3PUXF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
494
structure length
490
Chain Sequence
b'WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 151
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puxF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puxF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puxF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puxF02
4YMSC 3RLFG 2R6GG 4KI0F 3PUVF 4KI0G 3PUVG 4TQUM 3PUXF 4XTCN 4YMUC 3PV0F 3PUXG 4YMVC 3TUIA 3PUYF 4XIGM 3PV0G 4KHZF 4TQUN 3PUYG 3PUZF 4YMTB 3TUZA 4KHZG 4YMWC 3DHWA 4JBWF 3TUJA 3PUZG 4XIGN 2ONKC 4JBWG 3PUWF 3RLFF 3PUWG 3D31C 2R6GF 4XTCM
chains in the Genus database with same CATH superfamily
4ZHQE 2V7LA 5JDMA 2C5IT 3FZFB 4DBQA 2V7MA 4ZS2A 3FXEB 4WBOA 3KVBA 5FVKA 4B3RT 4JUYA 3KVAA 1J1JA 2CPTA 4QHOA 3RIUA 4O4IE 1D0XA 3RYFE 4YY3T 3ETVA 3A8YC 5JRCB 2XPKA 5FP3A 3OYZA 5DQVA 1N34T 3O1IA 4J2CA 4X1YE 2Y8DA 3ZC0A 2BG9A 2X51A 2M6IA 3TUIA 4C91A 2P9BA 2V5DA 4TV8E 1QSDA 2YINA 3MACA 2X9XA 5KXJA 2BKNA 4JI4T 2LSIA 4IE4A 4IGUA 3KINB 1WLXA 1IBKT 4QH4A 2XQ6A 2NTXA 4I4TE 4X5TA 4HKAA 4ILCA 2AXDS 2V5CA 4HFCA 3PU8A 1M62A 5LHIB 2Y48B 2PBIA 4QH5A 2X9WA 3N9QA 1LRZA 4IT4A 3O9XA 4WW0A 2QVAA 3IEEA 2UXCT 2JQQA 3AEFA 5LGUB 1WR0A 4NUVA 1FJGT 4NUUA 3C50A 4ZI3D 5JDFA 1DU2A 2XTLA 3SS1A 1IZNB 4TUYE 2ACZA 3EABA 2NR4A 4CI2B 4EB6E 2ONKC 3FHNA 2XQ4A 2ACXA 2UU9T 3RIFA 1IJ6A 2C5JA 1KEYA 4V1Av 5AQKB 2KWIB 3UFEA 3OYXA 1ZV4X 4HN9A 1IBLT 3IHRA 2X0LB 5EK4A 1HCIA 2XHEB 3ONLC 4ISSA 2KT9A 4DR7T 4TQUM 4H9QC 3EAMA 4YTNA 5F5WA 3B5MA 3PUYF 2LHRA 1UX4A 4YSXA 2UXNB 2HH7A 2A2FX 2WMNA 1X9BA 2Q9QD 2WM9A 4TNWA 4CN6A 4ZS3A 4DO0A 4JI5T 2HPJA 4JI7T 4B3TT 2E5LT 5L4HA 2LSGA 4EV6A 4GK5E 4IE0A 1LVKA 3DHWA 2LEHA 3N2GE 3O1JA 4ZXLA 2M67A 1HX1B 4O2AE 3AE4A 3N9MA 3I0OA 4B3ST 3ZC1A 2JMHA 5J2UE 3AE1A 4H9PC 4YMUC 3PJAJ 4DV7T 3NZPA 3X1DA 4TWHA 3PUYG 4U2YA 4PNIA 2OA5A 2ES0A 3UQ7A 2I0MA 2CCQA 1HG2A 2RPAA 3ONJA 3MK7C 5HEOA 1T8BA 4DV6T 2YEVC 5LXTE 3OJAA 5JVDE 1MIWA 3WI3A 3E0ZA 5IUXA 5JH7E 3UUXB 3RF1A 5LCYA 3NBXX 3VRAA 4IL9A 3VHLA 4JEUB 3RLFF 3CVRA 3M3ZB 4KI0F 2XUEA 5FY1A 3C4WA 4ZEYA 3QC9A 2WQYA 5FXWA 4JI0T 3CX8B 4DV1T 5LGNB 2CMRA 1YQ3A 1SA0E 2UXXB 1CHUA 5CJ5A 3MZKB 3CIRA 4ISTA 5HEHA 5CA0E 3FBZA 4BJMA 4IDNA 2JQKA 4JV5T 4O8SA 5HAXA 1XWMA 2VVSA 4P0AA 4TNVA 1HF8A 5AQUB 4L0RA 3N2OA 2NW7A 2Z6EA 3R84B 5HYAA 4KI0G 2A9UA 4CXWA 4XTCN 3AVRA 2DCFA 4U33A 4YSZA 2Q9QA 3UTKA 1M7KA 3FZKB 2J4GA 3ZN1B 4JBWF 3PDYA 5AQJB 5KDMC 1SE7A 3AE9A 2D0UA 2M6BA 4K0KT 5JR9B 3EHZA 4UEMA 2IC6A 5JQGE 3JAEA 1LKXA 4EXTA 4YMTB 2VKJA 3E08A 3HKEE 4I55E 1HNZT 1Z0PA 5FMNA 4O4HE 1UCUA 1V9DA 1G8XA 5GONE 3TLSA 4BJNA 5FXZA 3ANWA 1N32T 5JR9A 4UXNB 1OEDE 3GMIA 3ZYMA 3AEEA 3IA3A 4YJ3E 1MNEA 5DABA 2IIUA 4OFZA 3C64A 5FY0A 4H9RC 1KNRA 2NP9A 1ZHCA 1U5PA 3FZHB 4CXXA 4YFSA 3KV9A 3AA1B 2W00A 2V7IA 4HWIB 5HCMA 2HN1A 1R8IA 3LK3B 5AQNB 2XAQB 2X68A 