3PUXF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 151
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puxF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puxF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puxF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puxF02
3PUYG 4XTCM 3RLFG 3PUVF 3TUIA 4YMVC 2ONKC 3PUWF 2R6GG 4YMWC 3DHWA 3PV0G 4TQUN 4JBWF 4XIGN 3PUZF 4KHZF 4YMUC 3PUVG 4KI0F 3PUXF 4TQUM 3TUJA 3PUYF 3RLFF 3PUWG 4YMSC 4XIGM 4JBWG 3PUZG 4XTCN 3TUZA 4KI0G 4KHZG 2R6GF 4YMTB 3PV0F 3D31C 3PUXG
chains in the Genus database with same CATH superfamily
2XSAA 1U4QA 3QUJA 4ZI2C 2K48A 1W0AA 1L0VA 3DTOA 3SWHA 2DWGA 2JJ9A 2V7LA 1UX4A 4X66T 2CHNA 4IE7A 2R6GF 3Q5WA 4C90A 4L9IA 5L3FB 4ZZBA 4HWIB 4LF4T 3ZC1A 3TKLB 3JADA 5IHYA 1E2AA 5JRCA 4KHPT 2OV9A 3N5LA 3K3OA 3N9LA 5IYZE 4JI5T 3CQGB 4WBOA 4A56A 1MIYA 4MALA 5ADXL 3ZYKA 1DU2A 1AJ3A 1I6ZA 3HKBE 3BQLA 4X1YE 2X51A 2FJBA 1HR0T 4E7SA 4HEAA 5CA0E 3LG7A 1IZNB 2CXLA 3UT5E 4YXDA 4PW8A 1FJGT 3NRXA 4ZEYA 2LSJA 5CGMA 4CZZB 3WAJA 3JAEA 3RGLA 2CEAA 2L8KA 2J4GA 2QRXA 2WZHA 1MMAA 4HGAA 3HKDE 4NUUA 3VHLA 2H7VC 5LJMA 2CCQA 2XQ8A 4CN4A 3AAAB 2VKJA 2VL8A 5HEJA 2PTFA 2UUAT 3CX8B 5L3GB 4I43B 3PE0A 4LFBT 3MK7C 3UUXB 3EUHA 3ZMVB 4B3ST 5JDFA 2WDQA 2BS4A 3CQXC 2K9AA 3T1YT 4YTPA 3UU8A 4GKKT 4QXBB 1KNPA 2V26A 3X1DA 2V7IA 4B6XA 2MTQA 1KF6A 1KNZA 1XMQT 2JIWA 2JQKA 2G0UA 5AQOB 3RX6A 2BG9C 2IIUA 3FBZA 3ETUA 2VKDA 3AE7A 4MFRA 2YDSA 1OEDC 4QH4A 4TN7B 2RPAA 2DL1A 4GYSA 2X9HA 3QNUA 4GYRA 2HN1A 3FB2A 2BKPA 2BDEA 3PURA 2X68A 3ZPOA 5EK2A 1WR6A 3TUZA 4B3RT 3NKZA 5JDGA 5HEOA 3L39A 4IE6A 2KINB 1ZKEA 2UUCT 1VRBA 2LHNA 5AQVB 4L0RA 5KX5E 2JMKA 3N9MA 1CHUA 2SPCA 1WR0A 1FEWA 2MBGA 3AAEB 3AEBA 1G73A 3PUSA 2CLYC 2NTYA 4LF6T 3BQKA 2LKHA 3L8RA 5LG3A 3R6NA 1V9DA 3NZPA 4AI6A 5ABHA 2BS3A 3AECA 5L3BB 4CI2B 3ZSSA 5JTGA 2JQ9A 2W63A 4DIDB 3N2GE 1LRZA 5AQFB 4TNVA 2IMLA 4CXYA 3CMLA 2ACXA 1NEKA 3UUMA 2UXXB 1HG2A 2WU2A 4GK0E 4P0BA 1N34T 3UULA 4ZI3D 3O1IA 2CE7A 1N36T 5CFBA 5LGUB 1J1JA 3WI3A 2Z6EA 4KBMB 2EHOC 3A8YC 1W0BA 3TLVA 3PUZG 2BZBA 2KMFA 2I0MA 5LNKA 4U2ZA 3AE5A 3AA1B 3AEFA 2L9QA 5FKYA 5DQWA 5DABA 3C4ZA 4C91A 5LBQB 5LMUT 1IBKT 3W15B 4A98A 4PFPA 2V5DA 1UK5A 2Y8DA 2LSKA 1XNRT 1WCRA 3FZKB 4GIWA 2BBHA 2H3RA 3AEDA 4ZZCA 2Y48B 1OXZA 3RYCE 5EZYE 4Q25A 4LF5T 3IEEA 2IHR1 2F4VT 2BG9E 4EEDA 2WMOA 1T8BA 3K3QC 2WU5A 2XQYA 2HPJA 1GQEA 4B3TT 4IDOA 2BBJA 5AQKB 1OEDE 3ZN0B 3N9QA 4L5GA 4JV5T 5JH7E 4CXWA 4PJJA 2GK9A 2IC9A 1HS7A 3TUJA 2WAUA 2H89A 4MHCA 1BR4A 1BR1A 3AAIA 2ZLYA 5DJQC 3ZT7A 5LA6E 4F6RC 5LGNB 4XAXB 1MMGA 5FNVE 5EK4A 5H6RB 2BG9A 4HFIA 3RKGA 4DMVA 2J1DG 5L47A 1SHZC 2NR4A 4K0UA 4XTCM 3OBVE 1J5WA 1OEDA 1U5PA 2CHOA 2NWBA 2E5LT 2K5BB 4NUVA 2RA1A 3QOFA 2V1DB 5C8YE 2NW7A 5FYMA 4TX5A 3TLSA 4MLKA 2XQ5A 1Z0PA 5LHHB 2VQET 2W66A 2D2SA 4DV0T 4IDZA 3C51A 3RQWA 4HFEA 1H7CA 2VURA 2VQFT 2XQ6A 