4JBWF

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
492
Chain Sequence
b'SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 119
structure length 492
sequence length 492
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4jbwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4jbwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4jbwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4jbwF02
3PUXF 2R6GG 4YMVC 4KHZF 3PUVG 3PUYF 4XTCM 4JBWG 4KHZG 3PUXG 4XIGM 4YMWC 3PUYG 4YMSC 3TUZA 3DHWA 4KI0F 4TQUN 3TUIA 4KI0G 4YMUC 4XTCN 3RLFF 3PUWF 4TQUM 3PV0F 3PUZF 4XIGN 3TUJA 4YMTB 3PUWG 3RLFG 3PV0G 3PUZG 3D31C 2ONKC 2R6GF 4JBWF 3PUVF
chains in the Genus database with same CATH superfamily
3PUXF 3GMIA 4P1NA 2CM0A 4HFIA 2YU2A 2QYWA 4ZXLA 3KVAA 2V6YB 4UELA 3AA7B 2BS4A 2XTLA 3ZMUB 3QB5K 3CPZA 4CI3B 4AKGA 2UU9T 3VU7H 3TLWA 2KINB 1UK5A 3K3OA 4JI5T 5HCMA 4CN6A 1NAFA 2LE8A 4QH4A 2V6YA 5JDQA 3F2EA 3UUMA 2RPAA 3WI3A 2X9XA 3OJAA 1HCIA 2NTXA 4YTMA 2IHR1 3RIUC 4YLHA 3LK2B 4YHHT 3ZYMA 4YJ2E 1YKEB 1KEYA 2XQ5A 1HF8A 5HEOA 4JI6T 3GN5B 5E0OA 2BG9E 3ZEFB 2WCAA 4H63V 3NVOA 3VRBA 4ILAA 3LFMA 4BJNA 1CUNA 1NEKA 2M6BA 2CA5A 4Z91A 2CXFA 2V8SV 3GN5A 3RX6A 5IWAT 2C5IT 1ZOYA 1I6ZA 4H9RC 3E0ZA 2CE7A 2H3RA 2XQYA 5FY1A 3A8YC 5HWYA 4I4TE 5AQOB 2ZM2A 3C4XA 2VQFT 4CXXA 1H7CA 1J1JA 3VRAA 2KMFA 1SUMB 2JQKA 2X9HA 4B6XA 1XDPA 4X62T 3ZLIA 2BDEA 3EUHA 4LMLA 4CZZB 3ONJA 2D0UA 2X66A 2CCQA 2XASB 3S4UA 4LFAT 3T1YT 2XAFB 3AE6A 3A5XA 5LGUB 2X0YA 2CBIA 2YDSA 4UF0B 3ZMVB 3AE4A 3AEAA 3JAEA 4GK0E 2WQYA 4MLKA 4X1IE 2VKOA 3RI5A 2V5CA 3F31A 4DR1T 4CQIA 3OBVE 4A98A 3ABVA 4YHJA 3O9XA 3HKEE 4FJOA 4UF0A 2XQ7A 3JADA 2NOXA 3O1HA 4IL4A 3IHRA 2FJBA 3C64A 4KBMB 2OLTA 3PJAA 2V7JA 4L0RA 1WLXA 1QLBA 5LCYA 4ILCA 2LSYA 5FY0A 4UIGA 4HGAA 2QVAA 1U4QA 3TLVA 2LSGA 2I0MA 5FY7A 1W0AA 3PUYG 4ZS3A 3FZHB 2J4GA 4ZOLE 4NPPA 1UX4A 5LXTE 3AA6B 5ABFB 5FVLA 4XTCN 3PUZF 2LSJA 4U74A 1YW0A 3ZMTB 1ZV4X 4ERRA 3ZCJA 2CHOA 3TUZA 4IE7A 2FJAA 4KI0F 5JR9A 5KX5E 1T8BA 5ABFA 3RYHE 2JJ9A 3IBPA 4DR5T 1Y01A 4UEMA 4ANJA 2Y8DA 4QX7B 4AKHA 5AQKB 