3PUXF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 151
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puxF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puxF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puxF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puxF02
4YMVC 4JBWF 4JBWG 4KI0G 3PUXG 3PUYF 4TQUN 3PUZG 3PUWF 2R6GG 3RLFF 3RLFG 3PUZF 3PUWG 4YMUC 4KI0F 4YMTB 3DHWA 2ONKC 4TQUM 4XTCN 4YMSC 3PV0G 3PUYG 4KHZG 3TUZA 3PV0F 3TUIA 4XIGN 3PUVG 4XTCM 3PUXF 4KHZF 3D31C 3PUVF 3TUJA 2R6GF 4YMWC 4XIGM
chains in the Genus database with same CATH superfamily
4P0AA 3OVUA 4HFVA 4IDPA 3EUHA 4KI0G 1LKXA 5HCMA 5FL1A 1DU2A 2NWBA 2CHOA 4YTNA 2PBIA 3HKDE 4ZI7E 3CKDA 2ACZA 2NR4A 4OK0A 1MNEA 2WWVA 5J0ZA 3L39A 4ZXLA 3RIAA 2D5UA 2BS4A 3ETVA 5LGTB 1X79A 2FUPA 2VVNA 4XTCN 2C0SA 2IMLA 2JQ9A 3DJBA 3ONXA 2XAFB 3PJAJ 4ZOLE 3PUYG 1IJ6A 3DP7A 4ZS3A 5HEHA 5FXWA 3MJXA 4IE7A 3UFEA 5CA0E 2YU1A 3AE8A 3ZSTA 4X62T 3P8CD 2G0UA 5L4EA 1I94T 5L3BB 2LLYA 2X0YA 4DR4T 4O4IE 2N2NA 2H7OA 5CGMA 3RH3A 2WDVA 3AXJA 4WNKA 4EEDA 3UU4A 5L3GB 2VL0A 3HI2A 4E7ZA 1IBLT 5LBMA 4TZ4C 2W61A 2YDQA 3H37A 4AXPA 4DV0T 1AJ3A 2CHNA 2Q9QB 2R6GF 1OEDE 2D0UA 4HFHA 3O4XE 3SS1A 3C4ZA 5LYJE 3PUGA 4O8SA 5KDMC 4DV4T 4NPPA 2KWHA 3CVRA 2WMNA 4QXHB 2K3WA 4TQUN 1U4QA 3PUZG 2E9XB 2XSAA 3AAEB 4IDOA 4IL4A 3RLFG 2NP9A 4DR3T 3WAJA 4YHHT 4OX9T 4DR6T 3ZT5A 4Z8XA 5IWAT 4ZI3C 1HX1B 1UK5A 3CX8B 2A3DA 1S35A 2XPKA 2XM2A 5HEOA 2IW5B 5ABFA 3NRXA 4IL9A 3NZQA 2EHOD 5HEGA 4DMWA 4O4LE 1KEYA 4H9OC 4PJNA 4U72A 4LF4T 2BVMA 1D1BA 4DR1T 1XMQT 2XAHB 2DCFA 3N9OA 3QB5A 5FXZA 2D0TA 2A9UA 3HA4A 3AE4A 3MXZA 2XQ7A 3PUVG 2DNXA 3KV9A 4XTCM 1T72A 2V7JA 3RI5A 3RRCA 5EZYE 2LSYA 2CBJA 3AEEA 2CRBA 3AEFA 2LM9A 1UGOA 2C5JA 2CWOA 3N9NA 5KXJA 4JEHB 5LG4A 3I0OA 1W0BA 4YMWC 2VKDA 2WS3A 5J2UE 2WWUA 4GYSA 1KNPA 3AE2A 3LK42 4NUVA 2XUEA 2K24A 3RHWA 3Q5WA 2EHOA 2Y48B 4OYKA 5JDFA 4COFA 4HN9A 2Q9QA 1I6ZA 4CN6A 2LSKA 4YTMA 4TN7B 2LM2A 3TLSA 2WP9A 4KHPT 2CLYB 2CM0A 2KINB 3QOFA 1NEKA 3PUQA 5F3JA 2ZMAA 5AQJB 1W09A 4ZZBA 2MAWA 1OXZA 3AECA 5C8YE 2UXDT 1HS7A 4ZI2D 2KNDA 4WZXA 5JDQA 5LCYA 4BAYB 3N9QA 3UU5A 3PDYA 5AQNB 1HNZT 3GWHA 5AQTB 2JIWA 1HX8A 3SFDA 5AQPB 5AQUB 1KK7A 2V6XA 1VCSA 3JC6C 2VKHA 3KINB 3ONLC 4X20E 3VR9A 3KVAA 4YSYA 5JR9C 3RKGA 2BS3A 5IYZE 2N9DA 4K0KT 2XM1A 1E7PA 2XAQB 3CX7B 2WB5A 2DHRA 4G63A 3TLTA 3B57A 2X0HA 2JPFA 4YT0A 3IF8B 4X66T 1OEDC 4QX8B 2W63A 2YOEA 3FBZA 3I9WA 5LGNB 4EOZB 4LFAT 1M62A 4GYRA 4TQUM 3QK6A 3P4SA 1WCRA 3EVYA 1YQ3A 2VASA 3EDUA 4J2CA 2E9XC 1FEWA 3ZPOA 4HWDA 4Q25A 4F6RC 4DO0A 1MIWA 5LNKA 5JQGE 3I0QA 4OHFA 1KFYA 1OEDB 1UX4A 3DTOA 3ZYKA 3RYFE 1Y01A 4DBQA 3BQIA 3NZPA 3ZMZB 3CIRA 4TUYE 3UU6A 4AQYT 5CJ5A 2I59A 4AISA 2IUBA 4YMVC 2LSIA 1CHUA 5AQGB 4EIWA 4WBNE 5JR9A 4X64T 5KMGP 4ANJA 2LHRA 1VOMA 4XAXB 3OYXA 1BR2A 5HCJA 5LG3A 2FJEA 3GA8A 4BA9A 3TLVA 4YJ3E 1FIOA 