4DV5T 4TQUM 3B57A 4QXHB 1KK7A 3KV6A 4DV3T 2YK0A 3PUQA 3P7IA 5JDNA 2XAGB 5CA1E 5CB4E 4YY3T 5AQTB 1W9RA 3AE8A 1YW0A 1N32T 3I9WA 3EDUA 5ABEA 4LF7T 1Z8UA 2FBWA 4EGWA 2E9XD 3HL6A 4AQFC 3LJCA 2B76A 4LMJA 2VVSA 2PG8A 4YMWC 3AEEA 4PK5A 2I59A 3PUVG 4TV9E 4X1KE 3ZMZB 3AB3B 5LOVE 2BG9B 4QHOA 2FJDA 2HHHT 4PJNA 2JPFA 4ILAA 3GN5A 4COFA 2X66A 1HG5A 1MIWA 3ZJ2A 3AVSA 5DQVA 5L3CB 4I0UA 2K24A 1XDPA 3MA9A 2EHOA 5LHGB 5JQGE 2YKSA 4TV8E 4WYVA 3PU8A 4JI0T 2IC6A 1X79A 3HR0A 5L4EA 3UTKA 4TWDA 4ZHQE 4JI2T 3RQUA 2D9DA 2ZM6T 3LBXB 1MMNA 4EYYR 4M1PA 4ZS3A 4ZXLA 4EAHA 4JEHB 2M6BA 1R8IA 1IJ5A 3QC9A 3UU5A 2NOXA 2NTXA 4HWHA 5C2TA 3PUVF 3SS1A 4H63V 3RH3A 3VRAA 4QWNB 4QX8B 3F31A 1D0ZA 2UXNB 2CLYB 2LLYA 3I9YA 2BVMA 5FY7A 4AXPA 4LFAT 4TNWA 4OYJA 3U3IA 1Y01A 4HFBA 2YDRA 5E0OA 3GWHA 4P0AA 3K3NA 4AIUA 5AQPB 5FXXA 4GOUA 5L3EB 3OPCA 3Q5DA 3B5MA 4J2CA 2Q9QC 4AKGA 3AXJB 5JDQA 4YSXA 5L3DB 5LCYA 4U7YA 3G06A 3KV5A 2DCFA 2E2AA 4OK0A 1FMVA 4ISTA 3LK3B 3MXZA 1WRDA 3GN5B 2L3LA 1WLXA 3EHZA 3A7MA 5JR9C 1IBLT 2D0TA 2LEHA 4O2BE 3NRYA 2EHOB 4DNDA 3FZHB 3CKDA 4LF9T 2W4XA 4U2YA 5J2TE 3P4RA 4ISSA 2LRLA 3RRWA 5FY1A 3C98B 4XTCN 3ZCJA 1XWMA 4GK5E 3O9XA 4CN1A 4PFOA 3RIFA 2CA5A 3AEAA 3K8PC 2WS3A 3L09A 3UFEA 2H88A 4QH1A 3HA4A 3I0QA 3ZMTB 2XAQB 4KHZG 4BA9A 2ZM2A 4NIQA 1YXRA 2WDVA 3SOLA 3J7Yq 5FVKA 4DV4T 1EZ3A 3E08A 4TQUN 3CWZB 1D0YA 4WW0A 4IDNA 1JNRA 5FXZA 2NP9A 2XZEA 4IIJE 2WM9A 1HFAA 3OVUA 4TUYE 2CBIA 1XZYA 3KVBA 2BVLA 3EAMA 3RKOA 4N78D 4AQFA 5IWAT 4WNKA 4YSYA 3RIUA 4JI8T 2BKNA 2MPKA 3LSVA 3ZMSB 3VU7H 3PUAA 2FJAA 3UU3A 4WBNE 4DV2T 3EI0A 3GMIA 4ZI2D 4KHZF 1QSDA 3H3MA 3N9OA 3P4QA 3PTRB 5HXHA 4KI0G 3FBLA 4P09A 4YHJA 3RLFG 4DMWA 2D5UA 5HEUA 3P4PA 4DR5T 4V1Av 2VWAA 3VRBA 2ACZA 2XASB 1WYBA 3M3ZB 3TLWA 3IBPA 4HE8A 3P8CD 3H37A 3KFWX 2UXBT 3AE9A 4YMVC 4HFVA 2H7OA 3UUNA 4QXCB 5HEGA 4DO0A 2JRKA 1HTJF 2DI4A 2LSYA 4CXXA 4UVAB 1MNEA 2I6HA 2YEVC 3FXDB 4O8SA 1SA0E 3A5XA 3WAKA 2YU2A 5FXVA 5GONE 4TWFA 5LMNT 3RLFF 1SUMB 1JNZA 2E5VA 2X9XA 2LHRA 4YMTB 3D31C 2Q9QA 2W61A 1KNRA 2IDOB 1Y64B 1NENA 4YLHA 2LM2A 4KX6A 4YFSA 1ZP0A 2P9BA 2MAWA 5JR9A 2J47A 3CK6A 5HWXA 3JAFA 5L4HA 2LT3A 4XZCA 4HWDA 5LGTB 1SE7A 3BQIA 2UXCT 5KMGP 2JMHA 2QVAA 5FL1A 4OHFA 1NWMX 5HWYA 1KEYA 3UQ7A 2XTLA 5HAXA 4AQYT 2N9DA 2IW5B 5AQNB 3PUZF 2LKGA 2KWHA 1T7SA 4H9RC 4X65T 3LFMA 1HNWT 1S35A 1YD8G 1YKHB 3JC6C 2PJQA 3Q2MA 2QGSA 3QB5A 2WB5A 3ONLC 4JI6T 5LP6E 2K3WA 4U3CA 1M62A 3CPZA 3CVRA 1US7B 2W2UA 4DVDA 3RIAA 5AQUB 2Q9QB 3C4WA 2LSGA 3PV0G 1E7PA 4U31A 3O1HA 2ODUA 2KT9A 4Z8XA 4ZS2A 4PK6A 1UURA 3EVYA 5FXWA 3LBXA 5JR9B 2V7JA 4UVCB 3RRCA 4IL9A 4O4JE 2WSSV 3EABA 3ANWA 4IE4A 3ETVA 4JI4T 3I0OA 2V6YB 5AQGB 3SRZA 3OKQA 4H63H 3E22E 4X5TA 3AA7B 4HFHA 2XM2A 4I55E 3VKHA 1MNDA 2NW8A 5AQQB 4H9NC 2VL0A 4X20E 3PUWG 2EHOD 2ZMAA 4I50E 5BMVE 2E8IA 2QYWA 3PV0F 4DV1T 4KUMB 4QX7B 4EZ4A 2D0UA 1HCIA 2N2NA 1D1BA 4X64T 3KVAA 4ASKA 