISSA 2JIWA 1HCIA 3EABA 2PJQA 3VRBA 4YMTB 4JBWG 4IE7A 2W4XA 4ZS2A 2AXDS 1MNDA 4AKRB 2J62A 2ZLYA 3O1JA 3KV5A 3L8RA 3JADA 2Y8DA 1BR1A 3UQ7A 2CPTA 5LJNA 3OJAA 1AJ3A 3LG7A 1R8IA 4LMKA 2IUBA 2XM2A 2QA7A 1YQ3A 3SOLA 2JQ9A 3TUIA 2K9AA 3EI0A 2FJBA 2LSJA 2VURA 3RH3A 3OYXA 1X9BA 1IBMT 2YDRA 2LJLA 3KVAA 2XY8B 4HFVA 4GOUA 4AI6A 1XZYA 4O2BE 2XAQB 2WWUA 4QXBB 3PDYA 4ZOLE 4X20E 2HN2A 1D1BA 5JR9B 1W09A 3D0TA 3AE9A 3ZT7A 2LOSA 2X68A 2XSAA 4PFOA 3PV0F 4YXDA 3AAIA 3RIUA 2CEAA 3NRYA 1T7SA 3AE1A 1E1HB 3JAEA 4ZI2D 4EZHA 4IE6A 4U3CA 3N5LA 4MFRA 5JDMA 4P09A 1ZKEA 3AE6A 3N9LA 5F8PA 3HR0A 4ILCA 3ZN0B 3RRCA 2XSBA 4HFCA 3KVBA 2BVMA 4MALA 4U7IA 3Q5EA 4PJMA 1VRBA 2G0UA 1Y64B 3UUBA 3RIFA 4XZCA 1YKEB 4KHZG 2ODUA 2F4VT 3M65A 4GKKT 4NXNT 2LOPA 4HWHA 1NAFA 4LFAT 4U31A 5FMNA 2BZBA 4JI8T 1LKXA 2DHRA 2XAJB 5JQGE 2XQ5A 4GK5E 3HI2A 3NRXA 3CVRA 3UU4A 1I6ZA 3L39A 2XPKA 1D1CA 3KV6A 2K48A 1MIWA 2OLTA 2WCAA 4JI6T 2XQ4A 4F6RC 4DVDA 4B3MT 1U5PA 1ZP0A 2V8SV 4XTCM 2VVSA 3S4UA 2W61A 2E9XB 5E0OA 4CI1B 3N9NA 1XMOT 3VHLA 3C98B 4ILAA 2XQ7A 3QOFA 4QXCB 2YDSA 2DWGA 2WS3A 1OWAA 3C64A 4MHCA 4CXWA 1X79A 5H6QB 3B13A 2V7LA 3FBLA 2H7VC 5LGNB 3P50A 4PAGA 3PUZF 2WMNA 4DUYT 4JLEA 4DBRA 2X0LB 3AECA 4OFZA 1Z0PA 2LSGA 5LOVE 5ABFB 4G2AA 4EIWA 2NOXA 2X9WA 2E8IA 4L5GA 2YOEA 2NTYA 3G06A 3ANWB 4JV5T 5KXJA 2EHOB 3R84B 4AKIA 1UUSA 4H9OC 1KNPA 4PK6A 4UVBB 4EXTA 3TLUA 3CPZA 1VOMA 5LA6E 2UUCT 5FL0A 3WAKA 2UXDT 3RKOA 2IW5B 5CFBA 2RPAA 5L3GB 4AQFA 3PTRB 3K8PC 3RLFF 1B7TA 3RKGA 4ZI2C 1QLBA 3ONXA 2XTLA 3UUNA 3AXJB
chains in the Genus database with same CATH topology
3PV0G 3PV0F 4TQUN 4KHZG 3PUVG 4KHZF 3PUVF 4TQUM 3D31C 4YMUC 4YMVC 3PUZG 3PUZF 4YMWC 3PUYG 4YMTB 3PUYF 3RLFG 3RLFF 4JBWG 4KI0G 4JBWF 4KI0F 3TUIA 4XIGN 4XIGM 3TUZA 2R6GG 3PUWF 2R6GF 3TUJA 2ONKC 3PUWG 4XTCN 4XTCM 3DHWA 3PUXG 3PUXF 4YMSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 G;  3PV0 F;  4TQU N;  4KHZ G;  3PUV G;  4KHZ F;  3PUV F;  4TQU M;  3D31 C;  4YMU C;  4YMV C;  3PUZ G;  3PUZ F;  4YMW C;  3PUY G;  4YMT B;  3PUY F;  3RLF G;  3RLF F;  4JBW G;  4KI0 G;  4JBW F;  4KI0 F;  3TUI A;  4XIG N;  4XIG M;  3TUZ A;  2R6G G;  3PUW F;  2R6G F;  3TUJ A;  2ONK C;  3PUW G;  4XTC N;  4XTC M;  3DHW A;  3PUX G;  3PUX F;  4YMS C; 
