3PUXF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 151
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puxF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puxF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puxF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puxF02
3PUYF 2R6GF 4YMWC 4YMTB 3PV0G 4YMSC 3PUVF 3PUZF 4KHZG 3D31C 3PUYG 4XTCM 3TUIA 3DHWA 4TQUM 4XTCN 3PUXG 4KI0F 4TQUN 4KHZF 4JBWG 3RLFF 3PUWF 4XIGM 3PUXF 2R6GG 4KI0G 3PV0F 4JBWF 4YMUC 4XIGN 3TUJA 3PUVG 2ONKC 4YMVC 3RLFG 3TUZA 3PUWG 3PUZG
chains in the Genus database with same CATH superfamily
4LFCT 3EVYA 2A3DA 2LLYA 3EHZA 3ZT7A 5HEUA 4E7ZA 2E2AA 1T98A 4HN9A 2WU2A 2FJBA 3EUHA 1MMGA 2BG9E 3BQKA 3HL6A 4GKKT 2WB5A 3SS1A 2D9DA 4ILAA 5CFBA 3C4XA 2BS2A 4IL9A 1FEWA 4DV2T 1WR6A 2VKHA 3P7IA 3PDYA 4DMWA 4EEBA 1N32T 3OPCA 4TQUM 2J1DG 3UT5E 5CA0E 3CQGB 4P0BA 3OVUA 4KI0F 4YTNA 4EV6A 2D0TA 4O2BE 4AIUA 3WAJA 1S94A 5JDHA 1HG2A 2B1EA 2WDRA 3SOLA 2QYWA 3JADA 4KX6A 3HKEE 4J2CA 4NUVA 4UF0B 1HF8A 4XIGM 3BQLA 2E9XB 4P09A 5AQJB 1XDPA 4DV6T 2W4XA 3C98B 2I6HA 2LHNA 4ZI2C 1XNQT 4H63H 4Z8XA 4DO0A 1KK7A 2N1GA 1W09A 3PUSA 3WAKA 4ZI7E 2LHRA 2W67A 2R6GF 5CGMA 3UQ7A 2LOPA 4U2YA 5AQOB 3AA0B 3TLVA 5LGTB 4YJ3E 4HFCA 5LYJE 5E0OA 3PUZF 4QX8B 2LKHA 4JI5T 2W62A 2V1DB 3AXJB 3N9MA 4PK5A 3RYCE 5IUXA 5ABEA 2XSBA 4OHFA 1U5PA 2V5CA 3DHWA 2VL8A 2YDSA 2UU9T 3RQUA 4LF9T 4EAHA 2LM9A 1OXZA 4A56A 3KFWX 2MTQA 2LT3A 2FJAA 2MPKA 2WZIA 3CIRA 3ZC1A 5EZYE 3ZC0A 1LKXA 2KSRA 1VCSA 4ZS3A 1FMVA 2V7MA 5AQPB 5F8PA 3E0ZA 2HHHT 3IF8B 2V7KA 4QXBB 3ZT6A 2JQ9A 3ANWA 3O4XE 4HKAA 2VQET 3VKGA 4YMUC 3LK3B 2ZM2A 2BG9C 3QB5A 2C5KT 5AQQB 3ZSSA 1VOMA 4PFOA 4CXXA 2Y8DA 1XMQT 2XQ6A 3GN5A 4O4JE 3BK9A 4M1PA 4EXTA 4YHHT 2P9BA 2WDQA 4EZ4A 4GOUA 3P8CD 5JREA 3IBPA 3PUVF 3UFEA 1D1CA 2NTYA 3NRXA 3RC3A 3C4ZA 4G63A 2D5UA 2FJEA 3A5XA 4DUZT 3K3NA 4K0KT 2CLYC 4B3MT 3LG7A 3N9QA 4HFHA 5BR8T 1W0BA 4LF4T 4GYRA 2UXNB 2CWYA 3MZKB 2AXDS 4TQUN 2JPFA 2CE7A 2E8IA 1Z0PA 1N34T 4DV4T 3RYIE 3UQ4A 4U2ZA 2NP9A 2MOZA 2RA1A 4YSZA 3PUXF 2R6GG 3AEAA 3AEEA 3PJAJ 3CX8B 4IE6A 2E9XD 2H3RA 2XAHB 1MMAA 3AE8A 3C64A 2HN1A 2CBIA 4TWFA 5JRCA 1E1HB 3MA9A 2CCQA 3AE4A 3UU6A 4AQFA 3AXJA 5HXHA 3HKDE 3Q5WA 4IIJE 5A1LA 4AQFC 4EB6E 1YKEB 2Q9QC 3ZPOA 1YQ4A 5C8YE 1D1BA 3VU7H 4GYSA 2UXCT 1BR4A 2EHOB 2QGSA 3RPUA 2UUAT 2CA5A 4IDOA 4JI2T 2MYSA 4HWFA 4IE0A 1ZEEA 2BZBA 3Q5EA 4N78D 4QXHB 4ZZBA 3OYXA 2Y6XA 3IHRA 1QSDA 3RIUC 1YXRA 3IA3A 1SE7A 4O8SA 4OYKA 5AQMB 2VB6A 5AQUB 4JI1T 4LMKA 2HH7A 2CMRA 3QNUA 2ZM6T 3NKZA 4U7IA 4UXNB 4HFBA 3JAEA 4UVAB 4DBQA 2XQ4A 5LMUT 4DV0T 5CB4E 1Y64B 3NRYA 3FBZA 4UV9B 3EDVA 3MACA 1MIWA 1OWAA 3L3PA 3EDUA 5LBMA 4YSYA 1WYCA 3TUJA 2DI4A 2BBJA 2CXFA 3C51A 3ESLA 5HCJA 4ERRA 4YXDA 5HXCA 3F57A 3PUWG 2UXXB 1E2AA 3VRAA 4EGWA 3ZN0B 3RQWA 4YMTB 3DJBA 3PJAA 4TX5A 4H9NC 3GA8A 1HX8A 3JC6C 4LF6T 4DVDA 3Q5XA 3TLSA 3ZMVB 