2WP9A 5LG4A 2H7OA 3L09A 4MALA 3CK6A 5FXVA 4A56A 3QUJA 2UXNB 3LBXB 4XIGN 2LEHA 4ZS2A 4LF9T 3D31C 3UUNA 5TAOA 5C8YE 1N34T 4H9OC 4AQGA 3KV9A 3UQ7A 2IMLA 2YOEA 4LMKA 4BAYB 3MKDA 2JQHA 3LBXA 2V6XA 3WAKA 4O2BE 5LNKA 2ZMAA 1YQ4A 1G8XA 2IW5B 4CXWA 2DHRA 4E7SA 2W2UA 4YY3T 5L3DB 2HN1A 3MZKB 4DR6T 3ANWB 1M62A 3M65A 5JRCB 4PJLA 2ZM0A 3B13A 1LRZA 3NBXX 2GK9A 3N2GE 4LMJA 3ZC0A 2HHHT 4A97A 3ANWA 5EK4A 4DV6T 2RP4A 3U78A 5JRCA 4YMTB 2J47A 3RRCA 3OVUA 5L4EA 2JMHA 3PUSA 5HXHA 3EVYA 1WYCA 3N9OA 3OTOT 1KNPA 2HH7A 3FBZA 3PU8A 4CI2B 1MIYA 2XM2A 4HE8A 5JTGA 3RYIE 3ETVA 4OHFA 4HKAA 3O1IA 2K3WA 4EZ4A 5FNVE 5LOVE 4EOZB 3N9LA 2Q9QB 4G2AA 4PFPA 2MPKA 5ABEA 4AISA 2YKSA 4H9QC 2LM2A 3EI0A 2NP9A 4YMSC 4U72A 3H3AA 4TX5A 5HEJA 4O4HE 4DMVA 2LRLA 2V7IA 3BK9A 3LG7A 2WM9A 3N9PA 3QK6A 3I9YA 3H3MA 3RYFE 4QX8B 4TNWA 4YTNA 1MMGA 5AQVB 2Q9QA 5ABGA 1V9DA 4ZI7E 5LHIB 3AE7A 2W62A 3AEEA 4PFOA 1U5PA 3PUAA 3AE2A 5LJMA 4OX9T 1NWMX 3AEFA 1UUSA 3RC8A 1GQEA 4QHOA 5LGNB 2CRBA 1MIWA 1D0YA 3ZMSB 2VVSA 1QUUA 3BQIA 4PNIA 2W4XA 4XBFB 3KBUA 4DBRA 4HFCA 3PUQA 4JBWF 3P4WA 2ES0A 2ODUA 4IIJE 3PUWF 3MJXA 4DUZT 2Q9QC 5J0ZA 3AECA 4LF7T 4ILBA 3VKGA 2L3LA 3AE9A 2V7MA 4K0KT 2JQ9A 1HX8A 2C5KT 5ETWA 2XPKA 2XAQB 5AQFB 1D1AA 2X0HA 2VWAA 5LGTB 2BBHA 3QB5A 5JDMA 4C91A 4UXNB 4TV8E 3MK7C 5HCJA 3AEDA 4K0UA 3UU6A 4Q25A 4LF6T 3RKOA 4TQUM 3P4SA 3J9X1 2I59A 3N9NA 5JDGA 5AQLB 4QXBB 5FL0A 3OYZA 1KNZA 2K48A 2XSAA 4P09A 5H6RB 5CGMA 1JNZA 4UR9A 3ZSTA 4G63A 3NRXA 2P9BA 1WR6A 3E08A 4YMWC 4DV1T 4AXPA 3FHNA 4EXTA 1D1BA 4ASKA 4F8HA 2A9UA 1ZP0A 5IUXA 3AE5A 4X5TA 3L8RA 1N33T 2LT3A 1VRBA 2E5VA 2JQQA 4HFEA 5ABHA 5JDLA 3ZYKA 2DI4A 2HN2A 5JH7E 5ADXL 3RQWA 3UQ4A 3CX6B 4O4LE 4U7IA 4GKJT 3P7IA 1HTJF 4WBNE 1KF6A 2D0TA 4EYYR 3TLSA 2UXBT 5L2LA 3HI2A 1W0BA 3PUZG 4AQFA 4LF8T 4YXDA 3K3QC 5LG3A 1LKXA 4X1YE 4GKKT 2Z6EA 1SHZC 4XZCA 3PE0A 2OA5A 3RLFF 2H89A 2WY2A 4AI6A 3PV0F 3X1DA 1IZNB 4J2CA 2UUBT 3SOLA 3T8OA 4I55E 1G73A 2J1DG 2A3DA 2D5UA 3B57A 2ZM8A 3RYCE 4AKLA 3PU3A 4DR7T 3DJBA 2XAHB 5AQHB 4CXYA 2VB6A 1FMWA 4AIUA 2LHRA 3O4XE 1XMQT 3SWHA 4B3RT 4NXNT 5AQRB 1JNRA 3A7MA 