3HA4A 4DV0T 4DR4T 3Q5XA 4IIJE 3P4QA 1MIYA 4DVDA 3GWHA 2CWOA 4PW8A 3TLTA 3WAKA 2BG9E 4JI6T 3PUSA 5ABEA 4DMVA 2H3RA 5JTGA 2VL8A 2BS4A 2YOEA 3BQIA 2LSYA 2CLYC 3K3OA 1ZKEA 3K3QC 4QXCB 4DBRA 1NEKA 5C3JA 4YJ2E 2JQ9A 5HWYA 2KNDA 5LBMA 5LMNT 2V26A 4IDQA 4IHJE 4AI6A 2N9DA 4HWCA 2QRXA 4IE5A 2L8KA 3UU6A 3LFMA 3O1HA 2LOPA 3D0TA 5KX5E 2BVLA 3A7MA 4B6XA 2YKSA 2FBWA 3I1AA 4GKJT 1UGOA 2FJAA 4TQUN 3PUZF 1KK7A 4KX6A 3ZMSB 5JR9C 3H3AA 4OYKA 4LF6T 3RPUA 3IF8B 2V6YB 1OWAA 4DMWA 3AA0B 1OEDA 2V6XA 3AA7B 3AVSA 2WDVA 5JDQA 4KHZF 2CXLA 2RA1A 2BG9B 4E7SA 4GIWA 4DUZT 1I94T 4ERRA 4IREA 3SWHA 3L8RA 5EK2A 3CWZB 2HHHT 4HWFA 4OHFA 4NXMT 3JC6D 4KBMB 2V1DB 3JCFA 3OVUA 2BKPA 4ZI7E 2D0TA 2NTYA 2RP4A 3T1HT 5ADXL 2V6YA 2XQ7A 1ZP0A 1XMOT 2XSBA 1ZOYA 3MKDA 4O2BE 2LOSA 3GN5B 3AE8A 2E9XD 3AAEB 1ZEEA 1SHZC 3ZYKA 1YW0A 1YKHB 3C98B 3RKGA 2CHNA 2PTFA 5FYMA 3P4PA 4QXHB 3A5XA 2WDRA 1US7B 3AXJA 4DR2T 4U72A 3MA9A 3M65A 4AKRB 4KUMB 4IDPA 3RI5A 4UVCB 3GN5A 4P09A 4HFVA 1NWMX 4HTEA 1XZYA 4P1NA 3EVYA 1MMNA 1MMAA 4CZZB 5LJNA 4H63V 5FVLA 2UXDT 4ZI2D 3NRXA 3RQWA 3HL6A 4JI8T 2VKDA 5DJQC 1MIVA 2GK9A 2H88A 4AQYT 2NOXA 5KMGP 5EZYE 4LF8T 2WZIA 4GKKT 5AQIB 5L2LA 5LBQB 4LF4T 3AE2A 3EI0A 5H6QB 2X9HA 3TUZA 5L3EB 5L4EA 4ASKA 2WZHA 3TLVA 4WNKA 3AAAB 4EOZB 2LSKA 1UK5A 4HFHA 5LNKA 3HKBE 2CWYA 4O4LE 4DR6T 3RIUC 2VK9A 3EUHA 1WR6A 2JJ9A 4YXDA 1D1AA 1O3XA 1MMGA 2YDRA 3C4ZA 4KP3C 2CHOA 3UULA 3AECA 2N2NA 5HXEA 4PK5A 5LB7B 1FMVA 4CN1A 1E2AA 3EDUA 4UV9B 3NRYA 2BG9C 2FJEA 3F2EA 3ZT5A 2EHOD 3L3PA 3VKGA 4DV3T 3L09A 2CBIA 1HFAA 4H63H 3QK6A 2E9XA 1AJ3A 1Y64B 2WP9A 4HWDA 2LT3A 4DUYT 4JYAT 4UVBB 1T98A 4HFEA 3ZEFB 4LF5T 2CBJA 2YK0A 2ZM2A 4FI5A 2V7JA 3QOFA 5AQQB 2CXDA 4LMKA 5C2TA 1KFYA 3AE5A 3ZSTA 5C8YE 3AE7A 1KF6A 4XBFB 3AEBA 3DJBA 4X20E 4AKGA 1S94A 2H89A 3KDSE 3AE6A 5AQFB 2Y6XA 2MTQA 4YHHT 2PJQA 5IHYA 1BR2A 5L3DB 3VRBA 2J47A 1BR4A 2ODVA 5FNVE 3ESLA 4DR1T 3QUJA 4WYVA 5AQLB 2W61A 2X9YA 2IDOB 2CRBA 4NXNT 2H7VC 4M1PA 3MXZA 3CX7B 3V5SA 2XQ8A 1HG5A 4X62T 1W9RA 5LHHB 2JRKA 3AB3B 2YN6A 4AQFA 3W15B 3LBXA 3R6NA 2CA5A 4CI3B 3I0QA 4UELA 1HNWT 3UFGA 1EZ3A 4AKLA 3P4SA 5FKYA 4PFOA 4AISA 2WMOA 5TAOA 2HPLA 1H7CA 4IL4A 2Q9QB 4HEAA 3N9LA 4LF9T 5BMVE 2WB5A 1XMQT 4ZZBA 5A1LA 4A56A 3OPCA 2XSAA 3OTOT 2LM2A 1FMWA 4UR9A 3ZMZB 4GOUA 5JREA 3L39A 2XM1A 2DNXA 2WWVA 2MYSA 1GQEA 4XAXB 3KBTA 4DR5T 2CM0A 5AQMB 3PU3A 3RLFG 4KMCA 2W67A 4JLEA 3ZCIA 4NIQA 2EHOA 4B3MT 3K8PC 3UUBA 4IDZA 4UF0B 4MALA 1XNQT 2IUBA 2W4XA 4YTMA 5HXHA 4CXYA 4ILBA 4QWNB 1YXRA 5AQTB 3ANWB 5M4YA 4LMLA 2PG8A 3QB5K 2B76A 4X64T 3NZQA 2LJLA 2IAKA 4UV8B 3ONXA 2N1GA 1Z8UA 1U4QA 4A98A 4CN4A 4OK0A 5AQHB 1G73A 1HR0T 1YKEB 2XAGB 4UF0A 5L47A 4OYJA 1IAPA 4L9IA 1N33T 1XDOA 4JI2T 2I59A 4COFA 2FJDA 3LSVA 4ANJA 4HFBA 3RYIE 2IHR1 1WYBA 2XQYA 2D2SA 4L5GA 4JBWG 4ZI3C 3PUWF 4NPPA 4EEDA 3FBLA 3B57A 4PK6A 5IYZE 4FJOA 4AQFC 5HXCA 1B7TA 4AQGA 3N9OA 2JPFA 4LFCT 3RX6A 