3PUXF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 151
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puxF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puxF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puxF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puxF02
4YMSC 2ONKC 4KHZF 4XIGN 4KHZG 2R6GG 4JBWF 3TUIA 3RLFF 3DHWA 4YMVC 3PUYF 4XTCN 4JBWG 4TQUN 3RLFG 3PUXF 4YMTB 3PUYG 3PUVF 4KI0F 3PUWF 3PUXG 4XTCM 4XIGM 4KI0G 3PUVG 3PV0F 3PUWG 3D31C 3TUJA 3TUZA 3PV0G 3PUZF 4YMWC 4YMUC 3PUZG 2R6GF 4TQUM
chains in the Genus database with same CATH superfamily
3N2OA 3GA8A 3SFEA 3RH3A 4DV0T 5FXXA 3FZKB 2DHRA 3AEDA 4U3CA 3AE9A 2Z6EA 2E5VA 3N9LA 4PJJA 2BVLA 3O1HA 4CI2B 2LJLA 4MALA 1U5PA 1M62A 1VCTA 2DNXA 5CGMA 1BR0A 2YINA 3VR9A 3NZQA 3ZMZB 2CXDA 1HNZT 5KX5E 3PUWG 4O4IE 2AE9A 3K3QC 4UELA 4U31A 2QGSA 3RIUC 1FMVA 3SOLA 4M1PA 3P4WA 4I0UA 2I6HA 1XDOA 3RIFA 3RLFF 4PK4A 5HXHA 4IDZA 3E08A 5HCJA 3F57A 5F3JA 1YW0A 4PFPA 4YMTB 4WYVA 3PUYG 3PURA 2VKHA 1T98A 3ZKRA 3GN5A 4DR3T 4TNWA 3NZPA 4YMUC 5FXZA 2WZIA 4U33A 3KV5A 2CE7A 1QSDA 3UU8A 3P4RA 5HXCA 2YEVC 4LF7T 3KBUA 3B5MA 2LRLA 4AKLA 3ZMTB 3RIUA 2K24A 1N33T 3I9YA 4ERRA 2JQKA 5ABEA 5JTGA 5AQKB 4HWIB 4DR2T 5LNKA 2E9XB 4DV1T 3CK6A 3AA6B 3EDVA 4NUVA 4QKNA 3ONJA 3KINB 4ILCA 3L3PA 3P7IA 1FJGT 5HXRA 1SHZC 2XASB 3ZT7A 2PJQA 4YTPA 4AI6A 2X66A 5JR9C 4DR6T 3AE4A 1KNRA 4QXBB 2SPCA 1HX1B 3EAMA 3M3ZB 2ES0A 3UULA 4OYJA 4ZI3D 4DR1T 4DR4T 5AQJB 5L2LA 5DQVA 2YN6A 5C8YE 4TQUM 2MTQA 4B3MT 2B1EA 4OYKA 4AQFC 4ZI2D 3T8OA 3AA0B 2N2NA 4U7YA 3PUVG 2XUEA 5JR9A 3TUJA 2YU1A 5L47A 1HG2A 2XJ7A 5JDGA 1VRBA 4LF8T 2LM9A 4WNKA 5AFUL 1MMAA 3ZCIA 3FBZA 5AQNB 5AQQB 2J47A 3HA4A 3RGLA 1HX8A 4GKKT 4AIUA 5HEGA 2M6BA 4AQFA 1N36T 2UUCT 4YXDA 4B3ST 4A97A 3PUGA 3T1HT 4X20E 3ONLC 4GK0E 2LRKA 4UVBB 2V1DB 4U72A 5IYZE 2HN1A 3N9NA 3O4XE 4HGAA 4O2BE 1J1JA 2C5JA 5HWYA 4QWNB 1D1CA 3MK7C 2Y48B 2XQ8A 3AEEA 4NPPA 4JUYA 5HEOA 4EYYR 4ZZBA 3I0QA 3MXZA 2EHOC 2V6XA 4IGUA 5LMUT 2HN2A 2XQAA 4EAHA 3FBLA 5JH7E 4IREA 3TLSA 2WDQA 3CWZB 4AQGA 3RLFG 1WRDA 1W0AA 2V5CA 5ABFA 2CMRA 2CHOA 1ZEEA 4XBFB 5LJMA 4PNIA 3K3NA 4X1YE 2FJBA 4LF9T 3AE5A 4HEAA 4AQYT 4L9IA 1HFAA 2A3DA 1HTJF 2BKOA 4U2ZA 1L0VA 2NTYA 2DCFA 3LBXA 4ZZCA 2LT3A 2KLQA 2MAWA 4TNVA 5JDLA 2X68A 2BKPA 4WW0A 5HCMA 3HR0A 3AE6A 5L3DB 4NXNT 5IWAT 3QB5A 1BR2A 3O1IA 4NXMT 1MIVA 3ZJ1A 3DJBA 1FEWA 3TLTA 5HAXA 3SFDA 2J1DG 2OA5A 1WCRA 4OX9T 5JDHA 2ZM6T 4HTEA 3P8CD 3MZKB 2VKJA 4DV3T 2QRXA 3ZMVB 2UXCT 3UTKA 5FXVA 1G8XA 4MBQA 3N5LA 3PUSA 4TUYE 2WWUA 4EV6A 4H9QC 4F6RC 5LHHB 4CZZB 2E9XC 3P4PA 4XIGM 5JREA 2C5IT 2V7MA 3PUQA 2RA1A 2V6YB 5H6QB 4WZXA 2XAQB 1OWAA 3T1YT 1ZOYA 2ZLYA 2LLYA 2YDSA 1MNEA 3NKZA 2QA7A 1S94A 4PAGA 3JCFA 3CX6B 3HKDE 2XSAA 2ODVA 1DU2A 3AEFA 4EZHA 2V7KA 2N9DA 4UF0A 3H37A 5JQGE 5JRCB 2BZBA 2WDRA 2J4GA 4HFHA 2H7OA 2CBIA 4U7IA 3PUXF 1Z8UA 5LXTE 