3PE0A 3AB3B 4DR5T 5HXRA 5L3DB 2XAGB 2XAJB 4GOUA 2BG9B 5LP6E 2XJ7A 5DJQC 2XHEB 5FYMA 3GN5B 2OV9A 3PV0F 1WR6A 3MK7C 2YN6A 5HWYA 3RPUA 2H89A 2RPAA 3BK9A 4DUZT 4EYYR 3AAIA 2J1DG 3WI3A 2BBHA 2C5IT 5ABGA 3F31A 5JRCB 2D9DA 2BKOA 4HFIA 1G8XA 3FZHB 4H63V 2LE8A 2BKNA 3ZKRA 4UXNB 2QYWA 5EK3A 3H3MA 2XZEA 2OLTA 4CZZB 3AE3A 3PUYF 5E0OA 4AKRB 3CPZA 1J1JA 2I0MA 2K5BB 3KDSE 3LBXB 4B6XA 4CI3B 5KX5E 4B3RT 5AQQB 2D2SA 4HWHA 4DIDB 5HXSA 3AEDA 3QUJA 2W66A 3LBXA 3UUBA 3IBPA 4B3MT 4JI1T 3N9MA 1MIYA 2W0GA 3AE9A 3HKBE 4A98A 3C50A 4AQGA 5BMVE 5EK4A 3HL6A 1XNRT 3AA7B 2ODUA 4YMSC 3HKEE 2DL1A 2CBIA 3O1IA 4ZI3D 3FXEB 1IBKT 4JUYA 1HCIA 1S94A 5L2LA 3PJAA 1SA0E 3CWZB 2KXPB 2NW7A 4JI7T 3CQCB 4HE8A 4ISSA 5FP3A 3SOLA 4CI1B 5IHYA 5FY1A 3Q2MA 4ERRA 3RYIE 5AQSB 4DUYT 4X1YE 2XQ6A 2LJLA 4XZCA 5FXVA 1IAPA 3IA3A 2CPTA 4JI8T 4JBWF 2PG8A 4MLKA 4U2ZA 2B76A 4UF0B 4TNWA 3RIUC 1OWAA 4AIUA 2XQ8A 2V8SV 5DABA 5FY7A 3ZMVB 5JH7E 3A5XA 3RYCE 2JMKA 4UF0A 5JRCA 2BG9A 3O1JA 3PUZF 2W62A 4MHCA 5ABEA 3Q5EA 5LHGB 2JQHA 2WAUA 3HKCE 2ZLYA 4EYUA 2UU9T 2UXCT 4HFEA 4PJJA 1HFAA 5AQLB 3SFEA 4C91A 4KP3C 1XDOA 2C5KT 3OYZA 3A7MA 3C98B 5FXXA 3ZCIA 3F57A 4I4TE 4L9IA 1BR4A 4BJNA 3RRWA 3JC6D 3ABVA 2LSJA 2VK9A 3VKGA 3X1DA 4LMKA 4YJ2E 5LJMA 4YFSA 3QNUA 3FBLA 4G2AA 1JNZA 1XZYA 2JRKA 1LVFA 3M3ZB 3PTRB 4QKNA 1OEDA 3RF1A 1J5WA 2L8KA 3B5MA 3VRBA 3AE5A 2X67A 2EHOB 1W9RA 3LK3B 3JAFA 2FBWA 1Z0PA 4NXNT 2WCAA 4XBFB 1G73A 5L4HA 4JLEA 2Z6EA 5CFBA 3ZCJA 3CQGB 2V1DB 5GONE 5J2TE 4YMUC 2E9XD 1N32T 3Q5XA 3I1AA 5EK2A 4P1NA 3UQ4A 5ADXL 5HXCA 2LHNA 4EAHA 1N36T 3N9PA 4JI0T 5HAXA 4DNDA 1D0YA 5JDLA 2X9HA 4IIJE 3UT5E 2V7LA 4JI2T 3AEBA 2WU2A 3AVSA 3RQWA 4ZHQE 2J4GA 3AA0B 4EZ4A 3CMLA 3K3OA 2BBJA 3MKDA 3RGLA 2NW8A 2LRKA 1H7CA 4L5GA 5HEUA 3G06A 1NENA 2VL8A 4ILAA 4GIWA 4MALA 1WYCA 4JBWG 3PU3A 4YHJA 4LMJA 5LOVE 3AE6A 1YKHB 2WZHA 3MACA 2ACXA 1QSDA 1SUMB 2J62A 2L3LA 4KUMB 1MMNA 5JVDE 3S4UA 1GQEA 1SHZC 2VB6A 2UXNB 4FI5A 1ZEEA 2CXDA 4YSXA 2AXDS 5M4YA 3EAMA 2V6YA 1IJ5A 4IGUA 4P0BA 4TV9E 1J5ET 4DMVA 2QA7A 4ZI2C 3LFMA 5J1GA 3ANWA 4AQFA 1IBMT 3O1HA 4KBMB 4UVAB 2V6YB 2VKOA 4LF8T 5C3JA 2IC6A 2IHR1 4DV6T 2NTYA 3PUSA 2FJBA 4LF6T 2CXFA 3VU7H 2BS2A 1KF6A 3N2OA 3P4PA 4LF7T 1BR1A 2HPLA 4I0UA 3E0ZA 4XIGN 3ZT7A 3V5UA 1MMGA 3KV5A 4LMLA 5AQFB 2HN1A 5F5WA 3N9LA 4LF9T 4WBOA 4PK6A 4MBQA 4ILBA 5HEJA 1D0XA 2B1EA 4QX7B 4Z91A 4IE6A 3UTKA 3H3AA 5IUXA 3AAAB 4HGAA 4JYAT 4JEUB 3JAEA 5HWXA 4I43B 2JQQA 4IDQA 2JMHA 2WM9A 2NTXA 3K3NA 3ZSSA 2F4VT 3AE7A 2ES0A 2V7IA 4UV8B 4HFCA 3UULA 3CX6B 2MPKA 4KI0F 4DV7T 2E2AA 4QXCB 3IHRA 2H3RA 4O2BE 3ZJ2A 2LRLA 5L3EB 5FVKA 4X1KE 3PV0G 3ZMTB 3KVBA 1HF8A 4EB6E 1R8IA 3CQXC 4EGWA 4YXDA 5HYAA 4DV5T 4KHZG 3TUZA 2GK9A 3N5LA 1UCUA 4BJMA 2EHOC 3W15B 4IE4A 3ZEFB 3AEGA 1MNDA 4PJMA 3SRZA 3QB5K 3AEAA 3ANWB 3PUXF 4MFRA 4QHOA 4ADZA 1V9DA 4X1IE 4JI3T 2X9WA 2NOXA 4QWNB 4TV8E 2WY2A 2CA5A 2LOSA 1BR0A 2IAKA 