#chains in the Genus database with same CATH topology
 3CQG B;  3MA9 A;  4LFB T;  4AKL A;  2D2S A;  2KWI B;  3ETV A;  4HWI B;  1OXZ A;  4EYY R;  3HL6 A;  4HEA A;  2R6G G;  2X0H A;  5L3C B;  5KDM C;  1MIV A;  3KFW X;  3OVU A;  4QWN B;  5AFU L;  2OA5 A;  2NWB A;  4DV4 T;  3UFG A;  5AQR B;  5LG3 A;  2JJ9 A;  4LF7 T;  4DID B;  2UUA T;  3TKL B;  2XZE A;  1LRZ A;  4PFP A;  3Q5D A;  4Z91 A;  4AIS A;  3FZH B;  5HAX A;  4U7Y A;  3AXJ A;  2CHN A;  1D0Z A;  3EUH A;  3NZP A;  3L3P A;  2ES0 A;  2VWA A;  1QSD A;  1WYB A;  5CGM A;  3PUW G;  2BG9 B;  2YKS A;  2VKJ A;  3Q2M A;  3CX7 B;  4YLH A;  4CXX A;  4DV5 T;  1KNR A;  3KV9 A;  4TWH A;  4DV3 T;  2Y48 B;  2VQE T;  3H3A A;  4L0R A;  2FJD A;  3TUJ A;  4NXM T;  3LFM A;  2PTF A;  3A8Y C;  4DR4 T;  2Q9Q A;  4TQU M;  5JDN A;  2V7K A;  4TWF A;  1UUR A;  3WI3 A;  2ACX A;  3J7Y q;  4DR6 T;  3C4Z A;  3PU3 A;  4NIQ A;  4ADZ A;  3RIU C;  3RIA A;  3OTO T;  1M62 A;  5H6R B;  2XAS B;  3KBT A;  5HXC A;  3RF1 A;  5IHY A;  1J5E T;  4AXP A;  2XM1 A;  4CZZ B;  2WY2 A;  3GN5 A;  4CI3 B;  3NZQ A;  5FXX A;  4HFD A;  1HNX T;  2CBJ A;  4H63 H;  1KFY A;  4AQY T;  3K3N A;  2MBG A;  5FYM A;  3AB3 B;  5EK3 A;  3ZYM A;  3LBX B;  1UCU A;  1JNR A;  3CK6 A;  3IBP A;  3P4Q A;  3UTK A;  4IDO A;  4ZZC A;  5JRE A;  4PJL A;  3AE5 A;  4P0B A;  3MAC A;  4YHJ A;  2CWY A;  3IHR A;  3DP7 A;  1KEY A;  4LF6 T;  2XQY A;  2IAK A;  1SUM B;  2H3R A;  3MXZ A;  3UUX B;  4JI5 T;  4TV8 E;  4JI4 T;  3P4S A;  5J2U E;  1ZV4 X;  4XTC N;  4YY3 T;  4JI3 T;  3ZLI A;  2XQ3 A;  3ZJ2 A;  2VKH A;  2QYW A;  3F57 A;  3CQC B;  2XUE A;  4A5X A;  4EGW A;  3BQI A;  2CE7 A;  3U3I A;  4YMV C;  3CIR A;  4ZXL A;  4YSZ A;  1S94 A;  3DTO A;  3FB2 A;  3EHZ A;  3GMI A;  2UXB T;  3PUY F;  4OHF A;  1J5W A;  2WMO A;  2LSY A;  4I55 E;  2HHH T;  3ABV A;  3FBZ A;  1VCS A;  3FZK B;  3MZK B;  4JUY A;  3B57 A;  3N2O A;  2DL1 A;  2JMK A;  5AQJ B;  1XWM A;  2V6Y B;  2VKO A;  2Q9Q D;  1IJ6 A;  4O4I E;  3I9Y A;  3F31 A;  3CQX C;  1G8X A;  2LSK A;  4IDQ A;  2LE8 A;  1SHZ C;  3QNU A;  3Q5X A;  2H89 A;  3AE4 A;  1FMW A;  3OYZ A;  1J1J A;  5HEH A;  3QK6 A;  3PV0 G;  1D1A A;  