2WAUA 2YU1A 3AE3A 4MLKA 2W66A 5HEUA 2YU2A 5LGTB 4U2ZA 2DWGA 3TLWA 3LG7A 2KZ7B 4YTPA 4PFPA 3PV0F 2ZMAA 3AA6B 3BQLA 3Q5WA 5F8PA 2K3WA 4DNDA 1SUMB 2WDQA 4JI1T 3PE0A 3KFWX 3PUWG 5JDGA 4OX9T 1LVFA 2FJBA 2W63A 3CMLA 2JMKA 3RKOA 2Q9QC 2XM2A 4DV2T 4PJNA 5FL0A 5JDLA 4DIDB 4G2AA 4X65T 4H9NC 4N78D 5FY7A 5AQPB 3ZKRA 3I9WA 2VKHA 4QKNA 1T72A 1HNXT 1UUSA 2WSSV 2OLTA 5LP6E 2MBGA 2DLRA 4C90A 1VRBA 2ZM6T 3CK6A 3PV0G 3KV4A 4JI3T 1OEDB 4YMWC 3MJXA 1FEWA 3VR8A 3DP7A 3LJCA 1IJ5A 5ABHA 2LKHA 1E1HB 4ZOLE 4PK4A 2NW8A 5CGMA 4UIGA 1I6ZA 5AQSB 2WY2A 2X0HA 4U7IA 4AKIA 5ETWA 1QUUA 3ZMTB 5AFUL 3ETUA 2ZLYA 2FUPA 3F57A 3TKLB 5LG4A 3QNUA 1S35A 4Z91A 5AQGB 2E2AA 2A3DA 2DL1A 3LK42 4PJMA 3VKHA 2WWUA 2LSJA 3LDQB 4X1KE 4DV5T 2XQ5A 3P8CD 3BQKA 2HN2A 2BDEA 4YHJA 1FIOA 4CI1B 5ABFB 1UX5A 3PUZG 3AXJB 2I6HA 1W0AA 4LMJA 3RIAA 3PUQA 3PUVF 3FB2A 1JNRA 2G0UA 5FL1A 1T7SA 4KHZG 1XDPA 3ZJ1A 5LMUT 5AQRB 2X0YA 4Z8XA 2WU2A 5ABFA 5AQVB 1E7PA 4DR3T 2VKOA 4P0BA 3PJAA 4F6RC 2MOZA 4PAGA 4ILUA 2VURA 1MMDA 3CQXC 2VB6A 2YDQA 4EEBA 4PJLA 4ILAA 5F3JA 1BR0A 2WS3A 3HR0A 5J0ZA 5JRCA 3PUVG 2BS2A 4AXPA 1J5WA 2CXFA 2H7OA 4X66T 2KMFA 2VWAA 4X1IE 5HEJA 3AAIA 4TX5A 2LE8A 3B13A 3SFEA 5FXVA 3ZT7A 3OBVE 4G63A 3ZT6A 3ZCJA 1VCTA 1OEDC 2SPCA 2XQ9A 4YT0A 4TZ4C 3ZPOA 4CQIA 3ZMVB 5LHGB 3G06A 4U31A 3FZLB 3PURA 1OXZA 4Q25A 3ABVA 2NWBA 5HXRA 1WRDA 2LRLA 4E7ZA 2E9XB 2XASB 4BAYB 1NAFA 3RC8A 2UUBT 1QLBA 2QGSA 3ZSSA 2KLQA 3FXDB 3UUNA 4MBQA 2F4VT 3T1YT 2J1DG 4XIGM 3NWIA 4F8HA 2CE7A 2ZM0A 4H9OC 2JIWA 4TN7B 3AEDA 3LK2B 5HCJA 5ABGA 5DQWA 3GA8A 1KNZA 2CEAA 4QXBB 1IBMT 3UU4A 5HXSA 4Z90A 2D5UA 1BR1A 4I50E 1UURA 2VQFT 5JDHA 2XY8B 2MAWA 5CFBA 2IMLA 2DI4A 3H3MA 5FXXA 4YMSC 4I43B 4EYYR 3ZMUB 4EZHA 2ODUA 4XZCA 4A5XA 1D1CA 3RRCA 3LBXB 5H6RB 2XQAA 2LKGA 3RRWA 4LF7T 2E5VA 3PUGA 2KXPB 1N36T 2WBLA 4YSYA 2IC9A 3NKZA 3CQCB 3I9YA 3J7Yq 4K0UA 3UU5A 3C4XA 3CQGB 2KSRA 4ZZCA 3D31C 3IBPA 3S4UA 5LA6E 2X66A 1L0VA 2MPKA 4JEHB 3UU3A 4QH1A 1D0YA 2VL0A 4PJJA 2L9QA 3F31A 2EHOB 3HKDE 3HKCE 5HEGA 4TWFA 3JC6C 3AEGA 2K5BB 2VQET 2J62A 3TLUA 1Y01A 2R6GF 2KWHA 4LFAT 2DHRA 3ZYLA 3SFDA 3Q5EA 3PUXF 3H37A 4LFBT 3DTOA 4TWDA 2W2UA 3CX6B 1YD8G 2LLYA 5L3GB 3E22E 4HE8A 2E9XC 2UUCT 2W0GA 3N5LA 4AIUA 2CLYB 5LG3A 2VVNA 3RGLA 3PUAA 2KINB 3NVOA 5BR8T 3V5UA 4BA9A 3K1SA 4EAHA 2XJ7A 2QYWA 3RQUA 1WYCA 5J2TE 2R6GG 1VCSA 4GYSA 1HTJF 5IWAT 4EIWA 3RYCE 3PUXG 1CUNA 3N9PA 5LOVE 2A72A 2D9DA 4H9SE 2V8SV 2LHNA 1MNDA 3U3IA 3TUJA 4ADZA 4U3CA 2XAJB 4ZI2C 2XAFB 2BZBA 2X67A 4IDOA 4EGWA 4YMVC 3O4XE 5J1GA 2YDSA 1WFDA 2B1EA 4YLHA 4I0UA 2W62A 2JQHA 3UU8A 2XZEA 3C51A 2UXBT 5LJMA 4HFIA 5CB4E 2BBJA 4HGAA 2QA7A 3K3NA 3Q2MA 3VR9A 3KBUA 3OKQA 1HX8A 4GYRA 3AEAA 2E8IA 1HS7A 3ZLIA 4QX8B 3Q5DA 2NW9A 2V7KA 2PFVA 3UQ4A 3JAFA 2C0SA 4IE7A 3P4WA 3JADA 1VOMA 4EZ4A 2BKOA 2K9AA 3KV5A 1YQ4A 5AQOB 5L3BB 2BBHA 3ZJ2A 3FZMB 2IW5B 2WCAA 3KV6A 4IE6A 4UVAB 4U74A 3RH3A 2EHOC 