1WLXA 5H6RB 5ABHA 1N33T 4CI2B 1MMDA 2WDQA 2YKSA 2DWKA 2JQKA 1LVKA 2Q9QD 2X9XA 3PUWF 4I55E 3OBVE 2KT9A 4H9SE 3I9YA 4IDZA 3N2GE 2AE9A 4U74A 1VCTA 1T98A 1WYBA 3KV4A 5DQVA 3AXJB 2UUAT 1HNWT 4AKLA 4ZS2A 4O2AE 3RKOA 3RC8A 3ZJ1A 2L9QA 4CN1A 3ZN1B 2BDEA 3ZYLA 5JR9B 2E5VA 5FY0A 3EHZA 4QH1A 3JADA 1E1HB 2HH7A 4UEMA 4ISTA 3KBTA 1WR0A 3ZC1A 5AFUL 2PFVA 3NWIA 1FJGT 5LMUT 2A72A 4A5XA 3VKHA 3PURA 2E9XA 5AQKB 2KWIB 3FZFB 2XTLA 2A2FX 3AE1A 3FXDB 3P7IA 4CXWA 3Q9DA 2BKPA 3NRYA 3P50A 3B13A 3SWHA 3J9X1 2YEVC 2ZM8A 4FJOA 2WBLA 1KNZA 4AI6A 2CEAA 2VKJA 2VVSA 4ASKA 5LA6E 2R6GG 1W0AA 2VWAA 2BZBA 4L0RA 4UVCB 3NKZA 1YXRA 3L09A 5L3FB 1T8BA 2RP4A 3FZLB 3GN5A 4AKGA 1NAFA 1HG2A 3C4XA 2YINA 1FMWA 4H9QC 2X66A 1JNRA 2SPCA 2YU2A 4TWFA 3ZMUB 4A56A 3P4RA 4IT4A 3EABA 1NWMX 3OPCA 2WQYA 5A1LA 2V7MA 1IZNB 4HEAA 4PAGA 4DV1T 2N1GA 3FZMB 4O4HE 2LOPA 1HTJF 2LT3A 2XQ3A 4O4JE 4ILCA 4U7YA 4EXTA 4YTPA 5LHHB 4LFBT 2PTFA 4QXBB 5AQOB 3K3QC 2VQFT 4PK4A 2J47A 3TUJA 3T1HT 3GMIA 3D0TA 4A97A 1WRDA 2V5DA 3BQLA 2W2UA 3E08A 1B7TA 2DLRA 4GK0E 3KBUA 4X5TA 3ZT6A 5JDHA 2XASB 1D1CA 4PW8A 2IDOB 4Z90A 3UUMA 1US7B 5FL0A 5LJNA 4LFCT 4GK5E 2Y6XA 5LB7B 5CB4E 4K0UA 2CMRA 3UUNA 2KMFA 2OA5A 2IIUA 3U3IA 3P4WA 3K1SA 2RA1A 2ODVA 4QH4A 3UUXB 1QUUA 4YLHA 2HHHT 1CUNA 2IC9A 3AA6B 3JCFA 4TX5A 2UXBT 3P4QA 2ONKC 2MBGA 3A8YC 1D0ZA 3VR8A 2M6BA 4CN4A 3TLWA 1MIVA 2YDRA 4ZZCA 5JREA 2CWYA 3CK6A 4CXYA 2X9YA 3OTOT 2MYSA 4OYJA 3UU3A 1UUSA 4YY3T 4IREA 4UV9B 3C4WA 3J7Yq 3TUIA 2X68A 4IE5A 2LKGA 3RX6A 3TKLB 3BQKA 1X9BA 2KZ7B 4AKIA 1WFDA 4CQIA 2BG9E 2VURA 3L3PA 2XQ4A 4H9PC 1HG5A 4PK5A 5FVLA 2ZM0A 2NW9A 2UUCT 4AKHA 5C2TA 3L8RA 2H88A 4F8HA 1YD8G 3U78A 2E8IA 4H63H 4NIQA 4TWDA 4P09A 2W4XA 2QRXA 3QC9A 1QLBA 2JJ9A 4DV2T 4NUUA 1Y64B 2K9AA 4UVBB 3E22E 5F8PA 4E7SA 2FJAA 3ZLIA 4B3TT 2ZM2A 4GKKT 1ZP0A 2KSRA 2UXXB 3RQUA 2DWGA 4KX6A 4OFZA 3DHWA 5JDMA 4TNVA 2LKHA 5LGUB 4WW0A 5HXHA 2ZM6T 3HR0A 2P9BA 4PNIA 5LHIB 3UQ7A 1HNXT 3IEEA 2CCQA 3FHNA 2LEHA 2YK0A 4EEBA 2W00A 3R6NA 5JDGA 1HR0T 2KLQA 2BG9C 2W67A 2XSBA 1YW0A 3LDQB 4U7IA 5AQVB 5LBQB 3ETUA 5AQHB 3ESLA 4HWFA 5JDNA 5L3CB 4JI4T 4LF5T 2I6HA 4JI6T 2M67A 2WDRA 3PUVF 3C64A 4HWCA 4PFPA 4DBRA 2MOZA 3RIFA 1XNQT 2QVAA 4U3CA 4IDNA 4UR9A 4ZEYA 1O3XA 2K48A 3MZKB 3UFGA 2MTQA 3ONJA 2YDSA 3PUXG 2CE7A 1ZOYA 1MMAA 1UURA 2HPJA 3C51A 3ZC0A 1T7SA 3LG7A 2WU5A 3RLFF 1M7KA 4KMCA 1SE7A 3VRAA 3ZN0B 2V5CA 5ABFB 5LMNT 1EZ3A 4EZHA 3LJCA 3N2KE 4YMTB 4NXMT 4DVDA 2H7VC 1Z8UA 5H6QB 3O9XA 1ZKEA 4TWHA 1D1AA 2Y8DA 3NVOA 3RC3A 5ETWA 3VHLA 3ZYMA 4U31A 3T8OA 4X65T 4WYVA 1L0VA 3FB2A 2E5LT 1YQ4A 1LRZA 2X51A 1XMOT 4UELA 4GKJT 3M65A 1FMVA 4AQFC 1E2AA 1ZHCA 4HTEA 5AQRB 5AQMB 4HFBA 3AVRA 2XQ9A 2WSSV 2VQET 5FMNA 2V7KA 2UUBT 3RIUA 1KNRA 3UU8A 3D31C 3T1YT 3KV6A 2XQYA 5L47A 4JI5T 4IHJE 5JTGA 5LXTE 4JV5T 3LK2B 4CXXA 4XIGM 4PFOA 5TAOA 4DR2T 4I50E 4HWIB 5FNVE 2WMOA 3OJAA 1N34T 4U33A 5HXEA 4HKAA 