2W2UA 5DQWA 1NEKA 3RI5A 2J62A 1MMGA 4HWHA 1HS7A 3Q5WA 2LSKA 3OYZA 4ZXLA 4IE4A 5LHIB 5EK3A 4YT0A 2X9XA 2Q9QA 2HH7A 3PU3A 4G63A 2VURA 4XTCN 1KK7A 4DUZT 1CHUA 5FYMA 5AQFB 5LA6E 3ANWB 5H6RB 2KINB 4A56A 5J2UE 4BJNA 2RPAA 5FKYA 3FB2A 3UUNA 5C3JA 5LG4A 2X0YA 4DR5T 4OHFA 1WLXA 3BQKA 3ESLA 3AE8A 2XQ4A 3K1SA 5AQOB 2WSSV 3MACA 1XMQT 4LFBT 3K3OA 4CN4A 1UX4A 3AAAB 4YSYA 2VK9A 3AXJB 5LOVE 4C91A 2W63A 4DR7T 4HFDA 3EI0A 3C4XA 4CN1A 5LGNB 3C4ZA 5LGTB 1CUNA 2K9AA 4JI0T 4GK5E 4J2CA 4IE5A 1NENA 3PU8A 3FZFB 2VQFT 2UUAT 2X51A 4AKHA 2V8SV 4X5TA 3L09A 5ADXL 3HKBE 2IUBA 2VVNA 1MNDA 2NOXA 5KDMC 1GQEA 2PBIA 2VB6A 2ONKC 5ABGA 1T7SA 4JBWF 2ACZA 4LMJA 4LF6T 5JDFA 4AKIA 3J9X1 4LMKA 1OEDB 3C64A 5F8PA 3TLWA 3PJAJ 3ZN1B 4B3RT 3ETUA 4HFEA 2LKHA 3CX7B 5AQUB 4JI8T 4FJOA 4HKAA 3QUJA 3ZCJA 3MKDA 4IDPA 5HXEA 3RRWA 3CQXC 2CWYA 4AISA 3V5SA 4EEBA 2WBLA 1MMNA 4TWFA 1HF8A 3PDYA 5AQVB 4E7SA 2IIUA 3VKGA 3KV9A 3I1AA 1M7KA 3BK9A 3JAFA 4DMVA 4MLKA 5ABHA 4PFOA 5L3FB 4X65T 3AB3B 2JQ9A 2R6GF 5AQLB 2OV9A 2VWAA 3ZEFB 3ZN0B 3U3IA 4ISSA 4Z91A 3RKOA 1IJ6A 2JMHA 4LF5T 4YSZA 4ILAA 3PUXG 4TV8E 1UGOA 3ZSTA 4IE7A 4IE6A 1HNXT 4GYSA 1IJ5A 2DLRA 4DBRA 2X0HA 4QH1A 4AKGA 2WU2A 2KNDA 4ILUA 3WAJA 3OYXA 3OBVE 1WYCA 1ZHCA 3AVSA 3GWHA 2W61A 3RX6A 2P9BA 3FZLB 2X9WA 4LF4T 2LOPA 2DWKA 1IBLT 4KX6A 4PK5A 1XWMA 4QHOA 2V7LA 2VASA 1QUUA 3AE1A 4I55E 2V7JA 5HEJA 5HWXA 1T8BA 2X9YA 1W9RA 2HPJA 2BG9E 2IDOB 5KXJA 4H9RC 3H3MA 2ZM8A 4A98A 2YU2A 1NWMX 5FNVE 1SUMB 3WAKA 3OPCA 5LP6E 1XDPA 2KT9A 1AJ3A 2NWBA 4L0RA 3LG7A 4ZEYA 1MMDA 3P4SA 3TKLB 2W62A 4IT4A 4X1IE 3RHWA 3UFGA 4H9PC 3RPUA 3A5XA 4OK0A 1IBKT 1X9BA 3B57A 1MIYA 3ZC0A 4C90A 4ANJA 2XQYA 4YTNA 4HWCA 2ODUA 2L9QA 1FMWA 2WZHA 4ZOLE 5CB4E 4H9SE 3ZYKA 4DVDA 4F8HA 4HFIA 2C0SA 2UXNB 2YDRA 3EDUA 2E5LT 3RKGA 2H89A 1FIOA 2CWOA 4DUYT 4CI1B 1BR4A 4HWDA 1D1BA 2IW5B 3AA1B 3Q5XA 3CMLA 1HCIA 3MJXA 2LHNA 5CJ5A 4UV8B 4AXPA 2GK9A 3ZPOA 4YJ2E 3PTRB 1UX5A 3A8YC 2YDQA 4JEUB 2CXFA 1E1HB 1HG5A 1N34T 4P0AA 1X79A 3OJAA 2D2SA 1KNZA 5JDMA 2K5BB 5FY7A 5L3BB 4DV6T 3X1DA 5AQRB 4TQUN 1WR0A 4DIDB 1XMOT 5KMGP 2B76A 3RIAA 5FY1A 4BAYB 1Y01A 3L39A 5L4HA 1NAFA 3IA3A 4Z8XA 3U78A 1YQ4A 2EHOA 2HHHT 2BG9B 4YY3T 5AQSB 3CIRA 2BS2A 2WMNA 2CCQA 3JAEA 2BS3A 3NRXA 1UCUA 3SWHA 1KF6A 2D9DA 2CEAA 1QLBA 4YFSA 4UEMA 4P1NA 1MIWA 2UUBT 3IF8B 4KHZF 4ZS2A 5JVDE 4JYAT 3PJAA 2NTXA 4GOUA 1W0BA 1UK5A 3VKHA 4JI7T 5FP3A 2KWHA 4DV4T 2FJEA 4I50E 3ONXA 4IDOA 2DWGA 1YQ3A 3N9MA 4YSXA 2Q9QD 2IHR1 4DO0A 5J1GA 4P0BA 1T72A 5M4YA 4BJMA 1YKEB 1EZ3A 2G0UA 2WCAA 4FI5A 4YMVC 2JIWA 3PUWF 3N9PA 2PTFA 4QX8B 1OEDE 2NW8A 5F5WA 2HPLA 3ZMSB 2H7VC 3UUXB 4UXNB 2WS3A 2E9XA 3N9QA 4A5XA 2XHEB 4ZI7E 3UU4A 3PUYF 2NW9A 1G73A 3AAEB 3P4QA 2PG8A 2W00A 4IDNA 4YMWC 4DV5T 3FZHB 2LSGA 3ETVA 4H63V 2W66A 4DMWA 2XTLA 1J5WA 4O4JE 3RYIE 2CPTA 2XZEA 3OVUA 4I43B 3JC6C 4TWHA 5FL0A 2WQYA 3F31A 2L3LA 3TUZA 3AE7A 4ISTA 2UXBT 