5LYJE 2WU5A 2K24A 1J5ET 4GK0E 3SRZA 1X79A 1W0BA 4KHPT 1XNRT 4QX7B 5E0OA 5HWXA 3EDVA 4MFRA 4TV9E 5L3CB 1KNPA 3P7IA 2L3LA 2BVMA 5CA1E 3HI2A 3P4RA 3U78A 2OV9A 4MHCA 2LRKA 2XAHB 4WBNE 1D1BA 4A97A 4HWHA 3UUMA 2DWKA 3QB5A 1WCRA 4WZXA 1W09A 2BS3A 3VU7H 4HFDA 3RC3A 3CKDA 3PTRB 3P50A 2AE9A 2XQ3A 3ZN0B 3BK9A 2VASA 2UUAT 2K48A 4XIGN 2LM9A 4AKHA 5EK3A 1D0ZA 3RYHE 3CPZA 5L3FB 3WAJA 2ZM8A 4O4JE 3N9NA 3Q9DA 3T8OA 3SOLA 4DV4T 5JDNA 3J9X1 4EYUA 3N2KE 1NENA 3UT5E 2C5KT 1JNZA 3RHWA 4U7YA 4XTCM
chains in the Genus database with same CATH topology
4YMSC 3RLFG 2R6GG 4KI0F 3PUVF 4KI0G 3PUVG 4TQUM 3PUXF 4XTCN 4YMUC 3PV0F 3PUXG 4YMVC 3TUIA 3PUYF 4XIGM 3PV0G 4KHZF 4TQUN 3PUYG 3PUZF 4YMTB 3TUZA 4KHZG 4YMWC 3DHWA 4JBWF 3TUJA 3PUZG 4XIGN 2ONKC 4JBWG 3PUWF 3RLFF 3PUWG 3D31C 2R6GF 4XTCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMS C;  3RLF G;  2R6G G;  4KI0 F;  3PUV F;  4KI0 G;  3PUV G;  4TQU M;  3PUX F;  4XTC N;  4YMU C;  3PV0 F;  3PUX G;  4YMV C;  3TUI A;  3PUY F;  4XIG M;  3PV0 G;  4KHZ F;  4TQU N;  3PUY G;  3PUZ F;  4YMT B;  3TUZ A;  4KHZ G;  4YMW C;  3DHW A;  4JBW F;  3TUJ A;  3PUZ G;  4XIG N;  2ONK C;  4JBW G;  3PUW F;  3RLF F;  3PUW G;  3D31 C;  2R6G F;  4XTC M; 
#chains in the Genus database with same CATH topology
 4ZHQ E;  2V7L A;  5JDM A;  2C5I T;  3FZF B;  4DBQ A;  2V7M A;  4ZS2 A;  3FXE B;  4WBO A;  3KVB A;  5FVK A;  4B3R T;  4JUY A;  3KVA A;  1J1J A;  2CPT A;  4QHO A;  3RIU A;  4O4I E;  1D0X A;  3RYF E;  4YY3 T;  3ETV A;  3A8Y C;  5JRC B;  2XPK A;  5FP3 A;  3OYZ A;  5DQV A;  1N34 T;  3O1I A;  4J2C A;  4X1Y E;  2Y8D A;  3ZC0 A;  2BG9 A;  2X51 A;  2M6I A;  3TUI A;  4C91 A;  2P9B A;  2V5D A;  4TV8 E;  1QSD A;  2YIN A;  3MAC A;  2X9X A;  5KXJ A;  2BKN A;  4JI4 T;  2LSI A;  4IE4 A;  4IGU A;  3KIN B;  1WLX A;  1IBK T;  4QH4 A;  2XQ6 A;  2NTX A;  4I4T E;  4X5T A;  4HKA A;  4ILC A;  2AXD S;  2V5C A;  4HFC A;  3PU8 A;  1M62 A;  5LHI B;  2Y48 B;  2PBI A;  4QH5 A;  2X9W A;  3N9Q A;  1LRZ A;  4IT4 A;  3O9X A;  4WW0 A;  2QVA A;  3IEE A;  2UXC T;  2JQQ A;  3AEF A;  5LGU B;  1WR0 A;  4NUV A;  1FJG T;  4NUU A;  3C50 A;  4ZI3 D;  5JDF A;  1DU2 A;  2XTL A;  3SS1 A;  1IZN B;  4TUY E;  2ACZ A;  3EAB A;  2NR4 A;  4CI2 B;  4EB6 E;  2ONK C;  3FHN A;  2XQ4 A;  2ACX A;  2UU9 T;  3RIF A;  1IJ6 A;  2C5J A;  1KEY A;  4V1A v;  5AQK B;  2KWI B;  3UFE A;  3OYX A;  1ZV4 X;  4HN9 A;  1IBL T;  3IHR A;  2X0L B;  5EK4 A;  1HCI A;  2XHE B;  3ONL C;  4ISS A;  2KT9 A;  4DR7 T;  4TQU M;  4H9Q C;  3EAM A;  4YTN A;  5F5W A;  3B5M A;  3PUY F;  2LHR A;  1UX4 A;  4YSX A;  2UXN B;  2HH7 A;  2A2F X;  2WMN A;  1X9B A;  2Q9Q D;  2WM9 A;  4TNW A;  4CN6 A;  4ZS3 A;  4DO0 A;  4JI5 T;  2HPJ A;  4JI7 T;  4B3T T;  2E5L T;  5L4H A;  2LSG A;  4EV6 A;  4GK5 E;  4IE0 A;  1LVK A;  3DHW A;  2LEH A;  3N2G E;  3O1J A;  4ZXL A;  2M67 A;  1HX1 B;  4O2A E;  3AE4 A;  