4BJNA 3GN5B 4CN6A 2KMFA 3KINB 1SHZC 5ABGA 3QOFA 3SFEA 1HTJF 4NUUA 4JV5T 3N9NA 4QX7B 3VKHA 5FY7A 2WWVA 4B6XA 3OJAA 3PUXG 3VR8A 2WMNA 3AE5A 3UU8A 3VR9A 4NIQA 5AQIB 4QWNB 2DNXA 1ZKEA 5ABHA 2K9AA 4HGAA 5L3DB 3RLFF 2WQYA 3M65A 4TNVA 5FMNA 1NWMX 2XPKA 4TNWA 4PNIA 5F5WA 3A7MA 3RIFA 3JCFA 4QH4A 1HR0T 3AECA 2X9XA 4DV1T 4KP3C 2NTXA 3AE6A 2KT9A 3T1YT 2H7VC 5JDLA 2ACZA 4LF8T 1U4QA 2VL0A 3ABVA 4IL4A 5ABFB 3NVOA 4OFZA 3U78A 4DR6T 3RX6A 3VRBA 3EABA 4H9PC 4XZCA 2E9XC 3JC6D 4UELA 4AISA 3K3QC 2G0UA 2XUEA 5GONE 3AVSA 4DR3T 4V1Av 1UURA 1G8XA 2BKNA 1Y01A 3AA7B 1IJ5A 4QH5A 3V5SA 1G73A 4L0RA 2BG9B 1BR0A 2LE8A 4IREA 1J5WA 1N33T 2BG9A 4KHZF 3Q2MA 4HFIA 3RYHE 4BA9A 4ZI3D 2XZEA 4AXPA 5AQKB 3PUWF 4UIGA 1CHUA 1FIOA 4AQYT 2WCAA 2F4VT 4AKHA 4AKGA 5J2UE 2DHRA 3ZJ1A 5C2TA 4TWHA 5FXXA 2X9WA 4JBWF 1KNPA 4ZHQE 5AQLB 2FBWA 2CXLA 4YMVC 5AQHB 5BMVE 2WBLA 1R8IA 2A9UA 2DWGA 2M67A 1ZP0A 3PUZG 4IDNA 5EK2A 4AKRB 4JI3T 2X9HA 3CMLA 4AKLA 4EOZB 3OYZA 4H9RC 1VRBA 3PV0G 3ZSTA 2NOXA 1SUMB 3UU3A 2IUBA 3PURA 2VVNA 3H3AA 4KHZG 4YHJA 3PE0A 1T8BA 3KV5A 5LG4A 2ACXA 2A72A 2E5VA 2JIWA 3CX6B 3CX7B 4O4LE 1J1JA 2BKPA 4UF0A 3TKLB 3X1DA 4DMVA 2XAFB 3UU4A 4CXYA 4PJMA 4ZS2A 3ZCJA 5KDMC 1NEKA 4JBWG 2XQ8A 3K1SA 2JQKA 2WY2A 3K3OA 4H9QC 5DQVA 4X1IE 3TLUA 4YT0A 3KVBA 3LDQB 3PUGA 3AE7A 2C5IT 4HFEA 4TN7B 5J1GA 4F6RC 4FI5A 2M6BA 5FXWA 3QB5K 5TAOA 2CRBA 3PV0F 2ES0A 2YN6A 2JJ9A 2BVLA 2XY8B 3FZFB 4TWDA 5M4YA 2Q9QA 3FZLB 3BQIA 1JNRA 4EEDA 5LNKA 5L3GB 2LRKA 5AQNB 4CN4A 1HFAA 2LEHA 2WMOA 3N9OA 4HEAA 4ISTA 1EZ3A 4LMJA 4FJOA 3ZCIA 5JDMA 4IT4A 5ADXL 4LFAT 2W66A 2VASA 3KDSE 2B76A 2YDRA 5FXVA 2IW5B 5HYAA 1L0VA 1AJ3A 5FL0A 4KUMB 4TV8E 2VKJA 2LRLA 2HPJA 2H89A 2I0MA 2JRKA 2NR4A 2YU2A 2ZM0A 3LSVA 4EYUA 2IC6A 2CHNA 1UCUA 3ANWB 3RRWA 4NXNT 2XASB 1OEDB 3FXDB 3MKDA 4PAGA 3RKGA 2VKOA 4C91A 3CWZB 3T8OA 4IDZA 1MNEA 3RI5A 1XMOT 1UX4A 3QK6A 2V8SV 1MMDA 2DL1A 1WRDA 1NAFA 1X79A 2VK9A 4IGUA 2ZMAA 3AAIA 5AQVB 5LJMA 5EK3A 1D0ZA 1FMWA 3I9YA 1B7TA 4JI0T 5HEOA 4YLHA 4OX9T 4KMCA 1VCTA 3MJXA 3N2OA 3AE1A 3OBVE 1MNDA 3S4UA 4YSXA 3LBXB 5LCYA 1T7SA 4DR4T 4YMSC 3FZMB 4NPPA 5FVKA 4XBFB 3LFMA 1HNXT 4COFA 4UEMA 5LP6E 3UUXB 5JH7E 2K24A 1WLXA 2GK9A 2QRXA 3CK6A 3ETUA 1LVFA 3QC9A 4X1KE 4QHOA 2JMKA 4ZOLE 3R6NA 4ADZA 5KXJA 5LOVE 5LB7B 5FXZA 3UU5A 3RHWA 3LK42 2Z6EA 3UTKA 2XJ7A 1M62A 1ZHCA 5HCMA 4HFVA 1HNZT 4B3ST 2LJLA 3RC8A 4WBNE 1DU2A 4ZZCA 3LK2B 2L9QA 3OTOT 2XQ9A 1V9DA 4MFRA 2CWOA 4ILUA 1H7CA 2XQAA 3AA6B 1YKHB 4WNKA 5HAXA 5JVDE 3I0OA 5JR9C 1E7PA 2V6XA 2E5LT 4TV9E 3AEBA 4YJ2E 3P4QA 3ZJ2A 4MHCA 3ZMUB 4B3TT 3NZQA 1FJGT 2KXPB 2XSAA 1OEDE 4YMWC 4P0AA 2LKGA 5LBQB 5LGNB 3J9X1 1YW0A 2EHOD 2NW8A 2QA7A 3HR0A 1I94T 2CBJA 4DR5T 1W0AA 2N2NA 1JNZA 2WS3A 5DJQC 2L8KA 1KNRA 4XTCM 3FXEB 2LSGA 1LVKA 2FUPA 3ONJA 2IC9A 2W61A 1WFDA 2V7IA 2VVSA 4HWCA 3ETVA 4K0UA 4CXWA 3O1HA 4UVCB 2WP9A 1UUSA 1Z8UA 2VKDA 5HXEA 2JMHA 4H9OC 