3RQUA 4TWDA 2XM2A 4IL4A 1XNRT 3FXDB 5L4EA 3BQLA 3KDSE 2XQ5A 1N32T 4TV9E 4PK6A 5J0ZA 2NR4A 4XIGN 2FJDA 3ZT5A 3MA9A 3OTOT 2RP4A 5AQTB 4HFVA 2WY2A 3A7MA 1D0ZA 4UVAB 1LVKA 4TX5A 3QK6A 3AA7B 3UU3A 4MFRA 4N78D 3J7Yq 4G2AA 4BA9A 3RYHE 4DV7T 4H63H 5C2TA 1OXZA 1YXRA 2W0GA 3P50A 1SE7A 3QOFA 2ZMAA 3ZC1A 3PUVF 2CLYB 5DABA 5LYJE 4PW8A 4CXYA 3PV0F 2FBWA 5ABFB 4LFAT 3IBPA 4EOZB 2FJAA 3AVRA 2UXXB 2YK0A 5FXWA 2FUPA 4EGWA 4KHZG 3ABVA 2XQ7A 1JNRA 2VL0A 2LSJA 2CM0A 2MYSA 1WFDA 1O3XA 4K0UA 3AEGA 4EB6E 2BG9C 2Y6XA 3O9XA 3Q2MA 3LBXB 4H9OC 4UIGA 2UXDT 4HFCA 1SA0E 3N9OA 2DL1A 3B13A 2LEHA 3EVYA 4YHHT 5J2TE 2WAUA 3IHRA 3LK2B 4DV2T 3E22E 1WR6A 3ZSSA 2WP9A 3LK3B 2JJ9A 2H3RA 2V7IA 2I0MA 3L8RA 1ZKEA 2BG9A 1D0YA 4ZS3A 1E2AA 4AKRB 2XY8B 4QH4A 3CX8B 2VQET 4IL9A 3NRYA 2V26A 2WB5A 5AQHB 1JNZA 4O8SA 3VRBA 4GIWA 2QYWA 3WI3A 3ZYLA 3LFMA 3CQGB 3N2KE 3AE2A 3PUZF 4HFBA 3RYFE 1W09A 5TAOA 1V9DA 5EK4A 3EABA 2QVAA 5EK2A 1VOMA 3RYCE 5AQMB 4CQIA 2X0LB 1B7TA 1E7PA 2E8IA 4Z90A 4NUUA 2C5KT 2XSBA 4L5GA 5HEUA 2XAFB 2YOEA 4UF0B 2AXDS 2WWVA 1HR0T 4LMLA 2LOSA 3ZLIA 2A72A 2VL8A 4JV5T 1UURA 4EXTA 1H7CA 2L8KA 3C4WA 3KVAA 4EIWA 4LFCT 2V6YA 4K0KT 4ZHQE 4X62T 3EHZA 3Q5EA 3AEBA 2K3WA 2X67A 4UV9B 2VVSA 3HL6A 5L3EB 3CPZA 5IHYA 2D0TA 3W15B 4U2YA 3CQCB 3VHLA 1XZYA 1UUSA 4IIJE 2Q9QB 4YHJA 3VR8A 2D5UA 4JI5T 5CA1E 3ZT6A 5JDQA 1Z0PA 5JRCA 4ASKA 4YJ3E 1YKHB 5FVLA 3EUHA 4IDQA 3UT5E 4H9NC 4UR9A 5LBQB 1KFYA 4ZI3C 2LE8A 4YLHA 5LBMA 5CA0E 4KBMB 4V1Av 2IC9A 3PV0G 3OKQA 3F2EA 3C51A 2JPFA 1VCSA 4X66T 2K48A 2BBHA 2ZM2A 5DJQC 3S4UA 2XM1A 3PE0A 3DHWA 5A1LA 3ANWA 4ZI2C 4JBWG 4TN7B 1LKXA 4EZ4A 5L3CB 2Y8DA 2MPKA 5EZYE 2A9UA 2ACXA 2MBGA 4CXWA 4TZ4C 3SRZA 2EHOD 1BR1A 3UQ7A 3UU6A 3G06A 5HXSA 2M6IA 3R6NA 4E7ZA 3K8PC 4X1KE 2CLYC 4P09A 2X9HA 3QB5K 3RF1A 3AXJA 3TLVA 2ZM0A 1I94T 4B3TT 3HKEE 2CXLA 4WBNE 4IHJE 2IMLA 3NVOA 3KBTA 4QXCB 2BVMA 2CRBA 2IC6A 2VKDA 1IAPA 1OEDC 2IAKA 3RQWA 5FL1A 3NBXX 3Q5DA 4CN6A 1Y64B 3KVBA 5LMNT 2R6GG 4COFA 4O2AE 1WYBA 5FVKA 4JLEA 2YKSA 1S35A 2NW7A 2XQ3A 3C50A 1XNQT 3M65A 4CI3B 2KZ7B 3SS1A 2W67A 1HNWT 3TLUA 2LHRA 3PUZG 3RC8A 4ILBA 1OEDA 3IEEA 3DTOA 3H3AA 3UFEA 1KNPA 3GMIA 4ADZA 4YTMA 3HKCE 3KV4A 2A2FX 3D0TA 2JRKA 4QXHB 1D0XA 2PFVA 4PJMA 4JI3T 1ZV4X 3RRCA 3ZJ2A 5HEHA 3GN5B 5LGUB 3BQIA 2WMOA 4Q25A 3AEAA 2I59A 2E9XD 4KUMB 4KI0F 3UQ4A 5IUXA 2BBJA 2BDEA 2VKOA 3VU7H 4KMCA 3ZYMA 2XQ6A 4U74A 4XTCM 4YMSC 5AQIB 3LJCA 3R84B 3TUIA 2LSYA 5FMNA 4QH5A 4I4TE 4EYUA 3KFWX 4WBOA 2KXPB 1LVFA 3QC9A 2KMFA 2LSIA 3LK42 3ZMUB 4JI1T 2F4VT 2XAHB 4PJLA 2V5DA 2WU5A 5LHGB 3RC3A 3DP7A 2BKNA 1YD8G 3HI2A 3Q9DA 4B6XA 3AECA 2H88A 5HYAA 3PUAA 4JI6T 3LSVA 4CXXA 2XAGB 3CKDA 1IZNB 3CVRA 5LJNA 2Q9QC 3JC6D 2CA5A 1I6ZA 4O4LE 4XAXB 2LKGA 1U4QA 2D0UA 3D31C 3FHNA 2MOZA 4QX7B 3AE3A 4DNDA 5JR9B 2E2AA 3FZMB 5LCYA 3VRAA 2N1GA 4JI4T 2XQ9A 3V5UA 2CHNA 4KP3C 1US7B 3AAIA 3KV6A 2XPKA 3I9WA 5GONE 2KWIB 