3N9M A;  3I0O A;  4B3S T;  3ZC1 A;  2JMH A;  5J2U E;  3AE1 A;  4H9P C;  4YMU C;  3PJA J;  4DV7 T;  3NZP A;  3X1D A;  4TWH A;  3PUY G;  4U2Y A;  4PNI A;  2OA5 A;  2ES0 A;  3UQ7 A;  2I0M A;  2CCQ A;  1HG2 A;  2RPA A;  3ONJ A;  3MK7 C;  5HEO A;  1T8B A;  4DV6 T;  2YEV C;  5LXT E;  3OJA A;  5JVD E;  1MIW A;  3WI3 A;  3E0Z A;  5IUX A;  5JH7 E;  3UUX B;  3RF1 A;  5LCY A;  3NBX X;  3VRA A;  4IL9 A;  3VHL A;  4JEU B;  3RLF F;  3CVR A;  3M3Z B;  4KI0 F;  2XUE A;  5FY1 A;  3C4W A;  4ZEY A;  3QC9 A;  2WQY A;  5FXW A;  4JI0 T;  3CX8 B;  4DV1 T;  5LGN B;  2CMR A;  1YQ3 A;  1SA0 E;  2UXX B;  1CHU A;  5CJ5 A;  3MZK B;  3CIR A;  4IST A;  5HEH A;  5CA0 E;  3FBZ A;  4BJM A;  4IDN A;  2JQK A;  4JV5 T;  4O8S A;  5HAX A;  1XWM A;  2VVS A;  4P0A A;  4TNV A;  1HF8 A;  5AQU B;  4L0R A;  3N2O A;  2NW7 A;  2Z6E A;  3R84 B;  5HYA A;  4KI0 G;  2A9U A;  4CXW A;  4XTC N;  3AVR A;  2DCF A;  4U33 A;  4YSZ A;  2Q9Q A;  3UTK A;  1M7K A;  3FZK B;  2J4G A;  3ZN1 B;  4JBW F;  3PDY A;  5AQJ B;  5KDM C;  1SE7 A;  3AE9 A;  2D0U A;  2M6B A;  4K0K T;  5JR9 B;  3EHZ A;  4UEM A;  2IC6 A;  5JQG E;  3JAE A;  1LKX A;  4EXT A;  4YMT B;  2VKJ A;  3E08 A;  3HKE E;  4I55 E;  1HNZ T;  1Z0P A;  5FMN A;  4O4H E;  1UCU A;  1V9D A;  1G8X A;  5GON E;  3TLS A;  4BJN A;  5FXZ A;  3ANW A;  1N32 T;  5JR9 A;  4UXN B;  1OED E;  3GMI A;  3ZYM A;  3AEE A;  3IA3 A;  4YJ3 E;  1MNE A;  5DAB A;  2IIU A;  4OFZ A;  3C64 A;  5FY0 A;  4H9R C;  1KNR A;  2NP9 A;  1ZHC A;  1U5P A;  3FZH B;  4CXX A;  4YFS A;  3KV9 A;  3AA1 B;  2W00 A;  2V7I A;  4HWI B;  5HCM A;  2HN1 A;  1R8I A;  3LK3 B;  5AQN B;  2XAQ B;  2X68 A;  3HA4 A;  4DV0 T;  4DR4 T;  3Q5X A;  4IIJ E;  3P4Q A;  1MIY A;  4DVD A;  3GWH A;  2CWO A;  4PW8 A;  3TLT A;  3WAK A;  2BG9 E;  4JI6 T;  3PUS A;  5ABE A;  4DMV A;  2H3R A;  5JTG A;  2VL8 A;  2BS4 A;  2YOE A;  3BQI A;  2LSY A;  2CLY C;  3K3O A;  1ZKE A;  3K3Q C;  4QXC B;  4DBR A;  1NEK A;  5C3J A;  4YJ2 E;  2JQ9 A;  5HWY A;  2KND A;  5LBM A;  5LMN T;  2V26 A;  4IDQ A;  4IHJ E;  4AI6 A;  2N9D A;  4HWC A;  2QRX A;  4IE5 A;  2L8K A;  3UU6 A;  3LFM A;  3O1H A;  2LOP A;  3D0T A;  5KX5 E;  2BVL A;  3A7M A;  4B6X A;  2YKS A;  2FBW A;  3I1A A;  4GKJ T;  1UGO A;  2FJA A;  4TQU N;  3PUZ F;  1KK7 A;  4KX6 A;  3ZMS B;  5JR9 C;  3H3A A;  4OYK A;  4LF6 T;  3RPU A;  3IF8 B;  2V6Y B;  1OWA A;  4DMW A;  3AA0 B;  1OED A;  2V6X A;  3AA7 B;  3AVS A;  2WDV A;  5JDQ A;  4KHZ F;  2CXL A;  2RA1 A;  2BG9 B;  4E7S A;  4GIW A;  4DUZ T;  1I94 T;  4ERR A;  4IRE A;  3SWH A;  3L8R A;  5EK2 A;  3CWZ B;  2HHH T;  4HWF A;  4OHF A;  4NXM T;  3JC6 D;  4KBM B;  2V1D B;  3JCF A;  3OVU A;  2BKP A;  4ZI7 E;  2D0T A;  2NTY A;  2RP4 A;  3T1H T;  5ADX L;  2V6Y A;  2XQ7 A;  1ZP0 A;  1XMO T;  2XSB A;  1ZOY A;  3MKD A;  4O2B E;  2LOS A;  3GN5 B;  3AE8 A;  2E9X D;  3AAE B;  1ZEE A;  1SHZ C;  3ZYK A;  1YW0 