4EIWA 2MBGA 5IWAT 3RIUA 3MK7C 4PFPA 2WSSV 4IHJE 1CUNA 2J47A 4UV8B 2V7LA 4WYVA 5H6QB 3ZKRA 5L3CB 5J0ZA 2BVMA 3ONLC 2XAJB 4QXCB 3RYFE 4JYAT 2KWIB 2XHEB 2LSKA 2M6IA 4X62T 2V7JA 3P4SA 3ZEFB 1J5ET 2X0LB 2D0UA 3B57A 3DP7A 3ZMTB 2V26A 5KMGP 3GWHA 2ZM8A 3KVAA 3L39A 3N5LA 3AE3A 4P1NA 2Y48B 4DR2T 1BR2A 4DBRA 3H37A 5LG3A 3FZHB 5LGUB 4JI8T 4ANJA 3D31C 4JLEA 3N9PA 4UVBB 4UR9A 3W15B 2DCFA 3PUAA 3TUIA 2W0GA 1SA0E 2BDEA 1HX1B 3L09A 2H7OA 1ZV4X 2J62A 1O3XA 4Z90A 2V6YB 4CI2B 2BS3A 1HCIA 3T1HT 4O4HE 2IIUA 4I4TE 4ZXLA 1D0XA 1KEYA 3PUQA 4U74A 1GQEA 2X68A 2SPCA 3E08A 4C90A 5AQTB 4ZI2D 1US7B 4X5TA 3AAEB 1LRZA 4HE8A 5CJ5A 4XIGN 3KBUA 5JR9B 2C5JA 1MIVA 2CHOA 2OLTA 2KLQA 2X51A 3AEFA 4JI7T 1XZYA 1WYBA 2LOSA 2YU1A 1M7KA 3EI0A 3KV9A 4HTEA 4MBQA 2N9DA 4A98A 1NENA 2Q9QB 2PTFA 3M3ZB 4JI6T 2XQ5A 3RGLA 4JEHB 5LMNT 2UUCT 3DTOA 4MLKA 5KX5E 4H9SE 1ZOYA 4PW8A 2LSIA 5AQGB 3VHLA 1UX5A 2X9YA 2YOEA 3N9LA 4I43B 3UUNA 5DABA 5L3BB 1XDOA 4LMLA 5HEJA 1N36T 3ZYMA 1KNZA 5AQFB 1YQ3A 1WR0A 1MIYA 4BJMA 1QLBA 2ZLYA 3P4WA 4U31A 2PFVA 5DQWA 3J7Yq 5LHIB 2FJDA 2YKSA 1UGOA 4A5XA 1IAPA 3CKDA 3Q9DA 5JDNA 4G2AA 3RRCA 3N2KE 3KBTA 4GK5E 4IE4A 3FB2A 3N2GE 2KWHA 4XAXB 1KFYA 4YY3T 3TUZA 3PU8A 2RP4A 3RF1A 4U33A 4DV3T 3PUYF 2MAWA 3OKQA 5L3FB 3KV6A 3AAAB 2WAUA 5JQGE 3B5MA 1IJ6A 5L2LA 1WCRA 2K48A 2XAGB 1W9RA 3HA4A 4CI1B 2CLYB 2HN2A 4H63V 4AQGA 4DV7T 3F2EA 3D0TA 3EAMA 3UFGA 5HXSA 2IMLA 2JQHA 2L3LA 2NW9A 4PK4A 3KV4A 4Q25A 4TZ4C 2PJQA 4IE7A 5HWYA 2X0HA 4CQIA 4KHPT 2PG8A 3IEEA 4CN1A 2CM0A 3V5UA 2X67A 2XQYA 3AE2A 4WW0A 3R84B 5FY1A 2ODVA 2KINB 3O9XA 4DV5T 2PBIA 2V6YA 2YK0A 4PJLA 4TUYE 5AQSB 5HEGA 2EHOA 2NWBA 1KF6A 2XAQB 2ODUA 3P50A 4I0UA 5LHGB 3P4RA 5FYMA 3ONXA 4ILCA 5HEHA 3ZT5A 2K5BB 5LXTE 4MALA 2XQ3A 2CPTA 5F3JA 5JR9A 2DLRA 5JDQA 4DIDB 3RH3A 4DR1T 4CI3B 2CXDA 2A2FX 1XWMA 4PK6A 5J2TE 2XM1A 4Z91A 3SWHA 2BKOA 4OK0A 4XTCN 4HFDA 4JI4T 2J4GA 2WWUA 2XQ7A 1IZNB 2XM2A 1D0YA 2YDQA 4HWIB 4O2AE 5IHYA 1HNWT 4WBOA 4NXMT 2IHR1 3U3IA 4EYYR 2JQQA 4U72A 3SRZA 1IBMT 2W63A 3PU3A 4GIWA 2X66A 3AB3B 1YD8G 4O4IE 4YFSA 2UXDT 4EZHA 3NBXX 5FNVE 4I55E 4OYJA 5HXRA 4U3CA 2W00A 2XTLA 2DWKA 3AVRA 2VURA 3ZMSB 3CQCB 4CZZB 4IDQA 2BS4A 1OEDC 2YEVC 3ZLIA 3ZYLA 3P4PA 3GMIA 3QUJA 4IDPA 4JEUB 4BAYB 4HWDA 4B3RT 5LA6E 3NWIA 3AEGA 3LJCA 4F8HA 5AFUL 3FHNA 5LJNA 2IAKA 3HKBE 2IDOB 4LF5T 3TLTA 3K8PC 2Q9QD 3PUYG 3MXZA 2VWAA 4KBMB 2NW7A 1UK5A 4L5GA 4L9IA 2LM2A 4QH1A 4X20E 1MMNA 2QVAA 3LBXA 4YTPA 5C3JA 4ZEYA 2WZHA 3F31A 3UUMA 1D1AA 4I50E 3RKOA 5L4EA 2UUBT 2I59A 4JUYA 5FVLA 3RIAA 3H3MA 3UULA 3FBLA 3I0QA 5FKYA 4DNDA 5ABFA 2WM9A 2OV9A 1IBLT 4IE5A 3ZMZB 4DR7T 3G06A 2LSJA 5L3EB 5JTGA 3HI2A 2KZ7B 2V5DA 2K3WA 5JDFA 1X9BA 2C0SA 3I1AA 4AKIA 5FY0A 5HWXA 2X0YA 5EK4A 1QUUA 3UUBA 4X1YE 4X66T 2OA5A 4PJNA 4WZXA 3L8RA 5JRCB 1XNRT 3HKCE 3A8YC 2E9XA 5ETWA 2LSYA 5IYZE 3AA1B 2HPLA 5H6RB 4AI6A 3FZKB 3I9WA 3C50A 2KNDA 2W2UA 