5JDNA 4XZCA 5CFBA 3NWIA 2KSRA 2LM2A 1ZP0A 3E0ZA 3O1JA 4HN9A 3JADA 2CBJA 1LRZA 2W4XA 1R8IA 3C98B 4NIQA 5LG3A 4IE0A 3UUMA 3UUBA 2XAJB 4HWFA 4DBQA 1J5ET 5ETWA 5BR8T 3I0OA 1IBMT 4PJNA 4EEDA 2JMKA 5BMVE 2OLTA 4HE8A 4JEHB 2WDVA 3UU5A 2DI4A 5AQPB 2WM9A 4UVCB 5E0OA 2JQQA 2BS4A 3LDQB 3N2GE 5FY0A 2NP9A 1D1AA 4GKJT 4KHPT 2UU9T 4MHCA 3QNUA 1KEYA 2M67A 4GYRA 3FXEB 5AQGB 5LB7B 4X64T 4O4HE 2JQHA 4KI0G 2EHOB 4OFZA 5L3GB 4JI2T
chains in the Genus database with same CATH topology
4YMSC 2ONKC 4KHZF 4XIGN 4KHZG 2R6GG 4JBWF 3TUIA 3RLFF 3DHWA 4YMVC 3PUYF 4XTCN 4JBWG 4TQUN 3RLFG 3PUXF 4YMTB 3PUYG 3PUVF 4KI0F 3PUWF 3PUXG 4XTCM 4XIGM 4KI0G 3PUVG 3PV0F 3PUWG 3D31C 3TUJA 3TUZA 3PV0G 3PUZF 4YMWC 4YMUC 3PUZG 2R6GF 4TQUM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMS C;  2ONK C;  4KHZ F;  4XIG N;  4KHZ G;  2R6G G;  4JBW F;  3TUI A;  3RLF F;  3DHW A;  4YMV C;  3PUY F;  4XTC N;  4JBW G;  4TQU N;  3RLF G;  3PUX F;  4YMT B;  3PUY G;  3PUV F;  4KI0 F;  3PUW F;  3PUX G;  4XTC M;  4XIG M;  4KI0 G;  3PUV G;  3PV0 F;  3PUW G;  3D31 C;  3TUJ A;  3TUZ A;  3PV0 G;  3PUZ F;  4YMW C;  4YMU C;  3PUZ G;  2R6G F;  4TQU M; 
#chains in the Genus database with same CATH topology
 3N2O A;  3GA8 A;  3SFE A;  3RH3 A;  4DV0 T;  5FXX A;  3FZK B;  2DHR A;  3AED A;  4U3C A;  3AE9 A;  2Z6E A;  2E5V A;  3N9L A;  4PJJ A;  2BVL A;  3O1H A;  4CI2 B;  2LJL A;  4MAL A;  1U5P A;  1M62 A;  1VCT A;  2DNX A;  5CGM A;  1BR0 A;  2YIN A;  3VR9 A;  3NZQ A;  3ZMZ B;  2CXD A;  1HNZ T;  5KX5 E;  3PUW G;  4O4I E;  2AE9 A;  3K3Q C;  4UEL A;  4U31 A;  2QGS A;  3RIU C;  1FMV A;  3SOL A;  4M1P A;  3P4W A;  4I0U A;  2I6H A;  1XDO A;  3RIF A;  3RLF F;  4PK4 A;  5HXH A;  4IDZ A;  3E08 A;  5HCJ A;  3F57 A;  5F3J A;  1YW0 A;  4PFP A;  4YMT B;  4WYV A;  3PUY G;  3PUR A;  2VKH A;  1T98 A;  3ZKR A;  3GN5 A;  4DR3 T;  4TNW A;  3NZP A;  4YMU C;  5FXZ A;  2WZI A;  4U33 A;  3KV5 A;  2CE7 A;  1QSD A;  3UU8 A;  3P4R A;  5HXC A;  2YEV C;  4LF7 T;  3KBU A;  3B5M A;  2LRL A;  4AKL A;  3ZMT B;  3RIU A;  2K24 A;  1N33 T;  3I9Y A;  4ERR A;  2JQK A;  5ABE A;  5JTG A;  5AQK B;  4HWI B;  4DR2 T;  5LNK A;  2E9X B;  4DV1 T;  3CK6 A;  3AA6 B;  3EDV A;  4NUV A;  4QKN A;  3ONJ A;  3KIN B;  4ILC A;  3L3P A;  3P7I A;  1FJG T;  5HXR A;  1SHZ C;  2XAS B;  3ZT7 A;  2PJQ A;  4YTP A;  4AI6 A;  2X66 A;  5JR9 C;  4DR6 T;  3AE4 A;  1KNR A;  4QXB B;  2SPC A;  1HX1 B;  3EAM A;  3M3Z B;  2ES0 A;  3UUL A;  4OYJ A;  4ZI3 D;  4DR1 T;  4DR4 T;  5AQJ B;  5L2L A;  5DQV A;  2YN6 A;  5C8Y E;  4TQU M;  2MTQ A;  4B3M T;  2B1E A;  4OYK A;  4AQF C;  4ZI2 D;  3T8O A;  3AA0 B;  2N2N A;  4U7Y A;  3PUV G;  2XUE A;  5JR9 A;  3TUJ A;  2YU1 A;  5L47 A;  1HG2 A;  2XJ7 A;  5JDG A;  1VRB A;  4LF8 T;  2LM9 A;  4WNK A;  5AFU L;  1MMA A;  3ZCI A;  3FBZ A;  5AQN B;  5AQQ B;  2J47 A;  3HA4 A;  3RGL A;  1HX8 A;  4GKK