A;  1YKH B;  3C98 B;  3RKG A;  2CHN A;  2PTF A;  5FYM A;  3P4P A;  4QXH B;  3A5X A;  2WDR A;  1US7 B;  3AXJ A;  4DR2 T;  4U72 A;  3MA9 A;  3M65 A;  4AKR B;  4KUM B;  4IDP A;  3RI5 A;  4UVC B;  3GN5 A;  4P09 A;  4HFV A;  1NWM X;  4HTE A;  1XZY A;  4P1N A;  3EVY A;  1MMN A;  1MMA A;  4CZZ B;  5LJN A;  4H63 V;  5FVL A;  2UXD T;  4ZI2 D;  3NRX A;  3RQW A;  3HL6 A;  4JI8 T;  2VKD A;  5DJQ C;  1MIV A;  2GK9 A;  2H88 A;  4AQY T;  2NOX A;  5KMG P;  5EZY E;  4LF8 T;  2WZI A;  4GKK T;  5AQI B;  5L2L A;  5LBQ B;  4LF4 T;  3AE2 A;  3EI0 A;  5H6Q B;  2X9H A;  3TUZ A;  5L3E B;  5L4E A;  4ASK A;  2WZH A;  3TLV A;  4WNK A;  3AAA B;  4EOZ B;  2LSK A;  1UK5 A;  4HFH A;  5LNK A;  3HKB E;  2CWY A;  4O4L E;  4DR6 T;  3RIU C;  2VK9 A;  3EUH A;  1WR6 A;  2JJ9 A;  4YXD A;  1D1A A;  1O3X A;  1MMG A;  2YDR A;  3C4Z A;  4KP3 C;  2CHO A;  3UUL A;  3AEC A;  2N2N A;  5HXE A;  4PK5 A;  5LB7 B;  1FMV A;  4CN1 A;  1E2A A;  3EDU A;  4UV9 B;  3NRY A;  2BG9 C;  2FJE A;  3F2E A;  3ZT5 A;  2EHO D;  3L3P A;  3VKG A;  4DV3 T;  3L09 A;  2CBI A;  1HFA A;  4H63 H;  3QK6 A;  2E9X A;  1AJ3 A;  1Y64 B;  2WP9 A;  4HWD A;  2LT3 A;  4DUY T;  4JYA T;  4UVB B;  1T98 A;  4HFE A;  3ZEF B;  4LF5 T;  2CBJ A;  2YK0 A;  2ZM2 A;  4FI5 A;  2V7J A;  3QOF A;  5AQQ B;  2CXD A;  4LMK A;  5C2T A;  1KFY A;  3AE5 A;  3ZST A;  5C8Y E;  3AE7 A;  1KF6 A;  4XBF B;  3AEB A;  3DJB A;  4X20 E;  4AKG A;  1S94 A;  2H89 A;  3KDS E;  3AE6 A;  5AQF B;  2Y6X A;  2MTQ A;  4YHH T;  2PJQ A;  5IHY A;  1BR2 A;  5L3D B;  3VRB A;  2J47 A;  1BR4 A;  2ODV A;  5FNV E;  3ESL A;  4DR1 T;  3QUJ A;  4WYV A;  5AQL B;  2W61 A;  2X9Y A;  2IDO B;  2CRB A;  4NXN T;  2H7V C;  4M1P A;  3MXZ A;  3CX7 B;  3V5S A;  2XQ8 A;  1HG5 A;  4X62 T;  1W9R A;  5LHH B;  2JRK A;  3AB3 B;  2YN6 A;  4AQF A;  3W15 B;  3LBX A;  3R6N A;  2CA5 A;  4CI3 B;  3I0Q A;  4UEL A;  1HNW T;  3UFG A;  1EZ3 A;  4AKL A;  3P4S A;  5FKY A;  4PFO A;  4AIS A;  2WMO A;  5TAO A;  2HPL A;  1H7C A;  4IL4 A;  2Q9Q B;  4HEA A;  3N9L A;  4LF9 T;  5BMV E;  2WB5 A;  1XMQ T;  4ZZB A;  5A1L A;  4A56 A;  3OPC A;  2XSA A;  3OTO T;  2LM2 A;  1FMW A;  4UR9 A;  3ZMZ B;  4GOU A;  5JRE A;  3L39 A;  2XM1 A;  2DNX A;  2WWV A;  2MYS A;  1GQE A;  4XAX B;  3KBT A;  4DR5 T;  2CM0 A;  5AQM B;  3PU3 A;  3RLF G;  4KMC A;  2W67 A;  4JLE A;  3ZCI A;  4NIQ A;  2EHO A;  4B3M T;  3K8P C;  3UUB A;  4IDZ A;  4UF0 B;  4MAL A;  1XNQ T;  2IUB A;  2W4X A;  4YTM A;  5HXH A;  4CXY A;  4ILB A;  4QWN B;  1YXR A;  5AQT B;  3ANW B;  5M4Y A;  4LML A;  2PG8 A;  3QB5 K;  2B76 A;  4X64 T;  3NZQ A;  2LJL A;  2IAK A;  4UV8 B;  3ONX A;  2N1G A;  1Z8U A;  1U4Q A;  4A98 A;  4CN4 A;  4OK0 A;  5AQH B;  1G73 A;  1HR0 T;  1YKE B;  2XAG B;  4UF0 A;  5L47 A;  4OYJ A;  1IAP A;  4L9I A;  1N33 T;  1XDO A;  4JI2 T;  2I59 A;  4COF A;  2FJD A;  3LSV A;  4ANJ A;  4HFB A;  3RYI E;  2IHR 1;  