3WI3A 2EHOC 2RPAA 1S35A 3AEDA 4X64T 3PTRB 4LFBT 1BR1A 1I6ZA 2D2SA 1OEDA 2WU5A 3AE9A 4QKNA 4A97A 4E7SA 2BBHA 4ZI3C 3B13A 3E22E 1HG5A 4GK0E 3NZPA 4HWHA 3CVRA 3JAFA 5L4HA 4ASKA 5JDGA 3CPZA 5L47A 5LHHB 4DUYT 2CEAA 2UXBT 1HS7A 3ZN1B 2YINA 3O1IA 2AE9A 3Q5DA 4ISSA 5FP3A 3SFDA 3TLWA 5FL1A 4ILBA 5CA1E 4KI0G 4U7YA 4LF7T 4PJJA 1IBKT 3O1JA 5AQRB 2VQFT 3PUVG 4YTMA 3C4WA 2ONKC 3ZYKA 3RLFG 2H88A 2WDVA 3CQXC 1T72A 4X65T 4GKJT
chains in the Genus database with same CATH topology
3PUYF 2R6GF 4YMWC 4YMTB 3PV0G 4YMSC 3PUVF 3PUZF 4KHZG 3D31C 3PUYG 4XTCM 3TUIA 3DHWA 4TQUM 4XTCN 3PUXG 4KI0F 4TQUN 4KHZF 4JBWG 3RLFF 3PUWF 4XIGM 3PUXF 2R6GG 4KI0G 3PV0F 4JBWF 4YMUC 4XIGN 3TUJA 3PUVG 2ONKC 4YMVC 3RLFG 3TUZA 3PUWG 3PUZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY F;  2R6G F;  4YMW C;  4YMT B;  3PV0 G;  4YMS C;  3PUV F;  3PUZ F;  4KHZ G;  3D31 C;  3PUY G;  4XTC M;  3TUI A;  3DHW A;  4TQU M;  4XTC N;  3PUX G;  4KI0 F;  4TQU N;  4KHZ F;  4JBW G;  3RLF F;  3PUW F;  4XIG M;  3PUX F;  2R6G G;  4KI0 G;  3PV0 F;  4JBW F;  4YMU C;  4XIG N;  3TUJ A;  3PUV G;  2ONK C;  4YMV C;  3RLF G;  3TUZ A;  3PUW G;  3PUZ G; 
#chains in the Genus database with same CATH topology
 4LFC T;  3EVY A;  2A3D A;  2LLY A;  3EHZ A;  3ZT7 A;  5HEU A;  4E7Z A;  2E2A A;  1T98 A;  4HN9 A;  2WU2 A;  2FJB A;  3EUH A;  1MMG A;  2BG9 E;  3BQK A;  3HL6 A;  4GKK T;  2WB5 A;  3SS1 A;  2D9D A;  4ILA A;  5CFB A;  3C4X A;  2BS2 A;  4IL9 A;  1FEW A;  4DV2 T;  1WR6 A;  2VKH A;  3P7I A;  3PDY A;  4DMW A;  4EEB A;  1N32 T;  3OPC A;  4TQU M;  2J1D G;  3UT5 E;  5CA0 E;  3CQG B;  4P0B A;  3OVU A;  4KI0 F;  4YTN A;  4EV6 A;  2D0T A;  4O2B E;  4AIU A;  3WAJ A;  1S94 A;  5JDH A;  1HG2 A;  2B1E A;  2WDR A;  3SOL A;  2QYW A;  3JAD A;  4KX6 A;  3HKE E;  4J2C A;  4NUV A;  4UF0 B;  1HF8 A;  4XIG M;  3BQL A;  2E9X B;  4P09 A;  5AQJ B;  1XDP A;  4DV6 T;  2W4X A;  3C98 B;  2I6H A;  2LHN A;  4ZI2 C;  1XNQ T;  4H63 H;  4Z8X A;  4DO0 A;  1KK7 A;  2N1G A;  1W09 A;  3PUS A;  3WAK A;  4ZI7 E;  2LHR A;  2W67 A;  2R6G F;  5CGM A;  3UQ7 A;  2LOP A;  4U2Y A;  5AQO B;  3AA0 B;  3TLV A;  5LGT B;  4YJ3 E;  4HFC A;  5LYJ E;  5E0O A;  3PUZ F;  4QX8 B;  2LKH A;  4JI5 T;  2W62 A;  2V1D B;  3AXJ B;  3N9M A;  4PK5 A;  3RYC E;  5IUX A;  5ABE A;  2XSB A;  4OHF A;  1U5P A;  2V5C A;  3DHW A;  2VL8 A;  2YDS A;  2UU9 T;  3RQU A;  4LF9 T;  4EAH A;  2LM9 A;  1OXZ A;  4A56 A;  3KFW X;  2MTQ A;  2LT3 A;  2FJA A;  2MPK A;  2WZI A;  3CIR A;  3ZC1 A;  5EZY E;  3ZC0 A;  1LKX A;  2KSR A;  1VCS A;  4ZS3 A;  1FMV A;  2V7M A;  5AQP B;  5F8P A;  3E0Z A;  2HHH T;  3IF8 B;  2V7K A;  4QXB B;  3ZT6 A;  2JQ9 A;  3ANW A;  3O4X E;  4HKA A;  2VQE T;  3VKG A;  4YMU C;  3LK3 B;  2ZM2 A;  2BG9 C;  3QB5 A;  2C5K T;  5AQQ B;  3ZSS A;  1VOM A;  4PFO A;  4CXX A;  2Y8D A;  1XMQ T;  2XQ6 A;  3GN5 A;  4O4J E;  3BK9 