T;  4AIU A;  5HEG A;  2M6B A;  4AQF A;  1N36 T;  2UUC T;  4YXD A;  4B3S T;  4A97 A;  3PUG A;  3T1H T;  4X20 E;  3ONL C;  4GK0 E;  2LRK A;  4UVB B;  2V1D B;  4U72 A;  5IYZ E;  2HN1 A;  3N9N A;  3O4X E;  4HGA A;  4O2B E;  1J1J A;  2C5J A;  5HWY A;  4QWN B;  1D1C A;  3MK7 C;  2Y48 B;  2XQ8 A;  3AEE A;  4NPP A;  4JUY A;  5HEO A;  4EYY R;  4ZZB A;  3I0Q A;  3MXZ A;  2EHO C;  2V6X A;  4IGU A;  5LMU T;  2HN2 A;  2XQA A;  4EAH A;  3FBL A;  5JH7 E;  4IRE A;  3TLS A;  2WDQ A;  3CWZ B;  4AQG A;  3RLF G;  1WRD A;  1W0A A;  2V5C A;  5ABF A;  2CMR A;  2CHO A;  1ZEE A;  4XBF B;  5LJM A;  4PNI A;  3K3N A;  4X1Y E;  2FJB A;  4LF9 T;  3AE5 A;  4HEA A;  4AQY T;  4L9I A;  1HFA A;  2A3D A;  1HTJ F;  2BKO A;  4U2Z A;  1L0V A;  2NTY A;  2DCF A;  3LBX A;  4ZZC A;  2LT3 A;  2KLQ A;  2MAW A;  4TNV A;  5JDL A;  2X68 A;  2BKP A;  4WW0 A;  5HCM A;  3HR0 A;  3AE6 A;  5L3D B;  4NXN T;  5IWA T;  3QB5 A;  1BR2 A;  3O1I A;  4NXM T;  1MIV A;  3ZJ1 A;  3DJB A;  1FEW A;  3TLT A;  5HAX A;  3SFD A;  2J1D G;  2OA5 A;  1WCR A;  4OX9 T;  5JDH A;  2ZM6 T;  4HTE A;  3P8C D;  3MZK B;  2VKJ A;  4DV3 T;  2QRX A;  3ZMV B;  2UXC T;  3UTK A;  5FXV A;  1G8X A;  4MBQ A;  3N5L A;  3PUS A;  4TUY E;  2WWU A;  4EV6 A;  4H9Q C;  4F6R C;  5LHH B;  4CZZ B;  2E9X C;  3P4P A;  4XIG M;  5JRE A;  2C5I T;  2V7M A;  3PUQ A;  2RA1 A;  2V6Y B;  5H6Q B;  4WZX A;  2XAQ B;  1OWA A;  3T1Y T;  1ZOY A;  2ZLY A;  2LLY A;  2YDS A;  1MNE A;  3NKZ A;  2QA7 A;  1S94 A;  4PAG A;  3JCF A;  3CX6 B;  3HKD E;  2XSA A;  2ODV A;  1DU2 A;  3AEF A;  4EZH A;  2V7K A;  2N9D A;  4UF0 A;  3H37 A;  5JQG E;  5JRC B;  2BZB A;  2WDR A;  2J4G A;  4HFH A;  2H7O A;  2CBI A;  4U7I A;  3PUX F;  1Z8U A;  5LXT E;  2W2U A;  5DQW A;  1NEK A;  3RI5 A;  2J62 A;  1MMG A;  4HWH A;  1HS7 A;  3Q5W A;  2LSK A;  3OYZ A;  4ZXL A;  4IE4 A;  5LHI B;  5EK3 A;  4YT0 A;  2X9X A;  2Q9Q A;  2HH7 A;  3PU3 A;  4G63 A;  2VUR A;  4XTC N;  1KK7 A;  4DUZ T;  1CHU A;  5FYM A;  5AQF B;  5LA6 E;  3ANW B;  5H6R B;  2KIN B;  4A56 A;  5J2U E;  4BJN A;  2RPA A;  5FKY A;  3FB2 A;  3UUN A;  5C3J A;  5LG4 A;  2X0Y A;  4DR5 T;  4OHF A;  1WLX A;  3BQK A;  3ESL A;  3AE8 A;  2XQ4 A;  3K1S A;  5AQO B;  2WSS V;  3MAC A;  1XMQ T;  4LFB T;  3K3O A;  4CN4 A;  1UX4 A;  3AAA B;  4YSY A;  2VK9 A;  3AXJ B;  5LOV E;  4C91 A;  2W63 A;  4DR7 T;  4HFD A;  3EI0 A;  3C4X A;  4CN1 A;  5LGN B;  3C4Z A;  5LGT B;  1CUN A;  2K9A A;  4JI0 T;  4GK5 E;  4J2C A;  4IE5 A;  1NEN A;  3PU8 A;  3FZF B;  2VQF T;  2UUA T;  2X51 A;  4AKH A;  2V8S V;  4X5T A;  3L09 A;  5ADX L;  3HKB E;  2IUB A;  2VVN A;  1MND A;  2NOX A;  5KDM C;  1GQE A;  2PBI A;  2VB6 A;  2ONK C;  5ABG A;  1T7S A;  4JBW F;  2ACZ A;  4LMJ A;  4LF6 T;  5JDF A;  4AKI A;  3J9X 1;  4LMK A;  1OED B;  3C64 A;  5F8P A;  3TLW A;  3PJA J;  3ZN1 B;  4B3R T;  3ETU A;  4HFE A;  2LKH A;  3CX7 