5FL0A 1XDOA 3RIUC 2DLRA 3KV9A 3VKGA 3AXJA 4GKJT 3L3PA 4EV6A 1W09A 2B1EA 4O4HE 4O4LE 2CXDA 3RYIE 4DBRA 3AE3A 1HNXT 4JLEA 3NZQA 3V5UA 4HKAA 2WY2A 4EIWA 2QA7A 3HKEE 5LB7B 2CWOA 5KDMC 5C3JA 4ADZA 4TZ4C 3PUWF 1XNQT 3N9NA 2NW9A 1IAPA 4LF8T 3AVRA 2YU1A 2A72A 4IE0A 3VR8A 1HX8A 5AQLB 1YQ4A 4JUYA 2WP9A 3ZT6A 4YJ3E 3ANWB 4Z90A 2OLTA 4AISA 5F5WA 2V7MA 4IL4A 5HYAA 1HNZT 2C5JA 3RC3A 4U7IA 3UQ4A 2X0LB 4H9OC 1T72A 3PU3A 1UUSA 4IDPA 2PFVA 5ABGA 1ZOYA 4ILUA 5FVLA 4A97A 1XMOT 3JCFA 3ZEFB 1D0XA 3UU6A 1FIOA 2DHRA 4EOZB 2BKOA 1OWAA 2DNXA 3O1JA 3ZKRA 2UU9T 3C64A 4AKLA 4UVBB 1G8XA 1O3XA 3DHWA 2W0GA 4BAYB 2J62A 4DV7T 4DBQA 2CWYA 3C4XA 4LMKA 4XIGM 3CX6B 4PJMA 2HN2A 3AEGA 3PUXG 3GA8A 3HKCE 4DUYT 2HPLA 2HH7A 1HX1B 1WYCA 4OYKA 4DR3T 2X67A 3M65A 2XQAA 3ZLIA 3ONJA 5CJ5A 5HEHA 3SFDA 4DUZT 3EDVA 2WDRA 5HXRA 3FHNA 3B13A 2WQYA 2IUBA 3ABVA 1ZHCA 2X9WA 4ZI3C 1ZEEA 4B3MT 3UU4A 3TLUA 2DWKA 2FJEA 2E9XB 3AA0B 5LBMA 1UGOA 3UFGA 2IAKA 3Q5EA 4NPPA 1D1AA 4HFCA 1X9BA 1T98A 2XY8B 2CXFA 2ZM8A 2X0YA 4U74A 2C5IT 3AE6A 1D1CA 4ERRA 4YTNA 2V8SV 3KBTA 3PUXF 4FI5A 1KFYA 3RYHE 2CM0A 2AXDS 2XAFB 4DV6T 3P4WA 4OFZA 5LJNA 1CUNA 3SFEA 4HN9A 4EYUA 4NXMT 2KSRA 5HXCA 5F3JA 5JRCB 2A3DA 2XPKA 1ZV4X 3H3AA 3KINB 4FJOA 2LSIA 4A5XA 3IA3A 3OJAA 2PBIA 5AQJB 2CMRA 3NBXX 5JVDE 2CBJA 4YT0A 2W67A 4UEMA 4IREA 2ODVA 2M67A 3FZFB 2LE8A 2XSBA 4ZI7E 4U33A 4O4IE 3KDSE 1LVKA 3AE1A 4F8HA 4HFDA 3OTOT 2VB6A 3MKDA 4YMSC 2Q9QD 3CQCB 5LXTE 3ZCIA 3DP7A 2VK9A 4EXTA 2XAJB 1FMWA 3AE2A 4UXNB 3V5SA 5HXSA 3AE4A 5L2LA 2A9UA 4G2AA 2FUPA 2A2FX 4UELA 5FY0A 3MZKB 3PDYA 4JEUB 5HCMA 5AFUL 4YHHT 5F8PA 5M4YA 4YSZA 2LRKA 3DJBA 3FZMB 1B7TA 2W00A 2ONKC 4DR7T 4EB6E 4JI7T 1E1HB 4AKRB 2LJLA 2VASA 4HWFA 4KI0F 4OX9T 4K0KT 2V7KA 2X9YA 2XQ3A 3R84B 3OYZA 3S4UA 3VR9A 4IT4A 5ABFA 2XAHB 4H9PC 3OYXA 4JI1T 4UV8B 5JREA 2Y6XA 3N9PA 1IBMT 2XQ9A 5AQMB 2WMNA 2YDQA 4PAGA 3RPUA 5TAOA 3LK42 4NXNT 1VCSA 3J9X1 2E9XC 2WBLA 1MIVA 3P50A 3PUYG 1BR2A 3TUIA 3ZYMA 2ZM0A 4AQGA 4XIGN 2V6YA 4CQIA 4UF0A 3LK2B 3RI5A 5HCJA 2VVNA 4IGUA 2KWIB 3RHWA 1QUUA 4UV9B 1LVFA 3ZSTA 4CN6A 4ZOLE 4X1IE 3Q5XA 3NVOA 4I4TE 4HTEA 3PJAJ 2XQ7A 1YKEB 2XQ4A 4BJMA 3LDQB 4XBFB 1MMDA 1YQ3A 5AQRB 2AE9A 2MYSA 2BS2A 5LHIB 3T1HT 1HF8A 3F57A 4YMUC 3U78A 3BK9A 5EK3A 5AQIB 3PUYF 2OA5A 2LOPA 2JQHA 2WCAA 3IHRA 2KZ7B 2W62A 2KXPB 5FP3A 4IDQA 2JQQA 2C5KT 1QLBA 5FMNA 5ABFB 1LKXA 4EEBA 1VCTA 2V6XA 2XHEB 3PJAA 1I94T 5ETWA 2V5CA 4BJNA 5LG4A 3PUGA 5KXJA 2XM1A 3ZJ1A 3AA6B 1VOMA 4MBQA 4KP3C 4UIGA 3KBUA 4Z91A 5HXEA 3C50A 4IHJE 4ILBA 4LFCT 1UCUA 2CRBA 1N33T 4HWCA 5AQHB 3QK6A 4JBWG 3FZLB 4UF0B 4DR2T 2YN6A 2WWVA 5J2UE 3ZMUB 4X62T 2XUEA 3FXEB 5J1GA 4QKNA 4JI3T 2UXDT 3O4XE 4YJ2E 5JDMA 4CI3B 4CI1B 2CPTA 3QB5K 3F2EA 5JDHA 4DR1T 5H6QB 4ILCA 1M7KA 3RF1A 2X0HA 3ZC0A 2ES0A 4WZXA 4H9QC 4AKHA 2KNDA 1IJ6A 4PJLA 4YTMA 4DR4T 4O2AE 4P1NA 5LYJE 2UUBT 4UR9A 2YINA 3K1SA 4H9SE 4EZHA 1WFDA 