A;  4M1P A;  4EXT A;  4YHH T;  2P9B A;  2WDQ A;  4EZ4 A;  4GOU A;  3P8C D;  5JRE A;  3IBP A;  3PUV F;  3UFE A;  1D1C A;  2NTY A;  3NRX A;  3RC3 A;  3C4Z A;  4G63 A;  2D5U A;  2FJE A;  3A5X A;  4DUZ T;  3K3N A;  4K0K T;  2CLY C;  4B3M T;  3LG7 A;  3N9Q A;  4HFH A;  5BR8 T;  1W0B A;  4LF4 T;  4GYR A;  2UXN B;  2CWY A;  3MZK B;  2AXD S;  4TQU N;  2JPF A;  2CE7 A;  2E8I A;  1Z0P A;  1N34 T;  4DV4 T;  3RYI E;  3UQ4 A;  4U2Z A;  2NP9 A;  2MOZ A;  2RA1 A;  4YSZ A;  3PUX F;  2R6G G;  3AEA A;  3AEE A;  3PJA J;  3CX8 B;  4IE6 A;  2E9X D;  2H3R A;  2XAH B;  1MMA A;  3AE8 A;  3C64 A;  2HN1 A;  2CBI A;  4TWF A;  5JRC A;  1E1H B;  3MA9 A;  2CCQ A;  3AE4 A;  3UU6 A;  4AQF A;  3AXJ A;  5HXH A;  3HKD E;  3Q5W A;  4IIJ E;  5A1L A;  4AQF C;  4EB6 E;  1YKE B;  2Q9Q C;  3ZPO A;  1YQ4 A;  5C8Y E;  1D1B A;  3VU7 H;  4GYS A;  2UXC T;  1BR4 A;  2EHO B;  2QGS A;  3RPU A;  2UUA T;  2CA5 A;  4IDO A;  4JI2 T;  2MYS A;  4HWF A;  4IE0 A;  1ZEE A;  2BZB A;  3Q5E A;  4N78 D;  4QXH B;  4ZZB A;  3OYX A;  2Y6X A;  3IHR A;  1QSD A;  3RIU C;  1YXR A;  3IA3 A;  1SE7 A;  4O8S A;  4OYK A;  5AQM B;  2VB6 A;  5AQU B;  4JI1 T;  4LMK A;  2HH7 A;  2CMR A;  3QNU A;  2ZM6 T;  3NKZ A;  4U7I A;  4UXN B;  4HFB A;  3JAE A;  4UVA B;  4DBQ A;  2XQ4 A;  5LMU T;  4DV0 T;  5CB4 E;  1Y64 B;  3NRY A;  3FBZ A;  4UV9 B;  3EDV A;  3MAC A;  1MIW A;  1OWA A;  3L3P A;  3EDU A;  5LBM A;  4YSY A;  1WYC A;  3TUJ A;  2DI4 A;  2BBJ A;  2CXF A;  3C51 A;  3ESL A;  5HCJ A;  4ERR A;  4YXD A;  5HXC A;  3F57 A;  3PUW G;  2UXX B;  1E2A A;  3VRA A;  4EGW A;  3ZN0 B;  3RQW A;  4YMT B;  3DJB A;  3PJA A;  4TX5 A;  4H9N C;  3GA8 A;  1HX8 A;  3JC6 C;  4LF6 T;  4DVD A;  3Q5X A;  3TLS A;  3ZMV B;  4BJN A;  3GN5 B;  4CN6 A;  2KMF A;  3KIN B;  1SHZ C;  5ABG A;  3QOF A;  3SFE A;  1HTJ F;  4NUU A;  4JV5 T;  3N9N A;  4QX7 B;  3VKH A;  5FY7 A;  2WWV A;  4B6X A;  3OJA A;  3PUX G;  3VR8 A;  2WMN A;  3AE5 A;  3UU8 A;  3VR9 A;  4NIQ A;  5AQI B;  4QWN B;  2DNX A;  1ZKE A;  5ABH A;  2K9A A;  4HGA A;  5L3D B;  3RLF F;  2WQY A;  3M65 A;  4TNV A;  5FMN A;  1NWM X;  2XPK A;  4TNW A;  4PNI A;  5F5W A;  3A7M A;  3RIF A;  3JCF A;  4QH4 A;  1HR0 T;  3AEC A;  2X9X A;  4DV1 T;  4KP3 C;  2NTX A;  3AE6 A;  2KT9 A;  3T1Y T;  2H7V C;  5JDL A;  2ACZ A;  4LF8 T;  1U4Q A;  2VL0 A;  3ABV A;  4IL4 A;  5ABF B;  3NVO A;  4OFZ A;  3U78 A;  4DR6 T;  3RX6 A;  3VRB A;  3EAB A;  4H9P C;  4XZC A;  2E9X C;  3JC6 D;  4UEL A;  4AIS A;  3K3Q C;  2G0U A;  2XUE A;  5GON E;  3AVS A;  4DR3 T;  4V1A v;  1UUR A;  1G8X A;  2BKN A;  1Y01 A;  3AA7 B;  1IJ5 A;  4QH5 A;  3V5S A;  1G73 A;  4L0R A;  2BG9 B;  1BR0 A;  2LE8 A;  4IRE A;  1J5W A;  1N33 T;  2BG9 A;  4KHZ F;  3Q2M A;  4HFI A;  3RYH E;  4BA9 A;  4ZI3 D;  2XZE A;  4AXP A;  5AQK B;  3PUW F;  4UIG A;  1CHU A;  1FIO A;  4AQY T;  2WCA A;  2F4V T;  4AKH A;  4AKG