5LYJ E;  4OYJ A;  2L3L A;  1ZHC A;  4YTP A;  2NTX A;  1YXR A;  1WCR A;  3DJB A;  2LM2 A;  3N9Q A;  3C50 A;  5ETW A;  2V1D B;  2YEV C;  5CB4 E;  4CQI A;  3AVR A;  3P7I A;  2K3W A;  4YFS A;  1HNW T;  5HXH A;  1N36 T;  2QVA A;  2L9Q A;  3LJC A;  4TN7 B;  5LHH B;  1XNQ T;  3NKZ A;  3P4P A;  4YTM A;  2IC6 A;  3TLS A;  4UXN B;  2NR4 A;  3EDV A;  2LM9 A;  3N2K E;  3RQU A;  2FJA A;  4TNV A;  4UV8 B;  2ZM0 A;  1NEN A;  4YMW C;  4QXH B;  5AQV B;  2KND A;  5J1G A;  3UUM A;  5LGT B;  2X9X A;  4HGA A;  2IIU A;  4Q25 A;  1WLX A;  2WAU A;  4YMU C;  4EEB A;  5ABH A;  4K0K T;  4V1A v;  5JR9 A;  4DV2 T;  2YK0 A;  4LF4 T;  5LB7 B;  3T8O A;  5ABG A;  2LRK A;  4N78 D;  4IDN A;  2BBJ A;  4WZX A;  4QH1 A;  4TQU N;  5JDQ A;  3RGL A;  4TX5 A;  5LBQ B;  3PUZ G;  4PNI A;  2BKN A;  2IDO B;  5CA0 E;  1E7P A;  2FUP A;  3ESL A;  3L09 A;  3EVY A;  3T1Y T;  3AAE B;  5L2L A;  4P1N A;  4ZS3 A;  3C51 A;  4LF5 T;  4IIJ E;  2Q9Q C;  5LCY A;  2C5I T;  4WBO A;  3I9W A;  2HPJ A;  3N9O A;  3AVS A;  2VQF T;  2W62 A;  5JVD E;  4UV9 B;  4BAY B;  2X67 A;  1CUN A;  3R6N A;  4X66 T;  4XIG M;  4DND A;  2WM9 A;  4X1Y E;  5AQU B;  4LF9 T;  1YQ4 A;  1FIO A;  1MIY A;  4EAH A;  2WSS V;  3I1A A;  1HTJ F;  1NWM X;  4E7S A;  3PUV F;  4KMC A;  4WW0 A;  4ZZB A;  2LLY A;  2FJE A;  1FMV A;  3RLF G;  3HKE E;  4DO0 A;  5LGU B;  4QX8 B;  4H9S E;  2W66 A;  3ZMU B;  2PFV A;  2V26 A;  4HFE A;  2HN1 A;  2X9H A;  5AQP B;  1WR0 A;  2E9X A;  4X62 T;  2YN6 A;  4DR5 T;  3P4R A;  2CXD A;  4IE0 A;  5AQI B;  1LVF A;  3ETU A;  2M6I A;  2WZH A;  3JCF A;  3UU3 A;  4H63 V;  1Z8U A;  2UXN B;  5LNK A;  1BR4 A;  5HEO A;  3UU6 A;  3N9M A;  3ZT5 A;  3ZT6 A;  5FP3 A;  4DR2 T;  5J0Z A;  3H37 A;  1HS7 A;  5L4H A;  3HA4 A;  2M6B A;  3PU8 A;  5DQV A;  2BKO A;  3QB5 K;  1N34 T;  2K24 A;  5KX5 E;  1UX5 A;  2BVL A;  2W2U A;  3W15 B;  1HG2 A;  3QB5 A;  1I94 T;  5ABF A;  2JRK A;  3AA6 B;  4J2C A;  1V9D A;  3VKG A;  1FEW A;  3ANW A;  5JH7 E;  1MMN A;  2EHO A;  2V5C A;  4U33 A;  1HR0 T;  3B5M A;  4A98 A;  2YU1 A;  4ERR A;  2BDE A;  4DV6 T;  4MLK A;  2UXC T;  2D0T A;  4AKH A;  3ZC1 A;  4KUM B;  5HXS A;  2W0G A;  2UUB T;  3PJA J;  2BS3 A;  3P8C D;  2V6X A;  