5A1LA 2N1GA 4AKIA 3Q9DA 3IF8B 1J5ET 5IUXA 4JBWF 4QH5A 3RC8A 3KV4A 4DR6T 5AQSB 3P4SA 2KLQA 2XJ7A 3ZYLA 2C0SA 4LMLA 3NWIA 2WZIA 2LOSA 3MACA 3MJXA 3ESLA 2VKHA 3N2KE 2MOZA 2WWUA 3D0TA 2M6IA 3E0ZA 3HI2A 1NAFA 4PK4A 2R6GG 1OEDB 5J0ZA 4ANJA 5JDLA 4JYAT 3TLTA 3CX7B 4U72A 4E7ZA 2RP4A 4IE5A 2YOEA 2LM9A 3RYFE 3CIRA 3ZT5A 2E9XA 5BR8T 4PNIA 3JC6D 1S94A 3I1AA 3T8OA 4G63A 1UX5A 4TWHA 1BR0A 2VKOA 3UUBA 4KMCA 3N2OA 3ONXA 3ZN1B
chains in the Genus database with same CATH topology
3PUYG 4XTCM 3RLFG 3PUVF 3TUIA 4YMVC 2ONKC 3PUWF 2R6GG 4YMWC 3DHWA 3PV0G 4TQUN 4JBWF 4XIGN 3PUZF 4KHZF 4YMUC 3PUVG 4KI0F 3PUXF 4TQUM 3TUJA 3PUYF 3RLFF 3PUWG 4YMSC 4XIGM 4JBWG 3PUZG 4XTCN 3TUZA 4KI0G 4KHZG 2R6GF 4YMTB 3PV0F 3D31C 3PUXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY G;  4XTC M;  3RLF G;  3PUV F;  3TUI A;  4YMV C;  2ONK C;  3PUW F;  2R6G G;  4YMW C;  3DHW A;  3PV0 G;  4TQU N;  4JBW F;  4XIG N;  3PUZ F;  4KHZ F;  4YMU C;  3PUV G;  4KI0 F;  3PUX F;  4TQU M;  3TUJ A;  3PUY F;  3RLF F;  3PUW G;  4YMS C;  4XIG M;  4JBW G;  3PUZ G;  4XTC N;  3TUZ A;  4KI0 G;  4KHZ G;  2R6G F;  4YMT B;  3PV0 F;  3D31 C;  3PUX G; 
#chains in the Genus database with same CATH topology
 2XSA A;  1U4Q A;  3QUJ A;  4ZI2 C;  2K48 A;  1W0A A;  1L0V A;  3DTO A;  3SWH A;  2DWG A;  2JJ9 A;  2V7L A;  1UX4 A;  4X66 T;  2CHN A;  4IE7 A;  2R6G F;  3Q5W A;  4C90 A;  4L9I A;  5L3F B;  4ZZB A;  4HWI B;  4LF4 T;  3ZC1 A;  3TKL B;  3JAD A;  5IHY A;  1E2A A;  5JRC A;  4KHP T;  2OV9 A;  3N5L A;  3K3O A;  3N9L A;  5IYZ E;  4JI5 T;  3CQG B;  4WBO A;  4A56 A;  1MIY A;  4MAL A;  5ADX L;  3ZYK A;  1DU2 A;  1AJ3 A;  1I6Z A;  3HKB E;  3BQL A;  4X1Y E;  2X51 A;  2FJB A;  1HR0 T;  4E7S A;  4HEA A;  5CA0 E;  3LG7 A;  1IZN B;  2CXL A;  3UT5 E;  4YXD A;  4PW8 A;  1FJG T;  3NRX A;  4ZEY A;  2LSJ A;  5CGM A;  4CZZ B;  3WAJ A;  3JAE A;  3RGL A;  2CEA A;  2L8K A;  2J4G A;  2QRX A;  2WZH A;  1MMA A;  4HGA A;  3HKD E;  4NUU A;  3VHL A;  2H7V C;  5LJM A;  2CCQ A;  2XQ8 A;  4CN4 A;  3AAA B;  2VKJ A;  2VL8 A;  5HEJ A;  2PTF A;  2UUA T;  3CX8 B;  5L3G B;  4I43 B;  3PE0 A;  4LFB T;  3MK7 C;  3UUX B;  3EUH A;  3ZMV B;  4B3S T;  5JDF A;  2WDQ A;  2BS4 A;  3CQX C;  2K9A A;  3T1Y T;  4YTP A;  3UU8 A;  4GKK T;  4QXB B;  1KNP A;  2V26 A;  3X1D A;  2V7I A;  4B6X A;  2MTQ A;  1KF6 A;  1KNZ A;  1XMQ T;  2JIW A;  2JQK A;  2G0U A;  5AQO B;  3RX6 A;  2BG9 C;  2IIU A;  3FBZ A;  3ETU A;  2VKD A;  3AE7 A;  4MFR A;  2YDS A;  1OED C;  4QH4 A;  4TN7 B;  2RPA A;  2DL1 A;  4GYS A;  2X9H A;  3QNU A;  4GYR A;  2HN1 A;  3FB2 A;  2BKP A;  2BDE A;  3PUR A;  2X68 A;  3ZPO A;  5EK2 A;  1WR6 A;  3TUZ A;  4B3R T;  3NKZ A;  5JDG A;  5HEO A;  3L39 A;  4IE6 A;  2KIN B;  1ZKE A;  2UUC T;  1VRB A;  2LHN A;  5AQV B;  4L0R A;  5KX5 E;  2JMK A;  3N9M A;  1CHU A;  2SPC A;  1WR0 A;  1FEW A;  2MBG A;  3AAE