B;  5AQU B;  4JI8 T;  4FJO A;  4HKA A;  3QUJ A;  3ZCJ A;  3MKD A;  4IDP A;  5HXE A;  3RRW A;  3CQX C;  2CWY A;  4AIS A;  3V5S A;  4EEB A;  2WBL A;  1MMN A;  4TWF A;  1HF8 A;  3PDY A;  5AQV B;  4E7S A;  2IIU A;  3VKG A;  3KV9 A;  3I1A A;  1M7K A;  3BK9 A;  3JAF A;  4DMV A;  4MLK A;  5ABH A;  4PFO A;  5L3F B;  4X65 T;  3AB3 B;  2JQ9 A;  2R6G F;  5AQL B;  2OV9 A;  2VWA A;  3ZEF B;  3ZN0 B;  3U3I A;  4ISS A;  4Z91 A;  3RKO A;  1IJ6 A;  2JMH A;  4LF5 T;  4YSZ A;  4ILA A;  3PUX G;  4TV8 E;  1UGO A;  3ZST A;  4IE7 A;  4IE6 A;  1HNX T;  4GYS A;  1IJ5 A;  2DLR A;  4DBR A;  2X0H A;  4QH1 A;  4AKG A;  2WU2 A;  2KND A;  4ILU A;  3WAJ A;  3OYX A;  3OBV E;  1WYC A;  1ZHC A;  3AVS A;  3GWH A;  2W61 A;  3RX6 A;  2P9B A;  3FZL B;  2X9W A;  4LF4 T;  2LOP A;  2DWK A;  1IBL T;  4KX6 A;  4PK5 A;  1XWM A;  4QHO A;  2V7L A;  2VAS A;  1QUU A;  3AE1 A;  4I55 E;  2V7J A;  5HEJ A;  5HWX A;  1T8B A;  2X9Y A;  1W9R A;  2HPJ A;  2BG9 E;  2IDO B;  5KXJ A;  4H9R C;  3H3M A;  2ZM8 A;  4A98 A;  2YU2 A;  1NWM X;  5FNV E;  1SUM B;  3WAK A;  3OPC A;  5LP6 E;  1XDP A;  2KT9 A;  1AJ3 A;  2NWB A;  4L0R A;  3LG7 A;  4ZEY A;  1MMD A;  3P4S A;  3TKL B;  2W62 A;  4IT4 A;  4X1I E;  3RHW A;  3UFG A;  4H9P C;  3RPU A;  3A5X A;  4OK0 A;  1IBK T;  1X9B A;  3B57 A;  1MIY A;  3ZC0 A;  4C90 A;  4ANJ A;  2XQY A;  4YTN A;  4HWC A;  2ODU A;  2L9Q A;  1FMW A;  2WZH A;  4ZOL E;  5CB4 E;  4H9S E;  3ZYK A;  4DVD A;  4F8H A;  4HFI A;  2C0S A;  2UXN B;  2YDR A;  3EDU A;  2E5L T;  3RKG A;  2H89 A;  1FIO A;  2CWO A;  4DUY T;  4CI1 B;  1BR4 A;  4HWD A;  1D1B A;  2IW5 B;  3AA1 B;  3Q5X A;  3CML A;  1HCI A;  3MJX A;  2LHN A;  5CJ5 A;  4UV8 B;  4AXP A;  2GK9 A;  3ZPO A;  4YJ2 E;  3PTR B;  1UX5 A;  3A8Y C;  2YDQ A;  4JEU B;  2CXF A;  1E1H B;  1HG5 A;  1N34 T;  4P0A A;  1X79 A;  3OJA A;  2D2S A;  1KNZ A;  5JDM A;  2K5B B;  5FY7 A;  5L3B B;  4DV6 T;  3X1D A;  5AQR B;  4TQU N;  1WR0 A;  4DID B;  1XMO T;  5KMG P;  2B76 A;  3RIA A;  5FY1 A;  4BAY B;  1Y01 A;  3L39 A;  5L4H A;  1NAF A;  3IA3 A;  4Z8X A;  3U78 A;  1YQ4 A;  2EHO A;  2HHH T;  2BG9 B;  4YY3 T;  5AQS B;  3CIR A;  2BS2 A;  2WMN A;  2CCQ A;  3JAE A;  2BS3 A;  3NRX A;  1UCU A;  3SWH A;  1KF6 A;  2D9D A;  2CEA A;  1QLB A;  4YFS A;  4UEM A;  4P1N A;  1MIW A;  2UUB T;  3IF8 B;  4KHZ F;  4ZS2 A;  5JVD E;  4JYA T;  3PJA A;  2NTX A;  4GOU A;  1W0B A;  1UK5 A;  3VKH A;  4JI7 T;  5FP3 A;  2KWH A;  4DV4 T;  2FJE A;  4I50 E;  3ONX A;  4IDO A;  2DWG A;  1YQ3 A;  3N9M A;  4YSX A;  2Q9Q D;  2IHR 1;  4DO0 A;  5J1G A;  4P0B A;  1T72 A;  5M4Y A;  4BJM A;  1YKE B;  1EZ3 A;  2G0U A;  2WCA A;  4FI5 A;  4YMV C;  2JIW A;  3PUW F;  3N9P A;  2PTF A;  4QX8 B;  1OED E;  2NW8 A;  5F5W A;  2HPL A;  3ZMS B;  2H7V C;  3UUX B;  4UXN B;  2WS3 A;  2E9X A;  3N9Q A;  4A5X A;  2XHE B;  4ZI7 E;  3UU4 A;  3PUY F;  2NW9 A;  1G73 