A;  5J2U E;  2DHR A;  3ZJ1 A;  5C2T A;  4TWH A;  5FXX A;  2X9W A;  4JBW F;  1KNP A;  4ZHQ E;  5AQL B;  2FBW A;  2CXL A;  4YMV C;  5AQH B;  5BMV E;  2WBL A;  1R8I A;  2A9U A;  2DWG A;  2M67 A;  1ZP0 A;  3PUZ G;  4IDN A;  5EK2 A;  4AKR B;  4JI3 T;  2X9H A;  3CML A;  4AKL A;  4EOZ B;  3OYZ A;  4H9R C;  1VRB A;  3PV0 G;  3ZST A;  2NOX A;  1SUM B;  3UU3 A;  2IUB A;  3PUR A;  2VVN A;  3H3A A;  4KHZ G;  4YHJ A;  3PE0 A;  1T8B A;  3KV5 A;  5LG4 A;  2ACX A;  2A72 A;  2E5V A;  2JIW A;  3CX6 B;  3CX7 B;  4O4L E;  1J1J A;  2BKP A;  4UF0 A;  3TKL B;  3X1D A;  4DMV A;  2XAF B;  3UU4 A;  4CXY A;  4PJM A;  4ZS2 A;  3ZCJ A;  5KDM C;  1NEK A;  4JBW G;  2XQ8 A;  3K1S A;  2JQK A;  2WY2 A;  3K3O A;  4H9Q C;  5DQV A;  4X1I E;  3TLU A;  4YT0 A;  3KVB A;  3LDQ B;  3PUG A;  3AE7 A;  2C5I T;  4HFE A;  4TN7 B;  5J1G A;  4F6R C;  4FI5 A;  2M6B A;  5FXW A;  3QB5 K;  5TAO A;  2CRB A;  3PV0 F;  2ES0 A;  2YN6 A;  2JJ9 A;  2BVL A;  2XY8 B;  3FZF B;  4TWD A;  5M4Y A;  2Q9Q A;  3FZL B;  3BQI A;  1JNR A;  4EED A;  5LNK A;  5L3G B;  2LRK A;  5AQN B;  4CN4 A;  1HFA A;  2LEH A;  2WMO A;  3N9O A;  4HEA A;  4IST A;  1EZ3 A;  4LMJ A;  4FJO A;  3ZCI A;  5JDM A;  4IT4 A;  5ADX L;  4LFA T;  2W66 A;  2VAS A;  3KDS E;  2B76 A;  2YDR A;  5FXV A;  2IW5 B;  5HYA A;  1L0V A;  1AJ3 A;  5FL0 A;  4KUM B;  4TV8 E;  2VKJ A;  2LRL A;  2HPJ A;  2H89 A;  2I0M A;  2JRK A;  2NR4 A;  2YU2 A;  2ZM0 A;  3LSV A;  4EYU A;  2IC6 A;  2CHN A;  1UCU A;  3ANW B;  3RRW A;  4NXN T;  2XAS B;  1OED B;  3FXD B;  3MKD A;  4PAG A;  3RKG A;  2VKO A;  4C91 A;  3CWZ B;  3T8O A;  4IDZ A;  1MNE A;  3RI5 A;  1XMO T;  1UX4 A;  3QK6 A;  2V8S V;  1MMD A;  2DL1 A;  1WRD A;  1NAF A;  1X79 A;  2VK9 A;  4IGU A;  2ZMA A;  3AAI A;  5AQV B;  5LJM A;  5EK3 A;  1D0Z A;  1FMW A;  3I9Y A;  1B7T A;  4JI0 T;  5HEO A;  4YLH A;  4OX9 T;  4KMC A;  1VCT A;  3MJX A;  3N2O A;  3AE1 A;  3OBV E;  1MND A;  3S4U A;  4YSX A;  3LBX B;  5LCY A;  1T7S A;  4DR4 T;  4YMS C;  3FZM B;  4NPP A;  5FVK A;  4XBF B;  3LFM A;  1HNX T;  4COF A;  4UEM A;  5LP6 E;  3UUX B;  5JH7 E;  2K24 A;  1WLX A;  2GK9 A;  2QRX A;  3CK6 A;  3ETU A;  1LVF A;  3QC9 A;  4X1K E;  4QHO A;  2JMK A;  4ZOL E;  3R6N A;  4ADZ A;  5KXJ A;  5LOV E;  5LB7 B;  5FXZ A;  3UU5 A;  3RHW A;  3LK4 2;  2Z6E A;  3UTK A;  2XJ7 A;  1M62 A;  1ZHC A;  5HCM A;  4HFV A;  1HNZ T;  4B3S T;  2LJL A;  3RC8 A;  4WBN E;  1DU2 A;  4ZZC A;  3LK2 B;  2L9Q A;  3OTO T;  2XQ9 A;  1V9D A;  4MFR A;  2CWO A;  4ILU A;  1H7C A;  2XQA A;  3AA6 B;  1YKH B;  4WNK A;  5HAX A;  5JVD E;  3I0O A;  5JR9 C;  1E7P A;  2V6X A;  2E5L T;  4TV9 E;  3AEB A;  4YJ2 E;  3P4Q A;  3ZJ2 A;  4MHC A;  3ZMU B;  4B3T T;  3NZQ A;  1FJG T;  2KXP B;  2XSA A;  1OED E;  4YMW C;  4P0A A;  2LKG A;  5LBQ B;  5LGN B;  3J9X 1;  1YW0 A;  2EHO D;  2NW8 A;  2QA7 A;  3HR0 A;  1I94 T;  2CBJ A;  4DR5 