2V26A 1ZV4X 2XQ5A 3MA9A 3Q5DA 4YSZA 1VRBA 5DQWA 3V5SA 4H9NC 5CA1E 3EI0A 3PUWG 2FJDA 2WZIA 2XY8B 4PJLA 4DR7T 4H9RC 5FKYA 3FZKB 5AQIB 3F2EA 2HN2A 1XWMA 1UX5A 3NBXX 3PUAA 3PU8A 2LSGA 2X0LB 4HFDA 4ILUA 3RYHE 5BR8T 4IE0A 4M1PA 3WAKA 4C90A 4N78D 1YKEB 2XQAA 3AA1B 4UIGA 1U5PA 3KFWX 4QH5A 3LSVA 3EDVA 3OKQA 3ZMSB 2PJQA 4DV3T 3TLUA 4KHZF 2CLYC 2Q9QC 2QGSA 3K8PC 2DI4A 4V1Av 4EV6A 2CXLA 1XDPA 4U2YA 2BVLA 4B3ST 2M6IA 3R84B
chains in the Genus database with same CATH topology
4YMVC 4JBWF 4JBWG 4KI0G 3PUXG 3PUYF 4TQUN 3PUZG 3PUWF 2R6GG 3RLFF 3RLFG 3PUZF 3PUWG 4YMUC 4KI0F 4YMTB 3DHWA 2ONKC 4TQUM 4XTCN 4YMSC 3PV0G 3PUYG 4KHZG 3TUZA 3PV0F 3TUIA 4XIGN 3PUVG 4XTCM 3PUXF 4KHZF 3D31C 3PUVF 3TUJA 2R6GF 4YMWC 4XIGM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMV C;  4JBW F;  4JBW G;  4KI0 G;  3PUX G;  3PUY F;  4TQU N;  3PUZ G;  3PUW F;  2R6G G;  3RLF F;  3RLF G;  3PUZ F;  3PUW G;  4YMU C;  4KI0 F;  4YMT B;  3DHW A;  2ONK C;  4TQU M;  4XTC N;  4YMS C;  3PV0 G;  3PUY G;  4KHZ G;  3TUZ A;  3PV0 F;  3TUI A;  4XIG N;  3PUV G;  4XTC M;  3PUX F;  4KHZ F;  3D31 C;  3PUV F;  3TUJ A;  2R6G F;  4YMW C;  4XIG M; 
#chains in the Genus database with same CATH topology
 4P0A A;  3OVU A;  4HFV A;  4IDP A;  3EUH A;  4KI0 G;  1LKX A;  5HCM A;  5FL1 A;  1DU2 A;  2NWB A;  2CHO A;  4YTN A;  2PBI A;  3HKD E;  4ZI7 E;  3CKD A;  2ACZ A;  2NR4 A;  4OK0 A;  1MNE A;  2WWV A;  5J0Z A;  3L39 A;  4ZXL A;  3RIA A;  2D5U A;  2BS4 A;  3ETV A;  5LGT B;  1X79 A;  2FUP A;  2VVN A;  4XTC N;  2C0S A;  2IML A;  2JQ9 A;  3DJB A;  3ONX A;  2XAF B;  3PJA J;  4ZOL E;  3PUY G;  1IJ6 A;  3DP7 A;  4ZS3 A;  5HEH A;  5FXW A;  3MJX A;  4IE7 A;  3UFE A;  5CA0 E;  2YU1 A;  3AE8 A;  3ZST A;  4X62 T;  3P8C D;  2G0U A;  5L4E A;  1I94 T;  5L3B B;  2LLY A;  2X0Y A;  4DR4 T;  4O4I E;  2N2N A;  2H7O A;  5CGM A;  3RH3 A;  2WDV A;  3AXJ A;  4WNK A;  4EED A;  3UU4 A;  5L3G B;  2VL0 A;  3HI2 A;  4E7Z A;  1IBL T;  5LBM A;  4TZ4 C;  2W61 A;  2YDQ A;  3H37 A;  4AXP A;  4DV0 T;  1AJ3 A;  2CHN A;  2Q9Q B;  2R6G F;  1OED E;  2D0U A;  4HFH A;  3O4X E;  3SS1 A;  3C4Z A;  5LYJ E;  3PUG A;  4O8S A;  5KDM C;  4DV4 T;  4NPP A;  2KWH A;  3CVR A;  2WMN A;  4QXH B;  2K3W A;  4TQU N;  1U4Q A;  3PUZ G;  2E9X B;  2XSA A;  3AAE B;  4IDO A;  4IL4 A;  3RLF G;  2NP9 A;  4DR3 T;  3WAJ A;  4YHH T;  4OX9 T;  4DR6 T;  3ZT5 A;  4Z8X A;  5IWA T;  4ZI3 C;  1HX1 B;  1UK5 A;  3CX8 B;  2A3D A;  1S35 A;  2XPK A;  2XM2 A;  5HEO A;  2IW5 B;  5ABF A;  3NRX A;  4IL9 A;  3NZQ A;  2EHO D;  5HEG A;  4DMW A;  4O4L E;  1KEY A;  4H9O C;  4PJN A;  4U72 A;  4LF4 T;  2BVM A;  1D1B A;  4DR1 T;  1XMQ T;  2XAH B;  2DCF A;  3N9O A;  3QB5 A;  5FXZ A;  2D0T A;  2A9U A;  3HA4 A;  3AE4 A;  3MXZ A;  2XQ7 A;  3PUV G;  2DNX A;  3KV9 A;  4XTC M;  1T72 A;  2V7J A;  3RI5 A;  3RRC A;  5EZY E;  2LSY A;  2CBJ A;  3AEE