B;  3AEB A;  1G73 A;  3PUS A;  2CLY C;  2NTY A;  4LF6 T;  3BQK A;  2LKH A;  3L8R A;  5LG3 A;  3R6N A;  1V9D A;  3NZP A;  4AI6 A;  5ABH A;  2BS3 A;  3AEC A;  5L3B B;  4CI2 B;  3ZSS A;  5JTG A;  2JQ9 A;  2W63 A;  4DID B;  3N2G E;  1LRZ A;  5AQF B;  4TNV A;  2IML A;  4CXY A;  3CML A;  2ACX A;  1NEK A;  3UUM A;  2UXX B;  1HG2 A;  2WU2 A;  4GK0 E;  4P0B A;  1N34 T;  3UUL A;  4ZI3 D;  3O1I A;  2CE7 A;  1N36 T;  5CFB A;  5LGU B;  1J1J A;  3WI3 A;  2Z6E A;  4KBM B;  2EHO C;  3A8Y C;  1W0B A;  3TLV A;  3PUZ G;  2BZB A;  2KMF A;  2I0M A;  5LNK A;  4U2Z A;  3AE5 A;  3AA1 B;  3AEF A;  2L9Q A;  5FKY A;  5DQW A;  5DAB A;  3C4Z A;  4C91 A;  5LBQ B;  5LMU T;  1IBK T;  3W15 B;  4A98 A;  4PFP A;  2V5D A;  1UK5 A;  2Y8D A;  2LSK A;  1XNR T;  1WCR A;  3FZK B;  4GIW A;  2BBH A;  2H3R A;  3AED A;  4ZZC A;  2Y48 B;  1OXZ A;  3RYC E;  5EZY E;  4Q25 A;  4LF5 T;  3IEE A;  2IHR 1;  2F4V T;  2BG9 E;  4EED A;  2WMO A;  1T8B A;  3K3Q C;  2WU5 A;  2XQY A;  2HPJ A;  1GQE A;  4B3T T;  4IDO A;  2BBJ A;  5AQK B;  1OED E;  3ZN0 B;  3N9Q A;  4L5G A;  4JV5 T;  5JH7 E;  4CXW A;  4PJJ A;  2GK9 A;  2IC9 A;  1HS7 A;  3TUJ A;  2WAU A;  2H89 A;  4MHC A;  1BR4 A;  1BR1 A;  3AAI A;  2ZLY A;  5DJQ C;  3ZT7 A;  5LA6 E;  4F6R C;  5LGN B;  4XAX B;  1MMG A;  5FNV E;  5EK4 A;  5H6R B;  2BG9 A;  4HFI A;  3RKG A;  4DMV A;  2J1D G;  5L47 A;  1SHZ C;  2NR4 A;  4K0U A;  4XTC M;  3OBV E;  1J5W A;  1OED A;  1U5P A;  2CHO A;  2NWB A;  2E5L T;  2K5B B;  4NUV A;  2RA1 A;  3QOF A;  2V1D B;  5C8Y E;  2NW7 A;  5FYM A;  4TX5 A;  3TLS A;  4MLK A;  2XQ5 A;  1Z0P A;  5LHH B;  2VQE T;  2W66 A;  2D2S A;  4DV0 T;  4IDZ A;  3C51 A;  3RQW A;  4HFE A;  1H7C A;  2VUR A;  2VQF T;  2XQ6 A;  4DV5 T;  4TQU M;  3B57 A;  4QXH B;  1KK7 A;  3KV6 A;  4DV3 T;  2YK0 A;  3PUQ A;  3P7I A;  5JDN A;  2XAG B;  5CA1 E;  5CB4 E;  4YY3 T;  5AQT B;  1W9R A;  3AE8 A;  1YW0 A;  1N32 T;  3I9W A;  3EDU A;  5ABE A;  4LF7 T;  1Z8U A;  2FBW A;  4EGW A;  2E9X D;  3HL6 A;  4AQF C;  3LJC A;  2B76 A;  4LMJ A;  2VVS A;  2PG8 A;  4YMW C;  3AEE A;  4PK5 A;  2I59 A;  3PUV G;  4TV9 E;  4X1K E;  3ZMZ B;  3AB3 B;  5LOV E;  2BG9 B;  4QHO A;  2FJD A;  2HHH T;  4PJN A;  2JPF A;  4ILA A;  3GN5 A;  4COF A;  2X66 A;  1HG5 A;  1MIW A;  3ZJ2 A;  3AVS A;  5DQV A;  5L3C B;  4I0U A;  2K24 A;  1XDP A;  3MA9 A;  2EHO A;  5LHG B;  5JQG E;  2YKS A;  4TV8 E;  4WYV A;  3PU8 A;  4JI0 T;  2IC6 A;  1X79 A;  3HR0 A;  5L4E A;  3UTK A;  4TWD A;  4ZHQ E;  4JI2 T;  3RQU A;  2D9D A;  2ZM6 T;  3LBX B;  1MMN A;  4EYY R;  4M1P A;  4ZS3 A;  4ZXL A;  4EAH A;  4JEH B;  2M6B A;  1R8I A;  1IJ5 A;  3QC9 A;  3UU5 A;  2NOX A;  2NTX A;  4HWH A;  5C2T A;  3PUV F;  3SS1 A;  4H63 V;  3RH3 A;  3VRA A;  4QWN B;  4QX8 B;  3F31 A;  1D0Z A;  2UXN B;  2CLY B;  2LLY A;  3I9Y A;  2BVM A;  5FY7 A;  4AXP A;  4LFA T;  4TNW A;  4OYJ A;  3U3I