1WYB A;  2XQY A;  2D2S A;  4L5G A;  4JBW G;  4ZI3 C;  3PUW F;  4NPP A;  4EED A;  3FBL A;  3B57 A;  4PK6 A;  5IYZ E;  4FJO A;  4AQF C;  5HXC A;  1B7T A;  4AQG A;  3N9O A;  2JPF A;  4LFC T;  3RX6 A;  2WAU A;  2YU1 A;  3AE3 A;  4MLK A;  2W66 A;  5HEU A;  2YU2 A;  5LGT B;  4U2Z A;  2DWG A;  3TLW A;  3LG7 A;  2KZ7 B;  4YTP A;  4PFP A;  3PV0 F;  2ZMA A;  3AA6 B;  3BQL A;  3Q5W A;  5F8P A;  2K3W A;  4DND A;  1SUM B;  2WDQ A;  4JI1 T;  3PE0 A;  3KFW X;  3PUW G;  5JDG A;  4OX9 T;  1LVF A;  2FJB A;  2W63 A;  3CML A;  2JMK A;  3RKO A;  2Q9Q C;  2XM2 A;  4DV2 T;  4PJN A;  5FL0 A;  5JDL A;  4DID B;  4G2A A;  4X65 T;  4H9N C;  4N78 D;  5FY7 A;  5AQP B;  3ZKR A;  3I9W A;  2VKH A;  4QKN A;  1T72 A;  1HNX T;  1UUS A;  2WSS V;  2OLT A;  5LP6 E;  2MBG A;  2DLR A;  4C90 A;  1VRB A;  2ZM6 T;  3CK6 A;  3PV0 G;  3KV4 A;  4JI3 T;  1OED B;  4YMW C;  3MJX A;  1FEW A;  3VR8 A;  3DP7 A;  3LJC A;  1IJ5 A;  5ABH A;  2LKH A;  1E1H B;  4ZOL E;  4PK4 A;  2NW8 A;  5CGM A;  4UIG A;  1I6Z A;  5AQS B;  2WY2 A;  2X0H A;  4U7I A;  4AKI A;  5ETW A;  1QUU A;  3ZMT B;  5AFU L;  3ETU A;  2ZLY A;  2FUP A;  3F57 A;  3TKL B;  5LG4 A;  3QNU A;  1S35 A;  4Z91 A;  5AQG B;  2E2A A;  2A3D A;  2DL1 A;  3LK4 2;  4PJM A;  3VKH A;  2WWU A;  2LSJ A;  3LDQ B;  4X1K E;  4DV5 T;  2XQ5 A;  3P8C D;  3BQK A;  2HN2 A;  2BDE A;  4YHJ A;  1FIO A;  4CI1 B;  5ABF B;  1UX5 A;  3PUZ G;  3AXJ B;  2I6H A;  1W0A A;  4LMJ A;  3RIA A;  3PUQ A;  3PUV F;  3FB2 A;  1JNR A;  2G0U A;  5FL1 A;  1T7S A;  4KHZ G;  1XDP A;  3ZJ1 A;  5LMU T;  5AQR B;  2X0Y A;  4Z8X A;  2WU2 A;  5ABF A;  5AQV B;  1E7P A;  4DR3 T;  2VKO A;  4P0B A;  3PJA A;  4F6R C;  2MOZ A;  4PAG A;  4ILU A;  2VUR A;  1MMD A;  3CQX C;  2VB6 A;  2YDQ A;  4EEB A;  4PJL A;  4ILA A;  5F3J A;  1BR0 A;  2WS3 A;  3HR0 A;  5J0Z A;  5JRC A;  3PUV G;  2BS2 A;  4AXP A;  1J5W A;  2CXF A;  2H7O A;  4X66 T;  2KMF A;  2VWA A;  4X1I E;  5HEJ A;  3AAI A;  4TX5 A;  2LE8 A;  3B13 A;  3SFE A;  5FXV A;  3ZT7 A;  3OBV E;  4G63 A;  3ZT6 A;  3ZCJ A;  1VCT A;  1OED C;  2SPC A;  2XQ9 A;  4YT0 A;  4TZ4 C;  3ZPO A;  4CQI A;  3ZMV B;  5LHG B;  3G06 A;  4U31 A;  3FZL B;  3PUR A;  1OXZ A;  4Q25 A;  3ABV A;  2NWB A;  5HXR A;  1WRD A;  2LRL A;  4E7Z A;  2E9X B;  2XAS B;  4BAY B;  1NAF A;  3RC8 A;  2UUB T;  1QLB A;  2QGS A;  3ZSS A;  2KLQ A;  3FXD B;  3UUN A;  4MBQ A;  2F4V T;  3T1Y T;  2J1D G;  4XIG M;  3NWI A;  4F8H A;  2CE7 A;  2ZM0 A;  4H9O C;  2JIW A;  4TN7 B;  3AED A;  3LK2 B;  5HCJ A;  5ABG A;  5DQW A;  3GA8 A;  1KNZ A;  2CEA A;  4QXB B;  1IBM T;  3UU4 A;  5HXS A;  4Z90 A;  2D5U A;  1BR1 A;  4I50 E;  1UUR A;  2VQF T;  5JDH A;  2XY8 B;  2MAW A;  5CFB A;  2IML A;  2DI4 A;  3H3M A;  5FXX A;  4YMS C;  4I43 B;  4EYY R;  3ZMU B;  4EZH A;  2ODU A;  4XZC A;  4A5X A;  1D1C A;  3RRC A;  3LBX B;  5H6R B;  2XQA A;  2LKG A;  3RRW A;  4LF7 T;  2E5V