3PUX F;  2X0Y A;  2ACZ A;  4DMV A;  2KMF A;  5HWX A;  3O4X E;  4UIG A;  5L47 A;  2J1D G;  4JI0 T;  4IE4 A;  4O4H E;  3PE0 A;  3LK4 2;  4EED A;  2CLY B;  3LK2 B;  1EZ3 A;  5L4E A;  4YSY A;  4YTN A;  4KI0 F;  1HF8 A;  4HKA A;  3U78 A;  5AQG B;  3RI5 A;  4TUY E;  1GQE A;  1BR0 A;  2WZI A;  1US7 B;  4PJJ A;  2N1G A;  4XBF B;  5FXW A;  3FXD B;  4IDP A;  4NUV A;  4GKJ T;  4YSX A;  3M3Z B;  2D5U A;  5AQL B;  2N9D A;  4XAX B;  1D0Y A;  2XAF B;  5FXZ A;  4DR1 T;  3RYF E;  5KMG P;  3SWH A;  5HXR A;  3F2E A;  2WDV A;  2E9X D;  2CXL A;  5BR8 T;  3VR8 A;  2GK9 A;  3IEE A;  4NPP A;  5FY0 A;  3AA7 B;  4FI5 A;  3MJX A;  2I6H A;  3RYI E;  2BG9 A;  2VL0 A;  5HYA A;  2ZM6 T;  3Q9D A;  5FKY A;  1IBK T;  5AQS B;  3PUW F;  4HTE A;  2NP9 A;  3ZCI A;  3SFD A;  2JQQ A;  4X64 T;  4IL9 A;  1KNZ A;  2H88 A;  1SE7 A;  4MBQ A;  2KXP B;  2BS4 A;  2IML A;  3FXE B;  4DR3 T;  3AEF A;  4JI1 T;  4UEL A;  2KZ7 B;  4G63 A;  2JMH A;  2EHO D;  4ILB A;  4X65 T;  2W00 A;  3ZSS A;  3K3O A;  2V7M A;  2PG8 A;  4UVC B;  4ZEY A;  3WAJ A;  3MK7 C;  1W9R A;  3UUL A;  5LBM A;  5JR9 C;  2W67 A;  4CN6 A;  4H9N C;  5IYZ E;  4WYV A;  4JI7 T;  3PUY G;  5LMN T;  1QUU A;  5FXV A;  5FVL A;  1IBL T;  3PUQ A;  3UU8 A;  4DMW A;  4PK4 A;  5AQN B;  3Q5W A;  3GWH A;  3CX8 B;  5F5W A;  2WBL A;  4LML A;  2UXX B;  2P9B A;  1IZN B;  4B3S T;  5HEU A;  2BS2 A;  5HEJ A;  5JDF A;  4Z90 A;  2Y6X A;  4K0U A;  2C0S A;  4XIG N;  5FVK A;  4I0U A;  5C2T A;  3N9P A;  2VKD A;  4HFH A;  3LBX A;  2LKH A;  4PJN A;  4P0A A;  4OYK A;  2A2F X;  3PUS A;  3E0Z A;  2CHO A;  3IA3 A;  5DJQ C;  4UR9 A;  5C3J A;  1XDO A;  2CBI A;  3PUG A;  4TNW A;  2IC9 A;  5AQT B;  5L3D B;  4HFI A;  2E5V A;  4E7Z A;  3NVO A;  3TLT A;  3RYC E;  2JQK A;  1E2A A;  4LFC T;  3AE7 A;  3VR9 A;  3GA8 A;  3LSV A;  4X1I E;  5LP6 E;  2CM0 A;  3CKD A;  3AA1 B;  4ZI3 D;  2WU5 A;  4IE5 A;  3BK9 A;  4GK0 E;  2RP4 A;  3ZYL A;  2VB6 A;  2E9X C;  2XAG B;  2XQ9 A;  1LVK A;  1T8B A;  3TLW A;  4OK0 A;  3KDS E;  5JRC B;  2UU9 T;  3CML A;  3PUR A;  3BQK A;  4AQF C;  2WDQ A;  5CJ5 A;  3RX6 A;  3P4W A;  4H9R C;  1SA0 E;  3C4X A;  5JDH A;  3ONL C;  1DU2 A;  2CWO A;  5A1L A;  4HWD A;  1G73 A;  2V6Y A;  5F3J A;  5FNV E;  2WDR A;  1XDP A;  4HWC A;  4LF8 T;  2B1E A;  5LXT E;  4B3R T;  1HNZ T;  2XAH B;  2LSI A;  4YHH T;  1FJG T;  3RRW A;  5GON E;  1UX4 A;  5L3B B;  5CA1 E;  2J4G A;  3AAA B;  4JBW F;  2EHO C;  3KV4 A;  3TLV A;  5ABE A;  4QX7 B;  3NBX X;  5AQO B;  5FL1 A;  1OED B;  3AEA A;  3I0Q A;  3QC9 A;  3ZMZ B;  5JRC A;  5HXE A;  1UK5 A;  2BG9 E;  4IGU A;  3RC8 A;  3AED A;  2LHN A;  3K3Q C;  3V5S A;  2X9Y A;  4TV9 E;  3DHW A;  3N2G E;  3A5X A;  5ADX L;  4GYS A;  2N2N A;  4ZI7 E;  2NW9 A;  1XMQ T;  4O2A E;  5DQW A;  2AE9 A;  2J47 A;  1HX8 A;  3RYH E;  3V5U A;  1YW0 A;  2NW7 A;  3ZMS B;  4I50 E;  4U2Y A;  3FHN A;  2XQA A;  5AQK B;  2CMR A;  2RA1 A;  1MMA A;  4EV6 A;  4OX9 T;  2DWK A;  3PUV G;  4HE8 A;  2VK9 A;  3RC3 A;  4JEU B;  3VU7 H;  3K1S A;  1OED A;  3PJA A;  3TUZ A;  2V7I A;  2SPC A;  4KP3 C;  5JDG A;  1XNR T;  3EAM A;  3VKH A;  3RPU A;  4QH4 A;  3ZEF B;  2XQ6 A;  1VCT A;  4UF0 B;  4PK5 A;  3UT5 E;  2ZMA A;  5C8Y E;  2C5K T;  4WBN E;  2QGS A;  4ZI3 C;  2CLY C;  3JC6 D;  3H3M A;  3KIN B;  3ZYK A;  4L9I A;  3FZF B;  5M4Y A;  4DUZ T;  2E2A A;  4KHZ F;  5AQQ B;  2B76 A;  1W0A A;  2BG9 C;  4CN1 A;  1O3X A;  1WFD A;  1N33 T;  2CA5 A;  1U4Q A;  1HX1 B;  2X66 A;  1IAP A;  1KF6 A;  5L3F B;  1Y01 A;  2PBI A;  4IDZ A;  4DBQ A;  2CXF A;  2VVN A;  2V7J A;  3CWZ B;  4EOZ B;  3SS1 A;  2A3D A;  2LHR A;  3QUJ A;  4UF0 A;  1YKH B;  2D0U A;  1M7K A;  2DCF A;  3HKD E;  4O8S A;  1WR6 A;  1JNZ A;  5J2T E;  4H9P C;  2NW8 A;  3NWI A;  1WYC A;  3SFE A;  4HWF A;  1HFA A;  4HFB A;  2DNX A;  5EZY E;  1W0B A;  4EYU A;  1YD8 G;  3PUX G;  5HCM A;  2D9D A;  2QRX A;  4EB6 E;  2VAS A;  4IT4 A;  5JDL A;  4O4J E;  1T72 A;  3O9X A;  4KI0 G;  2KLQ A;  3PUA A;  4PW8 A;  1L0V A;  2FBW A;  4C90 A;  1MMD A;  3UFE A;  4C91 A;  3ZMT B;  4Z8X A;  2YDQ A;  1HG5 A;  4GIW A;  4X1K E;  2WB5 A;  3AE8 A;  2WWV A;  5AQM B;  5FY1 A;  4JYA T;  2H7O A;  4AIU A;  4JEH B;  2WU2 A;  5LHI B;  4ZHQ E;  2HH7 A;  5LMU T;  5IUX A;  4QH5 A;  4B6X A;  2WQY A;  4U72 A;  3ZCJ A;  5JTG A;  2MOZ A;  4A56 A;  2K5B B;  1D0X A;  4NUU A;  3ZN1 B;  2CRB A;  2Q9Q B;  5L3E B;  2Z6E A;  3T1H T;  1MMG A;  2JPF A;  4YMS C;  