A;  3AAE B;  3P4Q A;  2PG8 A;  2W00 A;  4IDN A;  4YMW C;  4DV5 T;  3FZH B;  2LSG A;  3ETV A;  4H63 V;  2W66 A;  4DMW A;  2XTL A;  1J5W A;  4O4J E;  3RYI E;  2CPT A;  2XZE A;  3OVU A;  4I43 B;  3JC6 C;  4TWH A;  5FL0 A;  2WQY A;  3F31 A;  2L3L A;  3TUZ A;  3AE7 A;  4IST A;  2UXB T;  3RQU A;  4TWD A;  2XM2 A;  4IL4 A;  1XNR T;  3FXD B;  5L4E A;  3BQL A;  3KDS E;  2XQ5 A;  1N32 T;  4TV9 E;  4PK6 A;  5J0Z A;  2NR4 A;  4XIG N;  2FJD A;  3ZT5 A;  3MA9 A;  3OTO T;  2RP4 A;  5AQT B;  4HFV A;  2WY2 A;  3A7M A;  1D0Z A;  4UVA B;  1LVK A;  4TX5 A;  3QK6 A;  3AA7 B;  3UU3 A;  4MFR A;  4N78 D;  3J7Y q;  4G2A A;  4BA9 A;  3RYH E;  4DV7 T;  4H63 H;  5C2T A;  1OXZ A;  1YXR A;  2W0G A;  3P50 A;  1SE7 A;  3QOF A;  2ZMA A;  3ZC1 A;  3PUV F;  2CLY B;  5DAB A;  5LYJ E;  4PW8 A;  4CXY A;  3PV0 F;  2FBW A;  5ABF B;  4LFA T;  3IBP A;  4EOZ B;  2FJA A;  3AVR A;  2UXX B;  2YK0 A;  5FXW A;  2FUP A;  4EGW A;  4KHZ G;  3ABV A;  2XQ7 A;  1JNR A;  2VL0 A;  2LSJ A;  2CM0 A;  2MYS A;  1WFD A;  1O3X A;  4K0U A;  3AEG A;  4EB6 E;  2BG9 C;  2Y6X A;  3O9X A;  3Q2M A;  3LBX B;  4H9O C;  4UIG A;  2UXD T;  4HFC A;  1SA0 E;  3N9O A;  2DL1 A;  3B13 A;  2LEH A;  3EVY A;  4YHH T;  5J2T E;  2WAU A;  3IHR A;  3LK2 B;  4DV2 T;  3E22 E;  1WR6 A;  3ZSS A;  2WP9 A;  3LK3 B;  2JJ9 A;  2H3R A;  2V7I A;  2I0M A;  3L8R A;  1ZKE A;  2BG9 A;  1D0Y A;  4ZS3 A;  1E2A A;  4AKR B;  2XY8 B;  4QH4 A;  3CX8 B;  2VQE T;  4IL9 A;  3NRY A;  2V26 A;  2WB5 A;  5AQH B;  1JNZ A;  4O8S A;  3VRB A;  4GIW A;  2QYW A;  3WI3 A;  3ZYL A;  3LFM A;  3CQG B;  3N2K E;  3AE2 A;  3PUZ F;  4HFB A;  3RYF E;  1W09 A;  5TAO A;  1V9D A;  5EK4 A;  3EAB A;  2QVA A;  5EK2 A;  1VOM A;  3RYC E;  5AQM B;  4CQI A;  2X0L B;  1B7T A;  1E7P A;  2E8I A;  4Z90 A;  4NUU A;  2C5K T;  2XSB A;  4L5G A;  5HEU A;  2XAF B;  2YOE A;  4UF0 B;  2AXD S;  2WWV A;  1HR0 T;  4LML A;  2LOS A;  3ZLI A;  2A72 A;  2VL8 A;  4JV5 T;  1UUR A;  4EXT A;  1H7C A;  2L8K A;  3C4W A;  3KVA A;  4EIW A;  4LFC T;  2V6Y A;  4K0K T;  4ZHQ E;  4X62 T;  3EHZ A;  3Q5E A;  3AEB A;  2K3W A;  2X67 A;  4UV9 B;  2VVS A;  3HL6 A;  5L3E B;  3CPZ A;  5IHY A;  2D0T A;  3W15 B;  4U2Y A;  3CQC B;  3VHL A;  1XZY A;  1UUS A;  4IIJ E;  2Q9Q B;  4YHJ A;  3VR8 A;  2D5U A;  4JI5 T;  5CA1 E;  3ZT6 A;  5JDQ A;  1Z0P A;  5JRC A;  4ASK A;  4YJ3 E;  1YKH B;  5FVL A;  3EUH A;  4IDQ A;  3UT5 E;  4H9N C;  4UR9 A;  5LBQ B;  1KFY A;  4ZI3 C;  2LE8 A;  4YLH A;  5LBM A;  5CA0 E;  4KBM B;  4V1A v;  2IC9 A;  3PV0 G;  3OKQ A;  3F2E A;  3C51 A;  2JPF A;  1VCS A;  4X66 T;  2K48 A;  2BBH A;  2ZM2 A;  5DJQ C;  3S4U A;  2XM1 A;  3PE0 A;  3DHW A;  5A1L A;  3ANW A;  4ZI2 C;  4JBW G;  4TN7 B;  1LKX A;  4EZ4 A;  5L3C B;  2Y8D A;  2MPK A;  5EZY E;  2A9U A;  2ACX A;  2MBG A;  4CXW A;  4TZ4 C;  3SRZ A;  2EHO D;  1BR1 A;  3UQ7 A;  3UU6 A;  3G06 A;  5HXS A;  