A;  1Y01 A;  4HFB A;  2YDR A;  5E0O A;  3GWH A;  4P0A A;  3K3N A;  4AIU A;  5AQP B;  5FXX A;  4GOU A;  5L3E B;  3OPC A;  3Q5D A;  3B5M A;  4J2C A;  2Q9Q C;  4AKG A;  3AXJ B;  5JDQ A;  4YSX A;  5L3D B;  5LCY A;  4U7Y A;  3G06 A;  3KV5 A;  2DCF A;  2E2A A;  4OK0 A;  1FMV A;  4IST A;  3LK3 B;  3MXZ A;  1WRD A;  3GN5 B;  2L3L A;  1WLX A;  3EHZ A;  3A7M A;  5JR9 C;  1IBL T;  2D0T A;  2LEH A;  4O2B E;  3NRY A;  2EHO B;  4DND A;  3FZH B;  3CKD A;  4LF9 T;  2W4X A;  4U2Y A;  5J2T E;  3P4R A;  4ISS A;  2LRL A;  3RRW A;  5FY1 A;  3C98 B;  4XTC N;  3ZCJ A;  1XWM A;  4GK5 E;  3O9X A;  4CN1 A;  4PFO A;  3RIF A;  2CA5 A;  3AEA A;  3K8P C;  2WS3 A;  3L09 A;  3UFE A;  2H88 A;  4QH1 A;  3HA4 A;  3I0Q A;  3ZMT B;  2XAQ B;  4KHZ G;  4BA9 A;  2ZM2 A;  4NIQ A;  1YXR A;  2WDV A;  3SOL A;  3J7Y q;  5FVK A;  4DV4 T;  1EZ3 A;  3E08 A;  4TQU N;  3CWZ B;  1D0Y A;  4WW0 A;  4IDN A;  1JNR A;  5FXZ A;  2NP9 A;  2XZE A;  4IIJ E;  2WM9 A;  1HFA A;  3OVU A;  4TUY E;  2CBI A;  1XZY A;  3KVB A;  2BVL A;  3EAM A;  3RKO A;  4N78 D;  4AQF A;  5IWA T;  4WNK A;  4YSY A;  3RIU A;  4JI8 T;  2BKN A;  2MPK A;  3LSV A;  3ZMS B;  3VU7 H;  3PUA A;  2FJA A;  3UU3 A;  4WBN E;  4DV2 T;  3EI0 A;  3GMI A;  4ZI2 D;  4KHZ F;  1QSD A;  3H3M A;  3N9O A;  3P4Q A;  3PTR B;  5HXH A;  4KI0 G;  3FBL A;  4P09 A;  4YHJ A;  3RLF G;  4DMW A;  2D5U A;  5HEU A;  3P4P A;  4DR5 T;  4V1A v;  2VWA A;  3VRB A;  2ACZ A;  2XAS B;  1WYB A;  3M3Z B;  3TLW A;  3IBP A;  4HE8 A;  3P8C D;  3H37 A;  3KFW X;  2UXB T;  3AE9 A;  4YMV C;  4HFV A;  2H7O A;  3UUN A;  4QXC B;  5HEG A;  4DO0 A;  2JRK A;  1HTJ F;  2DI4 A;  2LSY A;  4CXX A;  4UVA B;  1MNE A;  2I6H A;  2YEV C;  3FXD B;  4O8S A;  1SA0 E;  3A5X A;  3WAK A;  2YU2 A;  5FXV A;  5GON E;  4TWF A;  5LMN T;  3RLF F;  1SUM B;  1JNZ A;  2E5V A;  2X9X A;  2LHR A;  4YMT B;  3D31 C;  2Q9Q A;  2W61 A;  1KNR A;  2IDO B;  1Y64 B;  1NEN A;  4YLH A;  2LM2 A;  4KX6 A;  4YFS A;  1ZP0 A;  2P9B A;  2MAW A;  5JR9 A;  2J47 A;  3CK6 A;  5HWX A;  3JAF A;  5L4H A;  2LT3 A;  4XZC A;  4HWD A;  5LGT B;  1SE7 A;  3BQI A;  2UXC T;  5KMG P;  2JMH A;  2QVA A;  5FL1 A;  4OHF A;  1NWM X;  5HWY A;  1KEY A;  3UQ7 A;  2XTL A;  5HAX A;  4AQY T;  2N9D A;  2IW5 B;  5AQN B;  3PUZ F;  2LKG A;  2KWH A;  1T7S A;  4H9R C;  4X65 T;  3LFM A;  1HNW T;  1S35 A;  1YD8 G;  1YKH B;  3JC6 C;  2PJQ A;  3Q2M A;  2QGS A;  3QB5 A;  2WB5 A;  3ONL C;  4JI6 T;  5LP6 E;  2K3W A;  4U3C A;  1M62 A;  3CPZ A;  3CVR A;  1US7 B;  2W2U A;  4DVD A;  3RIA A;  5AQU B;  2Q9Q B;  3C4W A;  2LSG A;  3PV0 G;  1E7P A;  4U31 A;  3O1H A;  2ODU A;  2KT9 A;  4Z8X A;  4ZS2 A;  4PK6 A;  1UUR A;  3EVY A;  5FXW A;  3LBX A;  5JR9 B;  2V7J A;  4UVC B;  3RRC A;  4IL9 A;  4O4J E;  2WSS V;  3EAB A;  3ANW A;  4IE4 A;  3ETV A;  4JI4 T;  3I0O A;  2V6Y B;  5AQG B;  3SRZ A;  3OKQ A;  4H63 H;  3E22 