A;  2CRB A;  3AEF A;  2LM9 A;  1UGO A;  2C5J A;  2CWO A;  3N9N A;  5KXJ A;  4JEH B;  5LG4 A;  3I0O A;  1W0B A;  4YMW C;  2VKD A;  2WS3 A;  5J2U E;  2WWU A;  4GYS A;  1KNP A;  3AE2 A;  3LK4 2;  4NUV A;  2XUE A;  2K24 A;  3RHW A;  3Q5W A;  2EHO A;  2Y48 B;  4OYK A;  5JDF A;  4COF A;  4HN9 A;  2Q9Q A;  1I6Z A;  4CN6 A;  2LSK A;  4YTM A;  4TN7 B;  2LM2 A;  3TLS A;  2WP9 A;  4KHP T;  2CLY B;  2CM0 A;  2KIN B;  3QOF A;  1NEK A;  3PUQ A;  5F3J A;  2ZMA A;  5AQJ B;  1W09 A;  4ZZB A;  2MAW A;  1OXZ A;  3AEC A;  5C8Y E;  2UXD T;  1HS7 A;  4ZI2 D;  2KND A;  4WZX A;  5JDQ A;  5LCY A;  4BAY B;  3N9Q A;  3UU5 A;  3PDY A;  5AQN B;  1HNZ T;  3GWH A;  5AQT B;  2JIW A;  1HX8 A;  3SFD A;  5AQP B;  5AQU B;  1KK7 A;  2V6X A;  1VCS A;  3JC6 C;  2VKH A;  3KIN B;  3ONL C;  4X20 E;  3VR9 A;  3KVA A;  4YSY A;  5JR9 C;  3RKG A;  2BS3 A;  5IYZ E;  2N9D A;  4K0K T;  2XM1 A;  1E7P A;  2XAQ B;  3CX7 B;  2WB5 A;  2DHR A;  4G63 A;  3TLT A;  3B57 A;  2X0H A;  2JPF A;  4YT0 A;  3IF8 B;  4X66 T;  1OED C;  4QX8 B;  2W63 A;  2YOE A;  3FBZ A;  3I9W A;  5LGN B;  4EOZ B;  4LFA T;  1M62 A;  4GYR A;  4TQU M;  3QK6 A;  3P4S A;  1WCR A;  3EVY A;  1YQ3 A;  2VAS A;  3EDU A;  4J2C A;  2E9X C;  1FEW A;  3ZPO A;  4HWD A;  4Q25 A;  4F6R C;  4DO0 A;  1MIW A;  5LNK A;  5JQG E;  3I0Q A;  4OHF A;  1KFY A;  1OED B;  1UX4 A;  3DTO A;  3ZYK A;  3RYF E;  1Y01 A;  4DBQ A;  3BQI A;  3NZP A;  3ZMZ B;  3CIR A;  4TUY E;  3UU6 A;  4AQY T;  5CJ5 A;  2I59 A;  4AIS A;  2IUB A;  4YMV C;  2LSI A;  1CHU A;  5AQG B;  4EIW A;  4WBN E;  5JR9 A;  4X64 T;  5KMG P;  4ANJ A;  2LHR A;  1VOM A;  4XAX B;  3OYX A;  1BR2 A;  5HCJ A;  5LG3 A;  2FJE A;  3GA8 A;  4BA9 A;  3TLV A;  4YJ3 E;  1FIO A;  3PE0 A;  3AB3 B;  4DR5 T;  5HXR A;  5L3D B;  2XAG B;  2XAJ B;  4GOU A;  2BG9 B;  5LP6 E;  2XJ7 A;  5DJQ C;  2XHE B;  5FYM A;  3GN5 B;  2OV9 A;  3PV0 F;  1WR6 A;  3MK7 C;  2YN6 A;  5HWY A;  3RPU A;  2H89 A;  2RPA A;  3BK9 A;  4DUZ T;  4EYY R;  3AAI A;  2J1D G;  3WI3 A;  2BBH A;  2C5I T;  5ABG A;  3F31 A;  5JRC B;  2D9D A;  2BKO A;  4HFI A;  1G8X A;  3FZH B;  4H63 V;  2LE8 A;  2BKN A;  3ZKR A;  4UXN B;  2QYW A;  5EK3 A;  3H3M A;  2XZE A;  2OLT A;  4CZZ B;  3AE3 A;  3PUY F;  5E0O A;  4AKR B;  3CPZ A;  1J1J A;  2I0M A;  2K5B B;  3KDS E;  3LBX B;  4B6X A;  4CI3 B;  5KX5 E;  4B3R T;  5AQQ B;  2D2S A;  4HWH A;  4DID B;  5HXS A;  3AED A;  3QUJ A;  2W66 A;  3LBX A;  3UUB A;  3IBP A;  4B3M T;  4JI1 T;  3N9M A;  1MIY A;  2W0G A;  3AE9 A;  3HKB E;  4A98 A;  3C50 A;  4AQG A;  5BMV E;  5EK4 A;  3HL6 A;  1XNR T;  3AA7 B;  2ODU A;  4YMS C;  3HKE E;  2DL1 A;  2CBI A;  3O1I A;  4ZI3 D;  3FXE B;  1IBK T;  4JUY A;  1HCI A;  1S94 A;  5L2L A;  3PJA A;  1SA0 E;  3CWZ B;  2KXP B;  2NW7 A;  4JI7 T;  3CQC B;  4HE8 A;  4ISS A;  5FP3 A;  3SOL A;  4CI1 B;  5IHY A;  5FY1 A;  3Q2M A;  4ERR A;  3RYI