2M6I A;  3R6N A;  4E7Z A;  3K8P C;  4X1K E;  2CLY C;  4P09 A;  2X9H A;  3QB5 K;  3RF1 A;  3AXJ A;  3TLV A;  2ZM0 A;  1I94 T;  4B3T T;  3HKE E;  2CXL A;  4WBN E;  4IHJ E;  2IML A;  3NVO A;  3KBT A;  4QXC B;  2BVM A;  2CRB A;  2IC6 A;  2VKD A;  1IAP A;  1OED C;  2IAK A;  3RQW A;  5FL1 A;  3NBX X;  3Q5D A;  4CN6 A;  1Y64 B;  3KVB A;  5LMN T;  2R6G G;  4COF A;  4O2A E;  1WYB A;  5FVK A;  4JLE A;  2YKS A;  1S35 A;  2NW7 A;  2XQ3 A;  3C50 A;  1XNQ T;  3M65 A;  4CI3 B;  2KZ7 B;  3SS1 A;  2W67 A;  1HNW T;  3TLU A;  2LHR A;  3PUZ G;  3RC8 A;  4ILB A;  1OED A;  3IEE A;  3DTO A;  3H3A A;  3UFE A;  1KNP A;  3GMI A;  4ADZ A;  4YTM A;  3HKC E;  3KV4 A;  2A2F X;  3D0T A;  2JRK A;  4QXH B;  1D0X A;  2PFV A;  4PJM A;  4JI3 T;  1ZV4 X;  3RRC A;  3ZJ2 A;  5HEH A;  3GN5 B;  5LGU B;  3BQI A;  2WMO A;  4Q25 A;  3AEA A;  2I59 A;  2E9X D;  4KUM B;  4KI0 F;  3UQ4 A;  5IUX A;  2BBJ A;  2BDE A;  2VKO A;  3VU7 H;  4KMC A;  3ZYM A;  2XQ6 A;  4U74 A;  4XTC M;  4YMS C;  5AQI B;  3LJC A;  3R84 B;  3TUI A;  2LSY A;  5FMN A;  4QH5 A;  4I4T E;  4EYU A;  3KFW X;  4WBO A;  2KXP B;  1LVF A;  3QC9 A;  2KMF A;  2LSI A;  3LK4 2;  3ZMU B;  4JI1 T;  2F4V T;  2XAH B;  4PJL A;  2V5D A;  2WU5 A;  5LHG B;  3RC3 A;  3DP7 A;  2BKN A;  1YD8 G;  3HI2 A;  3Q9D A;  4B6X A;  3AEC A;  2H88 A;  5HYA A;  3PUA A;  4JI6 T;  3LSV A;  4CXX A;  2XAG B;  3CKD A;  1IZN B;  3CVR A;  5LJN A;  2Q9Q C;  3JC6 D;  2CA5 A;  1I6Z A;  4O4L E;  4XAX B;  2LKG A;  1U4Q A;  2D0U A;  3D31 C;  3FHN A;  2MOZ A;  4QX7 B;  3AE3 A;  4DND A;  5JR9 B;  2E2A A;  3FZM B;  5LCY A;  3VRA A;  2N1G A;  4JI4 T;  2XQ9 A;  3V5U A;  2CHN A;  4KP3 C;  1US7 B;  3AAI A;  3KV6 A;  2XPK A;  3I9W A;  5GON E;  2KWI B;  5JDN A;  4XZC A;  5CFB A;  3NWI A;  2KSR A;  2LM2 A;  1ZP0 A;  3E0Z A;  3O1J A;  4HN9 A;  3JAD A;  2CBJ A;  1LRZ A;  2W4X A;  1R8I A;  3C98 B;  4NIQ A;  5LG3 A;  4IE0 A;  3UUM A;  3UUB A;  2XAJ B;  4HWF A;  4DBQ A;  1J5E T;  5ETW A;  5BR8 T;  3I0O A;  1IBM T;  4PJN A;  4EED A;  2JMK A;  5BMV E;  2OLT A;  4HE8 A;  4JEH B;  2WDV A;  3UU5 A;  2DI4 A;  5AQP B;  2WM9 A;  4UVC B;  5E0O A;  2JQQ A;  2BS4 A;  3LDQ B;  3N2G E;  5FY0 A;  2NP9 A;  1D1A A;  4GKJ T;  4KHP T;  2UU9 T;  4MHC A;  3QNU A;  1KEY A;  2M67 A;  4GYR A;  3FXE B;  5AQG B;  5LB7 B;  4X64 T;  4O4H E;  2JQH A;  4KI0 G;  2EHO B;  4OFZ A;  5L3G B;  4JI2 T; 
#chains in the Genus database with same CATH homology
 4YMS C;  2ONK C;  4KHZ F;  4XIG N;  4KHZ G;  2R6G G;  4JBW F;  3TUI A;  3RLF F;  3DHW A;  4YMV C;  3PUY F;  4XTC N;  4JBW G;  4TQU N;  3RLF G;  3PUX F;  4YMT B;  3PUY G;  3PUV F;  4KI0 F;  3PUW F;  3PUX G;  4XTC M;  4XIG M;  4KI0 G;  3PUV G;  3PV0 F;  3PUW G;  3D31 C;  3TUJ A;  3TUZ A;  3PV0 G;  3PUZ F;  4YMW C;  4YMU C;  3PUZ G;  2R6G F;  4TQU M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...