4I4T E;  2MPK A;  3FZL B;  4AKG A;  4A97 A;  5EK2 A;  1S35 A;  3E22 E;  4DV7 T;  2YIN A;  3IF8 B;  2C5J A;  2MAW A;  3SRZ A;  3AE2 A;  2JQH A;  2VL8 A;  3JC6 C;  4CI2 B;  4H9Q C;  2LRL A;  3X1D A;  2R6G F;  2MTQ A;  1NEK A;  2L8K A;  2BKP A;  3CX6 B;  4O4L E;  2ZM2 A;  3GN5 B;  4U2Z A;  2X51 A;  1OED E;  5TAO A;  3UQ4 A;  4BJN A;  4KBM B;  5LJM A;  3ZPO A;  2KWH A;  2CCQ A;  4F8H A;  4AQG A;  4TZ4 C;  4KHP T;  2WP9 A;  4QHO A;  4I43 B;  3OKQ A;  2YU2 A;  3OBV E;  4B3T T;  2ODV A;  5LHG B;  3JAF A;  4U74 A;  4GYR A;  4IHJ E;  4M1P A;  4ILU A;  1UGO A;  4IL4 A;  3HKC E;  2A9U A;  2HPL A;  3KBU A;  5HCJ A;  3O1H A;  3LK3 B;  2LKG A;  4DV0 T;  2IHR 1;  4DV1 T;  5AQH B;  2XJ7 A;  5BMV E;  2KSR A;  3C4W A;  2XHE B;  4IST A;  4UVA B;  2BBH A;  2V5D A;  3O1I A;  1T98 A;  3AEB A;  3I0O A;  5EK4 A;  3RHW A;  3EDU A;  3UU5 A;  4COF A;  3ZJ1 A;  1ZEE A;  3LDQ B;  3VRA A;  4CXY A;  4KX6 A;  4BJM A;  3ZST A;  2MYS A;  1N32 T;  4BA9 A;  3D31 C;  4ANJ A;  2XQ8 A;  4JI2 T;  1OED C;  3E08 A;  3ZC0 A;  2E5L T;  2DLR A;  5AQF B;  4HN9 A;  1WRD A;  1CHU A;  5DAB A;  4EZ4 A;  2DI4 A;  2A72 A;  2W63 A;  4YJ2 E;  2ONK C;  3ONJ A;  5IWA T;  1MNE A;  3HKB E;  1H7C A;  2LT3 A;  3A7M A;  1ZOY A;  2LEH A;  3AE3 A;  4X5T A;  3MKD A;  2OV9 A;  4UEM A;  4LMJ A;  5HWY A;  3FZM B;  2ZM8 A;  2I59 A;  3RQW A;  4IRE A;  5FY7 A;  2KIN B;  4TWD A;  3AEE A;  1BR2 A;  5LG4 A;  3J9X 1;  2KT9 A;  3AA0 B;  4QKN A;  4YJ3 E;  4DR7 T;  3BQL A;  1KK7 A;  4FJO A;  2I0M A;  3AEG A;  2M67 A;  4ASK A;  4YT0 A;  5HEG A;  1IJ5 A;  3ZMV B;  4CN4 A;  3ZKR A;  4WNK A;  3OPC A;  4ISS A;  2JIW A;  1HCI A;  3EAB A;  2PJQ A;  3VRB A;  4YMT B;  4JBW G;  4IE7 A;  2W4X A;  4ZS2 A;  2AXD S;  1MND A;  4AKR B;  2J62 A;  2ZLY A;  3O1J A;  3KV5 A;  3L8R A;  3JAD A;  2Y8D A;  1BR1 A;  3UQ7 A;  2CPT A;  5LJN A;  3OJA A;  1AJ3 A;  3LG7 A;  1R8I A;  4LMK A;  2IUB A;  2XM2 A;  2QA7 A;  1YQ3 A;  3SOL A;  2JQ9 A;  3TUI A;  2K9A A;  3EI0 A;  2FJB A;  2LSJ A;  2VUR A;  3RH3 A;  3OYX A;  1X9B A;  1IBM T;  2YDR A;  2LJL A;  3KVA A;  2XY8 B;  4HFV A;  4GOU A;  4AI6 A;  1XZY A;  4O2B E;  2XAQ B;  2WWU A;  4QXB B;  3PDY A;  4ZOL E;  4X20 E;  