E;  5AQS B;  4DUY T;  4X1Y E;  2XQ6 A;  2LJL A;  4XZC A;  5FXV A;  1IAP A;  3IA3 A;  2CPT A;  4JI8 T;  4JBW F;  2PG8 A;  4MLK A;  4U2Z A;  2B76 A;  4UF0 B;  4TNW A;  3RIU C;  1OWA A;  4AIU A;  2XQ8 A;  2V8S V;  5DAB A;  5FY7 A;  3ZMV B;  5JH7 E;  3A5X A;  3RYC E;  2JMK A;  4UF0 A;  5JRC A;  2BG9 A;  3O1J A;  3PUZ F;  2W62 A;  4MHC A;  5ABE A;  3Q5E A;  5LHG B;  2JQH A;  2WAU A;  3HKC E;  2ZLY A;  4EYU A;  2UU9 T;  2UXC T;  4HFE A;  4PJJ A;  1HFA A;  5AQL B;  3SFE A;  4C91 A;  4KP3 C;  1XDO A;  2C5K T;  3OYZ A;  3A7M A;  3C98 B;  5FXX A;  3ZCI A;  3F57 A;  4I4T E;  4L9I A;  1BR4 A;  4BJN A;  3RRW A;  3JC6 D;  3ABV A;  2LSJ A;  2VK9 A;  3VKG A;  3X1D A;  4LMK A;  4YJ2 E;  5LJM A;  4YFS A;  3QNU A;  3FBL A;  4G2A A;  1JNZ A;  1XZY A;  2JRK A;  1LVF A;  3M3Z B;  3PTR B;  4QKN A;  1OED A;  3RF1 A;  1J5W A;  2L8K A;  3B5M A;  3VRB A;  3AE5 A;  2X67 A;  2EHO B;  1W9R A;  3LK3 B;  3JAF A;  2FBW A;  1Z0P A;  4NXN T;  2WCA A;  4XBF B;  1G73 A;  5L4H A;  4JLE A;  2Z6E A;  5CFB A;  3ZCJ A;  3CQG B;  2V1D B;  5GON E;  5J2T E;  4YMU C;  2E9X D;  1N32 T;  3Q5X A;  3I1A A;  5EK2 A;  4P1N A;  3UQ4 A;  5ADX L;  5HXC A;  2LHN A;  4EAH A;  1N36 T;  3N9P A;  4JI0 T;  5HAX A;  4DND A;  1D0Y A;  5JDL A;  2X9H A;  4IIJ E;  3UT5 E;  2V7L A;  4JI2 T;  3AEB A;  2WU2 A;  3AVS A;  3RQW A;  4ZHQ E;  2J4G A;  3AA0 B;  4EZ4 A;  3CML A;  3K3O A;  2BBJ A;  3MKD A;  3RGL A;  2NW8 A;  2LRK A;  1H7C A;  4L5G A;  5HEU A;  3G06 A;  1NEN A;  2VL8 A;  4ILA A;  4GIW A;  4MAL A;  1WYC A;  4JBW G;  3PU3 A;  4YHJ A;  4LMJ A;  5LOV E;  3AE6 A;  1YKH B;  2WZH A;  3MAC A;  2ACX A;  1QSD A;  1SUM B;  2J62 A;  2L3L A;  4KUM B;  1MMN A;  5JVD E;  3S4U A;  1GQE A;  1SHZ C;  2VB6 A;  2UXN B;  4FI5 A;  1ZEE A;  2CXD A;  4YSX A;  2AXD S;  5M4Y A;  3EAM A;  2V6Y A;  1IJ5 A;  4IGU A;  4P0B A;  4TV9 E;  1J5E T;  4DMV A;  2QA7 A;  4ZI2 C;  3LFM A;  5J1G A;  3ANW A;  4AQF A;  1IBM T;  3O1H A;  4KBM B;  4UVA B;  2V6Y B;  2VKO A;  4LF8 T;  5C3J A;  2IC6 A;  2IHR 1;  4DV6 T;  2NTY A;  3PUS A;  2FJB A;  4LF6 T;  2CXF A;  3VU7 H;  2BS2 A;  1KF6 A;  3N2O A;  3P4P A;  4LF7 T;  1BR1 A;  2HPL A;  4I0U A;  3E0Z A;  4XIG N;  3ZT7 A;  3V5U A;  1MMG A;  3KV5 A;  4LML A;  5AQF B;  2HN1 A;  5F5W A;  3N9L A;  4LF9 T;  4WBO A;  4PK6 A;  4MBQ A;  4ILB A;  5HEJ A;  1D0X A;  2B1E A;  4QX7 B;  4Z91 A;  4IE6 A;  3UTK A;  3H3A A;  5IUX A;  3AAA B;  4HGA A;  4JYA T;  4JEU B;  3JAE A;  5HWX A;  4I43 B;  2JQQ A;  4IDQ A;  2JMH A;  2WM9 A;  2NTX A;  3K3N A;  3ZSS A;  2F4V T;  3AE7 A;  2ES0 A;  2V7I A;  4UV8 B;  4HFC A;  3UUL A;  3CX6 B;  2MPK A;  4KI0 F;  4DV7 T;  2E2A A;  4QXC B;  3IHR A;  2H3R A;  4O2B E;  3ZJ2 A;  2LRL A;  5L3E B;  5FVK A;  4X1K E;  3PV0 G;  3ZMT B;  3KVB A;  1HF8 A;  4EB6 E;  1R8I A;  3CQX C;  4EGW A;  4YXD A;  5HYA A;  4DV5 T;  4KHZ G;  3TUZ A;  2GK9 A;  3N5L A;  1UCU A;  4BJM A;  2EHO C;  3W15 B;  4IE4 A;  3ZEF B;  3AEG A;  1MND A;  4PJM A;  3SRZ A;  3QB5 K;  3AEA A;  3ANW B;  3PUX F;  4MFR A;  4QHO A;  4ADZ A;  1V9D A;  4X1I E;  4JI3 T;  2X9W A;  2NOX A;  4QWN B;  4TV8 E;  2WY2 A;  2CA5 A;  2LOS A;  1BR0 A;  2IAK A;  1WLX A;  5H6R B;  5ABH A;  1N33 T;  4CI2 B;  1MMD A;  2WDQ A;  2YKS A;  2DWK A;  2JQK A;  1LVK A;  2Q9Q D;  2X9X A;  3PUW F;  4I55 E;  3OBV E;  2KT9 A;  4H9S E;  3I9Y A;  4IDZ A;  3N2G E;  2AE9 A;  4U74 A;  1VCT A;  1T98 A;  1WYB A;  3KV4 A;  5DQV A;  3AXJ B;  2UUA T;  1HNW T;  4AKL A;  4ZS2 A;  4O2A E;  3RKO A;  3RC8 A;  3ZJ1 A;  2L9Q A;  4CN1 A;  3ZN1 B;  2BDE A;  3ZYL A;  5JR9 B;  2E5V A;  5FY0 A;  3EHZ A;  4QH1 A;  3JAD A;  1E1H B;  2HH7 A;  4UEM A;  4IST A;  3KBT A;  1WR0 A;  3ZC1 A;  5AFU L;  2PFV A;  3NWI A;  1FJG T;  5LMU T;  2A72 A;  4A5X A;  3VKH A;  3PUR A;  2E9X A;  5AQK B;  2KWI B;  3FZF B;  2XTL A;  2A2F X;  3AE1 A;  3FXD B;  3P7I A;  4CXW A;  3Q9D A;  2BKP A;  3NRY A;  3P50 A;  3B13 A;  3SWH A;  3J9X 1;  2YEV C;  2ZM8 A;  4FJO A;  2WBL A;  1KNZ A;  4AI6 A;  2CEA A;  2VKJ A;  2VVS A;  4ASK A;  5LA6 E;  2R6G G;  1W0A A;  2VWA A;  2BZB A;  4L0R A;  4UVC B;  3NKZ A;  1YXR A;  3L09 A;  5L3F B;  1T8B A;  2RP4 A;  3FZL B;  3GN5 A;  4AKG A;  1NAF A;  1HG2 A;  3C4X A;  2YIN A;  1FMW A;  4H9Q C;  2X66 A;  1JNR A;  2SPC A;  2YU2 A;  4TWF A;  3ZMU B;  4A56 A;  3P4R A;  4IT4 A;  3EAB A;  1NWM X;  3OPC A;  2WQY A;  5A1L A;  2V7M A;  1IZN B;  4HEA A;  4PAG A;  4DV1 T;  2N1G A;  3FZM B;  4O4H E;  2LOP A;  1HTJ F;  2LT3 A;  2XQ3 A;  4O4J E;  4ILC A;  4U7Y A;  4EXT A;  4YTP A;  5LHH B;  4LFB T;  2PTF A;  4QXB B;  5AQO B;  3K3Q C;  2VQF T;  4PK4 A;  2J47 A;  3TUJ A;  3T1H T;  3GMI A;  3D0T A;  4A97 A;  1WRD A;  2V5D A;  3BQL A;  2W2U A;  3E08 A;  1B7T A;  2DLR A;  4GK0 E;  3KBU A;  4X5T A;  3ZT6 A;  5JDH A;  2XAS B;  1D1C A;  4PW8 A;  2IDO B;  4Z90 A;  3UUM A;  1US7 B;  5FL0 A;  5LJN A;  4LFC T;  4GK5 E;  2Y6X A;  5LB7 B;  5CB4 E;  4K0U A;  2CMR A;  3UUN A;  2KMF A;  2OA5 A;  2IIU A;  3U3I A;  3P4W A;  3K1S A;  2RA1 A;  2ODV A;  4QH4 A;  3UUX B;  1QUU A;  4YLH A;  2HHH T;  1CUN A;  2IC9 A;  3AA6 B;  3JCF A;  4TX5 A;  2UXB T;  3P4Q A;  2ONK C;  2MBG A;  3A8Y C;  1D0Z A;  3VR8 A;  2M6B A;  4CN4 A;  3TLW A;  1MIV A;  2YDR A;  4ZZC A;  5JRE A;  2CWY A;  3CK6 A;  4CXY A;  2X9Y A;  3OTO T;  2MYS A;  4OYJ A;  3UU3 A;  1UUS A;  4YY3 T;  4IRE A;  4UV9 B;  3C4W A;  3J7Y q;  3TUI A;  2X68 A;  4IE5 A;  2LKG A;  3RX6 A;  3TKL B;  3BQK A;  1X9B A;  2KZ7 B;  4AKI A;  1WFD A;  4CQI A;  2BG9 E;  2VUR A;  3L3P A;  2XQ4 A;  4H9P C;  1HG5 A;  4PK5 A;  5FVL A;  2ZM0 A;  2NW9 A;  2UUC T;  4AKH A;  5C2T A;  3L8R A;  2H88 A;  4F8H A;  1YD8 G;  3U78 A;  2E8I A;  4H63 H;  4NIQ A;  4TWD A;  4P09 A;  2W4X A;  2QRX A;  3QC9 A;  1QLB A;  