T;  1W0A A;  2N2N A;  1JNZ A;  2WS3 A;  5DJQ C;  2L8K A;  1KNR A;  4XTC M;  3FXE B;  2LSG A;  1LVK A;  2FUP A;  3ONJ A;  2IC9 A;  2W61 A;  1WFD A;  2V7I A;  2VVS A;  4HWC A;  3ETV A;  4K0U A;  4CXW A;  3O1H A;  4UVC B;  2WP9 A;  1UUS A;  1Z8U A;  2VKD A;  5HXE A;  2JMH A;  4H9O C;  4EIW A;  2MBG A;  5IWA T;  3RIU A;  3MK7 C;  4PFP A;  2WSS V;  4IHJ E;  1CUN A;  2J47 A;  4UV8 B;  2V7L A;  4WYV A;  5H6Q B;  3ZKR A;  5L3C B;  5J0Z A;  2BVM A;  3ONL C;  2XAJ B;  4QXC B;  3RYF E;  4JYA T;  2KWI B;  2XHE B;  2LSK A;  2M6I A;  4X62 T;  2V7J A;  3P4S A;  3ZEF B;  1J5E T;  2X0L B;  2D0U A;  3B57 A;  3DP7 A;  3ZMT B;  2V26 A;  5KMG P;  3GWH A;  2ZM8 A;  3KVA A;  3L39 A;  3N5L A;  3AE3 A;  4P1N A;  2Y48 B;  4DR2 T;  1BR2 A;  4DBR A;  3H37 A;  5LG3 A;  3FZH B;  5LGU B;  4JI8 T;  4ANJ A;  3D31 C;  4JLE A;  3N9P A;  4UVB B;  4UR9 A;  3W15 B;  2DCF A;  3PUA A;  3TUI A;  2W0G A;  1SA0 E;  2BDE A;  1HX1 B;  3L09 A;  2H7O A;  1ZV4 X;  2J62 A;  1O3X A;  4Z90 A;  2V6Y B;  4CI2 B;  2BS3 A;  1HCI A;  3T1H T;  4O4H E;  2IIU A;  4I4T E;  4ZXL A;  1D0X A;  1KEY A;  3PUQ A;  4U74 A;  1GQE A;  2X68 A;  2SPC A;  3E08 A;  4C90 A;  5AQT B;  4ZI2 D;  1US7 B;  4X5T A;  3AAE B;  1LRZ A;  4HE8 A;  5CJ5 A;  4XIG N;  3KBU A;  5JR9 B;  2C5J A;  1MIV A;  2CHO A;  2OLT A;  2KLQ A;  2X51 A;  3AEF A;  4JI7 T;  1XZY A;  1WYB A;  2LOS A;  2YU1 A;  1M7K A;  3EI0 A;  3KV9 A;  4HTE A;  4MBQ A;  2N9D A;  4A98 A;  1NEN A;  2Q9Q B;  2PTF A;  3M3Z B;  4JI6 T;  2XQ5 A;  3RGL A;  4JEH B;  5LMN T;  2UUC T;  3DTO A;  4MLK A;  5KX5 E;  4H9S E;  1ZOY A;  4PW8 A;  2LSI A;  5AQG B;  3VHL A;  1UX5 A;  2X9Y A;  2YOE A;  3N9L A;  4I43 B;  3UUN A;  5DAB A;  5L3B B;  1XDO A;  4LML A;  5HEJ A;  1N36 T;  3ZYM A;  1KNZ A;  5AQF B;  1YQ3 A;  1WR0 A;  1MIY A;  4BJM A;  1QLB A;  2ZLY A;  3P4W A;  4U31 A;  2PFV A;  5DQW A;  3J7Y q;  5LHI B;  2FJD A;  2YKS A;  1UGO A;  4A5X A;  1IAP A;  3CKD A;  3Q9D A;  5JDN A;  4G2A A;  3RRC A;  3N2K E;  3KBT A;  4GK5 E;  4IE4 A;  3FB2 A;  3N2G E;  2KWH A;  4XAX B;  1KFY A;  4YY3 T;  3TUZ A;  3PU8 A;  2RP4 A;  3RF1 A;  4U33 A;  4DV3 T;  3PUY F;  2MAW A;  3OKQ A;  5L3F B;  3KV6 A;  3AAA B;  2WAU A;  5JQG E;  3B5M A;  1IJ6 A;  5L2L A;  1WCR A;  2K48 A;  2XAG B;  1W9R A;  3HA4 A;  4CI1 B;  2CLY B;  2HN2 A;  4H63 V;  4AQG A;  4DV7 T;  3F2E A;  3D0T A;  3EAM A;  3UFG A;  5HXS A;  2IML A;  2JQH A;  2L3L A;  2NW9 A;  4PK4 A;  3KV4 A;  4Q25 A;  4TZ4 C;  2PJQ A;  4IE7 A;  5HWY A;  2X0H A;  4CQI A;  4KHP T;  2PG8 A;  3IEE A;  4CN1 A;  2CM0 A;  3V5U A;  2X67 A;  2XQY A;  3AE2 A;  4WW0 A;  3R84 B;  5FY1 A;  2ODV A;  2KIN B;  3O9X A;  4DV5 T;  2PBI A;  2V6Y A;  2YK0 A;  4PJL A;  4TUY E;  5AQS B;  5HEG A;  2EHO A;  2NWB A;  1KF6 A;  2XAQ B;  2ODU A;  3P50 A;  4I0U A;  5LHG B;  3P4R A;  5FYM A;  3ONX A;  4ILC A;  5HEH A;  3ZT5 