2VKJA 2WSSV 2C0SA 4PK4A 4ISSA 4GOUA 4DO0A 4QXHB 3RF1A 5HEHA 4AQFC 3ZYLA 3K8PC 4ADZA 1HFAA 2YN6A 5F3JA 2N1GA 4TZ4C 5HXRA 1N32T 4C90A 4ZZBA 4QH1A 5FL1A 3I9WA 5JQGE 2VASA 5L3CB 2WB5A 1J5WA 4YJ3E 5J2UE 1MIVA 3FXEB 4IDOA 2NW7A 2MTQA 4P0BA 2DCFA 1SE7A 4GYRA 4EB6E 4F6RC 3CWZB 2Q9QD 4GYSA 4TV9E 2VK9A 4WYVA 5JDHA 3RIAA 3VR9A 3EDUA 1UGOA 3OYXA 3PDYA 1O3XA 3V5SA 3Q5EA 4KHZF 4MBQA 4BJMA 4UV8B 1YQ3A 2CWOA 3FZMB 4OFZA 2WU2A 4HWHA 4HWFA 5AQSB 5KMGP 2QA7A 5JR9B 4UVAB 2RA1A 4JI8T 1IAPA 3P4QA 3P8CD 3RRWA 5CB4E 1FEWA 2FJDA 4IL9A 1QSDA 4Z90A 2MBGA 1FIOA 1D0ZA 4DV5T 2LLYA 4JI2T 4JUYA 3UU3A 4DBQA 3FB2A 2WU5A 2AE9A 2WDVA 1DU2A 3CX8B 3FBLA 3ZT7A 4TNVA 3KVBA 4OYJA 3NZPA 4YT0A 4YTPA 2X9WA 4KP3C 2XQ9A 3RKGA 4H63H 2G0UA 1ZHCA 3LDQB 3RHWA 4X1KE 4AKRB 4DMWA 2BKOA 2YDQA 2VURA 4QWNB 3AE1A 3ZN0B 1FMVA 4EAHA 2W67A 3EHZA 4DVDA 2V7KA 2NR4A 3UUBA 3Q5WA 2ACZA 2XQAA 4O4IE 4TWFA 3NWIA 4LF5T 4XTCM 2ZM6T 4PK6A 5AQTB 5JR9C 1BR4A 1BR0A 1D1CA 5H6QB 3CQCB 2H88A 4U31A 3LK3B 3PUWG 4OYKA 3O1JA 2CEAA 2R6GF 2V26A 2DLRA 1WRDA 2VKDA 3Q5DA 1VCTA 2FBWA 5DQVA 5JVDE 2MOZA 2IDOB 1OXZA 2XY8B 4TWHA 4UVBB 3ZCIA 2CLYB 3F57A 2UUAT 3DTOA 4YSYA 5LYJE 3JC6C 3CIRA 4XIGM 3PUXG 3DHWA 3T1HT 5AQQB 5CA1E 2K5BB 3ZT6A 2LHNA 5C2TA 3ZPOA 4H9PC 2WZHA 2HPJA 4KUMB 2XHEB 3TKLB 2VL8A 4U3CA 2IAKA 2XQ8A 3ZN1B 1M7KA 2LRKA 4IE4A 3KV6A 2XQ4A 1XNQT 3VKHA 4P0AA 2IIUA 2KNDA 1HX1B 1XDOA 3JAFA 1IBLT 3RGLA 4ZI3C 4PW8A 1UCUA 4B3MT 4ISTA 1XNRT 5L3GB 4UVCB 5AQPB 4O4JE 3E22E 5AQNB 3QNUA 4PAGA 5LB7B 2IC9A 3AE3A 2E8IA 3K1SA 5HAXA 2V1DB 4JI0T 3M3ZB 5HEUA 1T72A 2W63A 3AEBA 1SA0E 4MFRA 3Q9DA 2OV9A 2CLYC 2E2AA 2WS3A 3UTKA 4YSXA 1MNEA 3U3IA 3ONLC 2X67A 2N2NA 5J1GA 2VVNA 3UU8A 2IC6A 3W15B 5AFUL 3AAEB 4WNKA 2D2SA 3PV0G 2KSRA 2XZEA 5LA6E 3SS1A 4I43B 1HG5A 4I0UA 2VKHA 4PK5A 2DL1A 3NRYA 2DNXA 3AA0B 3G06A 3N5LA 3ZMZB 3R84B 5F5WA 4NXMT 4DR4T 3KBTA 5AQGB 4U2YA 1WCRA 2CMRA 1J5ET 1L0VA 1HR0T 2X68A 1I94T 2X51A 3ZJ2A 3MXZA 3QOFA 4DUYT 2CXDA 2WMNA 4EZHA 3N9QA 4NUUA 3BQLA 3EAMA 3JCFA 4HEAA 3N2OA 3TLTA 4GIWA 2D9DA 2XM1A 2X0LB 4ZEYA 4I50E 3WAJA 4A5XA 5F8PA 2CWYA 3UUXB 2KWIB 