2JJ9 A;  4DV2 T;  4NUU A;  1Y64 B;  2K9A A;  4UVB B;  3E22 E;  5F8P A;  4E7S A;  2FJA A;  3ZLI A;  4B3T T;  2ZM2 A;  4GKK T;  1ZP0 A;  2KSR A;  2UXX B;  3RQU A;  2DWG A;  4KX6 A;  4OFZ A;  3DHW A;  5JDM A;  4TNV A;  2LKH A;  5LGU B;  4WW0 A;  5HXH A;  2ZM6 T;  3HR0 A;  2P9B A;  4PNI A;  5LHI B;  3UQ7 A;  1HNX T;  3IEE A;  2CCQ A;  3FHN A;  2LEH A;  2YK0 A;  4EEB A;  2W00 A;  3R6N A;  5JDG A;  1HR0 T;  2KLQ A;  2BG9 C;  2W67 A;  2XSB A;  1YW0 A;  3LDQ B;  4U7I A;  5AQV B;  5LBQ B;  3ETU A;  5AQH B;  3ESL A;  4HWF A;  5JDN A;  5L3C B;  4JI4 T;  4LF5 T;  2I6H A;  4JI6 T;  2M67 A;  2WDR A;  3PUV F;  3C64 A;  4HWC A;  4PFP A;  4DBR A;  2MOZ A;  3RIF A;  1XNQ T;  2QVA A;  4U3C A;  4IDN A;  4UR9 A;  4ZEY A;  1O3X A;  2K48 A;  3MZK B;  3UFG A;  2MTQ A;  3ONJ A;  2YDS A;  3PUX G;  2CE7 A;  1ZOY A;  1MMA A;  1UUR A;  2HPJ A;  3C51 A;  3ZC0 A;  1T7S A;  3LG7 A;  2WU5 A;  3RLF F;  1M7K A;  4KMC A;  1SE7 A;  3VRA A;  3ZN0 B;  2V5C A;  5ABF B;  5LMN T;  1EZ3 A;  4EZH A;  3LJC A;  3N2K E;  4YMT B;  4NXM T;  4DVD A;  2H7V C;  1Z8U A;  5H6Q B;  3O9X A;  1ZKE A;  4TWH A;  1D1A A;  2Y8D A;  3NVO A;  3RC3 A;  5ETW A;  3VHL A;  3ZYM A;  4U31 A;  3T8O A;  4X65 T;  4WYV A;  1L0V A;  3FB2 A;  2E5L T;  1YQ4 A;  1LRZ A;  2X51 A;  1XMO T;  4UEL A;  4GKJ T;  3M65 A;  1FMV A;  4AQF C;  1E2A A;  1ZHC A;  4HTE A;  5AQR B;  5AQM B;  4HFB A;  3AVR A;  2XQ9 A;  2WSS V;  2VQE T;  5FMN A;  2V7K A;  2UUB T;  3RIU A;  1KNR A;  3UU8 A;  3D31 C;  3T1Y T;  3KV6 A;  2XQY A;  5L47 A;  4JI5 T;  4IHJ E;  5JTG A;  5LXT E;  4JV5 T;  3LK2 B;  4CXX A;  4XIG M;  4PFO A;  5TAO A;  4DR2 T;  4I50 E;  4HWI B;  5FNV E;  2WMO A;  3OJA A;  1N34 T;  4U33 A;  5HXE A;  4HKA A;  2V26 A;  1ZV4 X;  2XQ5 A;  3MA9 A;  3Q5D A;  4YSZ A;  1VRB A;  5DQW A;  3V5S A;  4H9N C;  5CA1 E;  3EI0 A;  3PUW G;  2FJD A;  2WZI A;  2XY8 B;  4PJL A;  4DR7 T;  4H9R C;  5FKY A;  3FZK B;  5AQI B;  3F2E A;  2HN2 A;  1XWM A;  1UX5 A;  3NBX X;  3PUA A;  3PU8 A;  2LSG A;  2X0L B;  4HFD A;  4ILU A;  3RYH E;  5BR8 T;  4IE0 A;  4M1P A;  3WAK A;  4C90 A;  4N78 D;  1YKE B;  2XQA A;  3AA1 B;  4UIG A;  1U5P A;  3KFW X;  4QH5 A;  3LSV A;  3EDV A;  3OKQ A;  3ZMS B;  2PJQ A;  4DV3 T;  3TLU A;  4KHZ F;  2CLY C;  2Q9Q C;  2QGS A;  3K8P C;  2DI4 A;  4V1A v;  4EV6 A;  2CXL A;  1XDP A;  4U2Y A;  2BVL A;  4B3S T;  2M6I A;  3R84 B; 
#chains in the Genus database with same CATH homology
 4YMV C;  4JBW F;  4JBW G;  4KI0 G;  3PUX G;  3PUY F;  4TQU N;  3PUZ G;  3PUW F;  2R6G G;  3RLF F;  3RLF G;  3PUZ F;  3PUW G;  4YMU C;  4KI0 F;  4YMT B;  3DHW A;  2ONK C;  4TQU M;  4XTC N;  4YMS C;  3PV0 G;  3PUY G;  4KHZ G;  3TUZ A;  3PV0 F;  3TUI A;  4XIG N;  3PUV G;  4XTC M;  3PUX F;  4KHZ F;  3D31 C;  3PUV F;  3TUJ A;  2R6G F;  4YMW C;  4XIG M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...