A;  2K5B B;  5LXT E;  4MAL A;  2XQ3 A;  2CPT A;  5F3J A;  5JR9 A;  2DLR A;  5JDQ A;  4DID B;  3RH3 A;  4DR1 T;  4CI3 B;  2CXD A;  2A2F X;  1XWM A;  4PK6 A;  5J2T E;  2XM1 A;  4Z91 A;  3SWH A;  2BKO A;  4OK0 A;  4XTC N;  4HFD A;  4JI4 T;  2J4G A;  2WWU A;  2XQ7 A;  1IZN B;  2XM2 A;  1D0Y A;  2YDQ A;  4HWI B;  4O2A E;  5IHY A;  1HNW T;  4WBO A;  4NXM T;  2IHR 1;  3U3I A;  4EYY R;  2JQQ A;  4U72 A;  3SRZ A;  1IBM T;  2W63 A;  3PU3 A;  4GIW A;  2X66 A;  3AB3 B;  1YD8 G;  4O4I E;  4YFS A;  2UXD T;  4EZH A;  3NBX X;  5FNV E;  4I55 E;  4OYJ A;  5HXR A;  4U3C A;  2W00 A;  2XTL A;  2DWK A;  3AVR A;  2VUR A;  3ZMS B;  3CQC B;  4CZZ B;  4IDQ A;  2BS4 A;  1OED C;  2YEV C;  3ZLI A;  3ZYL A;  3P4P A;  3GMI A;  3QUJ A;  4IDP A;  4JEU B;  4BAY B;  4HWD A;  4B3R T;  5LA6 E;  3NWI A;  3AEG A;  3LJC A;  4F8H A;  5AFU L;  3FHN A;  5LJN A;  2IAK A;  3HKB E;  2IDO B;  4LF5 T;  3TLT A;  3K8P C;  2Q9Q D;  3PUY G;  3MXZ A;  2VWA A;  4KBM B;  2NW7 A;  1UK5 A;  4L5G A;  4L9I A;  2LM2 A;  4QH1 A;  4X20 E;  1MMN A;  2QVA A;  3LBX A;  4YTP A;  5C3J A;  4ZEY A;  2WZH A;  3F31 A;  3UUM A;  1D1A A;  4I50 E;  3RKO A;  5L4E A;  2UUB T;  2I59 A;  4JUY A;  5FVL A;  3RIA A;  3H3M A;  3UUL A;  3FBL A;  3I0Q A;  5FKY A;  4DND A;  5ABF A;  2WM9 A;  2OV9 A;  1IBL T;  4IE5 A;  3ZMZ B;  4DR7 T;  3G06 A;  2LSJ A;  5L3E B;  5JTG A;  3HI2 A;  2KZ7 B;  2V5D A;  2K3W A;  5JDF A;  1X9B A;  2C0S A;  3I1A A;  4AKI A;  5FY0 A;  5HWX A;  2X0Y A;  5EK4 A;  1QUU A;  3UUB A;  4X1Y E;  4X66 T;  2OA5 A;  4PJN A;  4WZX A;  3L8R A;  5JRC B;  1XNR T;  3HKC E;  3A8Y C;  2E9X A;  5ETW A;  2LSY A;  5IYZ E;  3AA1 B;  2HPL A;  5H6R B;  4AI6 A;  3FZK B;  3I9W A;  3C50 A;  2KND A;  2W2U A;  3WI3 A;  2EHO C;  2RPA A;  1S35 A;  3AED A;  4X64 T;  3PTR B;  4LFB T;  1BR1 A;  1I6Z A;  2D2S A;  1OED A;  2WU5 A;  3AE9 A;  4QKN A;  4A97 A;  4E7S A;  2BBH A;  4ZI3 C;  3B13 A;  3E22 E;  1HG5 A;  4GK0 E;  3NZP A;  4HWH A;  3CVR A;  3JAF A;  5L4H A;  4ASK A;  5JDG A;  3CPZ A;  5L47 A;  5LHH B;  4DUY T;  2CEA A;  2UXB T;  1HS7 A;  3ZN1 B;  2YIN A;  3O1I A;  2AE9 A;  3Q5D A;  4ISS A;  5FP3 A;  3SFD A;  3TLW A;  5FL1 A;  4ILB A;  5CA1 E;  4KI0 G;  4U7Y A;  4LF7 T;  4PJJ A;  1IBK T;  3O1J A;  5AQR B;  2VQF T;  3PUV G;  4YTM A;  3C4W A;  2ONK C;  3ZYK A;  3RLF G;  2H88 A;  2WDV A;  3CQX C;  1T72 A;  4X65 T;  4GKJ T; 
#chains in the Genus database with same CATH homology
 3PUY F;  2R6G F;  4YMW C;  4YMT B;  3PV0 G;  4YMS C;  3PUV F;  3PUZ F;  4KHZ G;  3D31 C;  3PUY G;  4XTC M;  3TUI A;  3DHW A;  4TQU M;  4XTC N;  3PUX G;  4KI0 F;  4TQU N;  4KHZ F;  4JBW G;  3RLF F;  3PUW F;  4XIG M;  3PUX F;  2R6G G;  4KI0 G;  3PV0 F;  4JBW F;  4YMU C;  4XIG N;  3TUJ A;  3PUV G;  2ONK C;  4YMV C;  3RLF G;  3TUZ A;  3PUW G;  3PUZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...