A;  3PUG A;  2KXP B;  1N36 T;  2WBL A;  4YSY A;  2IC9 A;  3NKZ A;  3CQC B;  3I9Y A;  3J7Y q;  4K0U A;  3UU5 A;  3C4X A;  3CQG B;  2KSR A;  4ZZC A;  3D31 C;  3IBP A;  3S4U A;  5LA6 E;  2X66 A;  1L0V A;  2MPK A;  4JEH B;  3UU3 A;  4QH1 A;  1D0Y A;  2VL0 A;  4PJJ A;  2L9Q A;  3F31 A;  2EHO B;  3HKD E;  3HKC E;  5HEG A;  4TWF A;  3JC6 C;  3AEG A;  2K5B B;  2VQE T;  2J62 A;  3TLU A;  1Y01 A;  2R6G F;  2KWH A;  4LFA T;  2DHR A;  3ZYL A;  3SFD A;  3Q5E A;  3PUX F;  3H37 A;  4LFB T;  3DTO A;  4TWD A;  2W2U A;  3CX6 B;  1YD8 G;  2LLY A;  5L3G B;  3E22 E;  4HE8 A;  2E9X C;  2UUC T;  2W0G A;  3N5L A;  4AIU A;  2CLY B;  5LG3 A;  2VVN A;  3RGL A;  3PUA A;  2KIN B;  3NVO A;  5BR8 T;  3V5U A;  4BA9 A;  3K1S A;  4EAH A;  2XJ7 A;  2QYW A;  3RQU A;  1WYC A;  5J2T E;  2R6G G;  1VCS A;  4GYS A;  1HTJ F;  5IWA T;  4EIW A;  3RYC E;  3PUX G;  1CUN A;  3N9P A;  5LOV E;  2A72 A;  2D9D A;  4H9S E;  2V8S V;  2LHN A;  1MND A;  3U3I A;  3TUJ A;  4ADZ A;  4U3C A;  2XAJ B;  4ZI2 C;  2XAF B;  2BZB A;  2X67 A;  4IDO A;  4EGW A;  4YMV C;  3O4X E;  5J1G A;  2YDS A;  1WFD A;  2B1E A;  4YLH A;  4I0U A;  2W62 A;  2JQH A;  3UU8 A;  2XZE A;  3C51 A;  2UXB T;  5LJM A;  4HFI A;  5CB4 E;  2BBJ A;  4HGA A;  2QA7 A;  3K3N A;  3Q2M A;  3VR9 A;  3KBU A;  3OKQ A;  1HX8 A;  4GYR A;  3AEA A;  2E8I A;  1HS7 A;  3ZLI A;  4QX8 B;  3Q5D A;  2NW9 A;  2V7K A;  2PFV A;  3UQ4 A;  3JAF A;  2C0S A;  4IE7 A;  3P4W A;  3JAD A;  1VOM A;  4EZ4 A;  2BKO A;  2K9A A;  3KV5 A;  1YQ4 A;  5AQO B;  5L3B B;  2BBH A;  3ZJ2 A;  3FZM B;  2IW5 B;  2WCA A;  3KV6 A;  4IE6 A;  4UVA B;  4U74 A;  3RH3 A;  2EHO C;  5LYJ E;  2WU5 A;  2K24 A;  1J5E T;  4GK0 E;  3SRZ A;  1X79 A;  1W0B A;  4KHP T;  1XNR T;  4QX7 B;  5E0O A;  5HWX A;  3EDV A;  4MFR A;  4TV9 E;  5L3C B;  1KNP A;  3P7I A;  2L3L A;  2BVM A;  5CA1 E;  3HI2 A;  3P4R A;  3U78 A;  2OV9 A;  4MHC A;  2LRK A;  2XAH B;  4WBN E;  1D1B A;  4A97 A;  4HWH A;  3UUM A;  2DWK A;  3QB5 A;  1WCR A;  4WZX A;  1W09 A;  2BS3 A;  3VU7 H;  4HFD A;  3RC3 A;  3CKD A;  3PTR B;  3P50 A;  2AE9 A;  2XQ3 A;  3ZN0 B;  3BK9 A;  2VAS A;  2UUA T;  2K48 A;  4XIG N;  2LM9 A;  4AKH A;  5EK3 A;  1D0Z A;  3RYH E;  3CPZ A;  5L3F B;  3WAJ A;  2ZM8 A;  4O4J E;  3N9N A;  3Q9D A;  3T8O A;  3SOL A;  4DV4 T;  5JDN A;  3J9X 1;  4EYU A;  3N2K E;  1NEN A;  3UT5 E;  2C5K T;  1JNZ A;  3RHW A;  4U7Y A;  4XTC M; 
#chains in the Genus database with same CATH homology
 4YMS C;  3RLF G;  2R6G G;  4KI0 F;  3PUV F;  4KI0 G;  3PUV G;  4TQU M;  3PUX F;  4XTC N;  4YMU C;  3PV0 F;  3PUX G;  4YMV C;  3TUI A;  3PUY F;  4XIG M;  3PV0 G;  4KHZ F;  4TQU N;  3PUY G;  3PUZ F;  4YMT B;  3TUZ A;  4KHZ G;  4YMW C;  3DHW A;  4JBW F;  3TUJ A;  3PUZ G;  4XIG N;  2ONK C;  4JBW G;  3PUW F;  3RLF F;  3PUW G;  3D31 C;  2R6G F;  4XTC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...