2HN2 A;  1D1B A;  5JR9 B;  1W09 A;  3D0T A;  3AE9 A;  3ZT7 A;  2LOS A;  2X68 A;  2XSA A;  4PFO A;  3PV0 F;  4YXD A;  3AAI A;  3RIU A;  2CEA A;  3NRY A;  1T7S A;  3AE1 A;  1E1H B;  3JAE A;  4ZI2 D;  4EZH A;  4IE6 A;  4U3C A;  3N5L A;  4MFR A;  5JDM A;  4P09 A;  1ZKE A;  3AE6 A;  3N9L A;  5F8P A;  3HR0 A;  4ILC A;  3ZN0 B;  3RRC A;  2XSB A;  4HFC A;  3KVB A;  2BVM A;  4MAL A;  4U7I A;  3Q5E A;  4PJM A;  1VRB A;  2G0U A;  1Y64 B;  3UUB A;  3RIF A;  4XZC A;  1YKE B;  4KHZ G;  2ODU A;  2F4V T;  3M65 A;  4GKK T;  4NXN T;  2LOP A;  4HWH A;  1NAF A;  4LFA T;  4U31 A;  5FMN A;  2BZB A;  4JI8 T;  1LKX A;  2DHR A;  2XAJ B;  5JQG E;  2XQ5 A;  4GK5 E;  3HI2 A;  3NRX A;  3CVR A;  3UU4 A;  1I6Z A;  3L39 A;  2XPK A;  1D1C A;  3KV6 A;  2K48 A;  1MIW A;  2OLT A;  2WCA A;  4JI6 T;  2XQ4 A;  4F6R C;  4DVD A;  4B3M T;  1U5P A;  1ZP0 A;  2V8S V;  4XTC M;  2VVS A;  3S4U A;  2W61 A;  2E9X B;  5E0O A;  4CI1 B;  3N9N A;  1XMO T;  3VHL A;  3C98 B;  4ILA A;  2XQ7 A;  3QOF A;  4QXC B;  2YDS A;  2DWG A;  2WS3 A;  1OWA A;  3C64 A;  4MHC A;  4CXW A;  1X79 A;  5H6Q B;  3B13 A;  2V7L A;  3FBL A;  2H7V C;  5LGN B;  3P50 A;  4PAG A;  3PUZ F;  2WMN A;  4DUY T;  4JLE A;  4DBR A;  2X0L B;  3AEC A;  4OFZ A;  1Z0P A;  2LSG A;  5LOV E;  5ABF B;  4G2A A;  4EIW A;  2NOX A;  2X9W A;  2E8I A;  4L5G A;  2YOE A;  2NTY A;  3G06 A;  3ANW B;  4JV5 T;  5KXJ A;  2EHO B;  3R84 B;  4AKI A;  1UUS A;  4H9O C;  1KNP A;  4PK6 A;  4UVB B;  4EXT A;  3TLU A;  3CPZ A;  1VOM A;  5LA6 E;  2UUC T;  5FL0 A;  3WAK A;  2UXD T;  3RKO A;  2IW5 B;  5CFB A;  2RPA A;  5L3G B;  4AQF A;  3PTR B;  3K8P C;  3RLF F;  1B7T A;  3RKG A;  4ZI2 C;  1QLB A;  3ONX A;  2XTL A;  3UUN A;  3AXJ B; 
#chains in the Genus database with same CATH homology
 3PV0 G;  3PV0 F;  4TQU N;  4KHZ G;  3PUV G;  4KHZ F;  3PUV F;  4TQU M;  3D31 C;  4YMU C;  4YMV C;  3PUZ G;  3PUZ F;  4YMW C;  3PUY G;  4YMT B;  3PUY F;  3RLF G;  3RLF F;  4JBW G;  4KI0 G;  4JBW F;  4KI0 F;  3TUI A;  4XIG N;  4XIG M;  3TUZ A;  2R6G G;  3PUW F;  2R6G F;  3TUJ A;  2ONK C;  3PUW G;  4XTC N;  4XTC M;  3DHW A;  3PUX G;  3PUX F;  4YMS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...