E;  4X5T A;  3AA7 B;  4HFH A;  2XM2 A;  4I55 E;  3VKH A;  1MND A;  2NW8 A;  5AQQ B;  4H9N C;  2VL0 A;  4X20 E;  3PUW G;  2EHO D;  2ZMA A;  4I50 E;  5BMV E;  2E8I A;  2QYW A;  3PV0 F;  4DV1 T;  4KUM B;  4QX7 B;  4EZ4 A;  2D0U A;  1HCI A;  2N2N A;  1D1B A;  4X64 T;  3KVA A;  4ASK A;  5FL0 A;  1XDO A;  3RIU C;  2DLR A;  3KV9 A;  3VKG A;  3AXJ A;  4GKJ T;  3L3P A;  4EV6 A;  1W09 A;  2B1E A;  4O4H E;  4O4L E;  2CXD A;  3RYI E;  4DBR A;  3AE3 A;  1HNX T;  4JLE A;  3NZQ A;  3V5U A;  4HKA A;  2WY2 A;  4EIW A;  2QA7 A;  3HKE E;  5LB7 B;  2CWO A;  5KDM C;  5C3J A;  4ADZ A;  4TZ4 C;  3PUW F;  1XNQ T;  3N9N A;  2NW9 A;  1IAP A;  4LF8 T;  3AVR A;  2YU1 A;  2A72 A;  4IE0 A;  3VR8 A;  1HX8 A;  5AQL B;  1YQ4 A;  4JUY A;  2WP9 A;  3ZT6 A;  4YJ3 E;  3ANW B;  4Z90 A;  2OLT A;  4AIS A;  5F5W A;  2V7M A;  4IL4 A;  5HYA A;  1HNZ T;  2C5J A;  3RC3 A;  4U7I A;  3UQ4 A;  2X0L B;  4H9O C;  1T72 A;  3PU3 A;  1UUS A;  4IDP A;  2PFV A;  5ABG A;  1ZOY A;  4ILU A;  5FVL A;  4A97 A;  1XMO T;  3JCF A;  3ZEF B;  1D0X A;  3UU6 A;  1FIO A;  2DHR A;  4EOZ B;  2BKO A;  1OWA A;  2DNX A;  3O1J A;  3ZKR A;  2UU9 T;  3C64 A;  4AKL A;  4UVB B;  1G8X A;  1O3X A;  3DHW A;  2W0G A;  4BAY B;  2J62 A;  4DV7 T;  4DBQ A;  2CWY A;  3C4X A;  4LMK A;  4XIG M;  3CX6 B;  4PJM A;  2HN2 A;  3AEG A;  3PUX G;  3GA8 A;  3HKC E;  4DUY T;  2HPL A;  2HH7 A;  1HX1 B;  1WYC A;  4OYK A;  4DR3 T;  2X67 A;  3M65 A;  2XQA A;  3ZLI A;  3ONJ A;  5CJ5 A;  5HEH A;  3SFD A;  4DUZ T;  3EDV A;  2WDR A;  5HXR A;  3FHN A;  3B13 A;  2WQY A;  2IUB A;  3ABV A;  1ZHC A;  2X9W A;  4ZI3 C;  1ZEE A;  4B3M T;  3UU4 A;  3TLU A;  2DWK A;  2FJE A;  2E9X B;  3AA0 B;  5LBM A;  1UGO A;  3UFG A;  2IAK A;  3Q5E A;  4NPP A;  1D1A A;  4HFC A;  1X9B A;  1T98 A;  2XY8 B;  2CXF A;  2ZM8 A;  2X0Y A;  4U74 A;  2C5I T;  3AE6 A;  1D1C A;  4ERR A;  4YTN A;  2V8S V;  3KBT A;  3PUX F;  4FI5 A;  1KFY A;  3RYH E;  2CM0 A;  2AXD S;  2XAF B;  4DV6 T;  3P4W A;  4OFZ A;  5LJN A;  1CUN A;  3SFE A;  4HN9 A;  4EYU A;  4NXM T;  2KSR A;  5HXC A;  5F3J A;  5JRC B;  2A3D A;  2XPK A;  1ZV4 X;  3H3A A;  3KIN B;  4FJO A;  2LSI A;  4A5X A;  3IA3 A;  3OJA A;  2PBI A;  5AQJ B;  2CMR A;  3NBX X;  5JVD E;  2CBJ A;  4YT0 A;  2W67 A;  4UEM A;  4IRE A;  2ODV A;  2M67 A;  3FZF B;  2LE8 A;  2XSB A;  4ZI7 E;  4U33 A;  4O4I E;  3KDS E;  1LVK A;  3AE1 A;  4F8H A;  4HFD A;  3OTO T;  2VB6 A;  3MKD A;  4YMS C;  2Q9Q D;  3CQC B;  5LXT E;  3ZCI A;  3DP7 A;  2VK9 A;  4EXT A;  2XAJ B;  1FMW A;  3AE2 A;  4UXN B;  3V5S A;  5HXS A;  3AE4 A;  5L2L A;  2A9U A;  4G2A A;  2FUP A;  2A2F X;  4UEL A;  5FY0 A;  3MZK B;  3PDY A;  4JEU B;  5HCM A;  5AFU L;  4YHH T;  5F8P A;  5M4Y A;  4YSZ A;  2LRK A;  3DJB A;  3FZM B;  1B7T A;  2W00 A;  2ONK C;  4DR7 T;  4EB6 E;  4JI7 T;  1E1H B;  4AKR B;  2LJL A;  2VAS A;  4HWF A;  4KI0 F;  4OX9 T;  4K0K T;  2V7K A;  2X9Y A;  2XQ3 A;  3R84 B;  3OYZ A;  3S4U A;  3VR9 A;  4IT4 A;  5ABF A;  2XAH B;  4H9P C;  3OYX A;  4JI1 T;  4UV8 B;  5JRE A;  2Y6X A;  3N9P A;  1IBM T;  2XQ9 A;  5AQM B;  2WMN A;  2YDQ A;  4PAG A;  3RPU A;  5TAO A;  3LK4 2;  4NXN T;  1VCS A;  3J9X 1;  2E9X C;  2WBL A;  1MIV A;  3P50 A;  3PUY G;  1BR2 A;  3TUI A;  3ZYM A;  2ZM0 A;  4AQG A;  4XIG N;  2V6Y A;  4CQI A;  4UF0 A;  3LK2 B;  3RI5 A;  5HCJ A;  2VVN A;  4IGU A;  2KWI B;  3RHW A;  1QUU A;  4UV9 B;  1LVF A;  3ZST A;  4CN6 A;  4ZOL E;  4X1I E;  3Q5X A;  3NVO A;  4I4T E;  4HTE A;  3PJA J;  2XQ7 A;  1YKE B;  2XQ4 A;  4BJM A;  3LDQ B;  4XBF B;  1MMD A;  1YQ3 A;  5AQR B;  2AE9 A;  2MYS A;  2BS2 A;  5LHI B;  3T1H T;  1HF8 A;  3F57 A;  4YMU C;  3U78 A;  3BK9 A;  5EK3 A;  5AQI B;  3PUY F;  2OA5 A;  2LOP A;  2JQH A;  2WCA A;  3IHR A;  2KZ7 B;  2W62 A;  2KXP B;  5FP3 A;  4IDQ A;  2JQQ A;  2C5K T;  1QLB A;  5FMN A;  5ABF B;  1LKX A;  4EEB A;  1VCT A;  2V6X A;  2XHE B;  3PJA A;  1I94 T;  5ETW A;  2V5C A;  4BJN A;  5LG4 A;  3PUG A;  5KXJ A;  2XM1 A;  3ZJ1 A;  3AA6 B;  1VOM A;  4MBQ A;  4KP3 C;  4UIG A;  3KBU A;  4Z91 A;  5HXE A;  3C50 A;  4IHJ E;  4ILB A;  4LFC T;  1UCU A;  2CRB A;  1N33 T;  4HWC A;  5AQH B;  3QK6 A;  4JBW G;  3FZL B;  4UF0 B;  4DR2 T;  2YN6 A;  2WWV A;  5J2U E;  3ZMU B;  4X62 T;  2XUE A;  3FXE B;  5J1G A;  4QKN A;  4JI3 T;  2UXD T;  3O4X E;  4YJ2 E;  5JDM A;  4CI3 B;  4CI1 B;  2CPT A;  3QB5 K;  3F2E A;  5JDH A;  4DR1 T;  5H6Q B;  4ILC A;  1M7K A;  3RF1 A;  2X0H A;  3ZC0 A;  2ES0 A;  4WZX A;  4H9Q C;  4AKH A;  2KND A;  1IJ6 A;  4PJL A;  4YTM A;  4DR4 T;  4O2A E;  4P1N A;  5LYJ E;  2UUB T;  4UR9 A;  2YIN A;  3K1S A;  4H9S E;  4EZH A;  1WFD A;  5A1L A;  2N1G A;  4AKI A;  3Q9D A;  3IF8 B;  1J5E T;  5IUX A;  4JBW F;  4QH5 A;  3RC8 A;  3KV4 A;  4DR6 T;  5AQS B;  3P4S A;  2KLQ A;  2XJ7 A;  3ZYL A;  2C0S A;  4LML A;  3NWI A;  2WZI A;  2LOS A;  3MAC A;  3MJX A;  3ESL A;  2VKH A;  3N2K E;  2MOZ A;  2WWU A;  3D0T A;  2M6I A;  3E0Z A;  3HI2 A;  1NAF A;  4PK4 A;  2R6G G;  1OED B;  5J0Z A;  4ANJ A;  5JDL A;  4JYA T;  3TLT A;  3CX7 B;  4U72 A;  4E7Z A;  2RP4 A;  4IE5 A;  2YOE A;  2LM9 A;  3RYF E;  3CIR A;  3ZT5 A;  2E9X A;  5BR8 T;  4PNI A;  3JC6 D;  1S94 A;  3I1A A;  3T8O A;  4G63 A;  1UX5 A;  4TWH A;  1BR0 A;  2VKO A;  3UUB A;  4KMC A;  3N2O A;  3ONX A;  3ZN1 B; 
#chains in the Genus database with same CATH homology
 3PUY G;  4XTC M;  3RLF G;  3PUV F;  3TUI A;  4YMV C;  2ONK C;  3PUW F;  2R6G G;  4YMW C;  3DHW A;  3PV0 G;  4TQU N;  4JBW F;  4XIG N;  3PUZ F;  4KHZ F;  4YMU C;  3PUV G;  4KI0 F;  3PUX F;  4TQU M;  3TUJ A;  3PUY F;  3RLF F;  3PUW G;  4YMS C;  4XIG M;  4JBW G;  3PUZ G;  4XTC N;  3TUZ A;  4KI0 G;  4KHZ G;  2R6G F;  4YMT B;  3PV0 F;  3D31 C;  3PUX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...