5CA0E 4JI3T 2LSKA 2A72A 2EHOB 2UXCT 5HEGA 4HFDA 3UU4A 5DQWA 2I6HA 4O2AE 3AB3B 2LKHA 1B7TA 3KV4A 3MACA 2JRKA 4QH5A 4DV7T 2EHOA 3PTRB 3Q5XA 3ESLA 4OK0A 4X20E 1MMDA 5LJNA 2WDRA 2E5LT 4KHZG 2VL0A 2XSBA 1BR2A 3AAAB 4TWDA 4U33A 5JREA 3OPCA 3ONXA 2LJLA 1X9BA 4DV2T 4JI4T 3IA3A 1OEDB 3JC6D 4IDQA 2LOSA 2NTYA 2PBIA 5CJ5A 4PJJA 5EZYE 2LKGA 4JYAT 2JMKA 2XUEA 3K3NA 4DR3T 4COFA 4ZZCA 1LVKA 4HWIB 4U7YA 4KI0G 5GONE 2DWGA 5L3FB 4IE5A 5BR8T 3Q2MA 1OEDA 3V5UA 4TUYE 3PUVF 4YMVC 1E1HB 2HPLA 4IDPA 4IDZA 2BS2A 2E9XB 2C5JA 1KK7A 2WWUA 3EDVA 4EV6A 2EHOC 4LFCT 3VR8A 4X66T 2L9QA 3CX7B 5LMUT 1YD8G 5FXZA 3HKBE 4YFSA 1W9RA 4ZI3D 4ZI2C 2UXDT 1WFDA 2WDQA 3HR0A 4CI1B 3SFDA 2E9XA 3UFGA 4JEHB 1MMAA 2PTFA 2IUBA 2WBLA 1Z8UA 2MYSA 2AXDS 2XQ3A 1Y64B 3C4WA 3ETUA 2B1EA 3C4ZA 5HXSA 3KFWX 3C51A 3N2KE 2BZBA 3J7Yq 2YK0A 3HA4A 3FXDB 3KDSE 2DWKA 2UXXB 1ZEEA 3CVRA 2BBJA 1OEDC 5DJQC 4WBOA 2R6GG 2BKPA 4WW0A 5L4HA 2QGSA 1E2AA 4L5GA 2A2FX 3LK42 4QKNA 4HWDA 3IEEA 4IGUA 4N78D 3I1AA 4FI5A 4B3TT 1VCSA 2X9YA 4JI7T 2L8KA 2SPCA 5HYAA 2E9XC 4QXCB 3ZSSA 5J2TE 4DV4T 2KT9A 4IDNA 1OWAA 1IJ6A 1T7SA 4ILUA 4O8SA 3VHLA 3FZLB 4DV3T 1N36T 4ZHQE 3R6NA 4HFVA 2ZLYA 2WAUA 2XAJB 4EEBA 2V7LA 2Y6XA 1Z0PA 5AQMB 3P4RA 2NW8A 3ZKRA 5C3JA 2LSIA 3RC3A 1WYBA 3MA9A 1HNWT 3QC9A 5AQUB 2BG9B 4EGWA 3HL6A 3AXJB 3CMLA 2N9DA 4LF4T 2WMOA 2K24A 3CKDA 4IT4A 3LSVA 5CFBA 1HS7A 2VQET 2XJ7A 4IE0A 4YMUC 2BG9A 2NWBA 5FMNA 4L9IA 3AXJA 2B76A 4JV5T 2JPFA 1BR1A 3RIFA 4DNDA 4U2ZA 3ZT5A 5FXXA 5KXJA 4JBWG 3P50A 1MNDA 2KZ7B 3N9MA 5BMVE 2W61A 2Y48B 1VOMA 2CXLA 4IE6A 4BA9A 3C50A 3HKCE 5A1LA 5LHHB 1AJ3A 2NW9A 4GK5E 5JDFA 1XWMA 1IBKT 4DIDB 5EK3A 3B5MA 2LOPA 1IJ5A 2LM9A 1HNZT 1US7B 1S94A 4UV9B 5JDNA 4YSZA 3D0TA 5FXWA 5FP3A 5AQIB 2F4VT 1FJGT 3I0OA 3HKDE 3UU5A 4CN4A 1EZ3A 1HNXT 3FZKB 4X65T 2XQ6A 1R8IA 1UURA 4HTEA 2M67A 2BG9C 3L3PA 4JI1T 2EHOD 2PG8A 3H37A 2WZIA 1T98A 2K9AA 2YEVC 4KHPT 1KFYA 4ZI2D 4V1Av 2CPTA 3PUYF 2KLQA 3SRZA 3NZQA 3ZJ1A 2BVLA 2BVMA 4WZXA 1D0XA 4AQYT 1ZKEA 3AEGA 3TLUA 1KNRA 3UULA 3AE8A 4H9NC 2FJEA 4EYUA 5EK2A 4EEDA 1YXRA 2KXPB 4KMCA 1CHUA 2YDRA 3UT5E 1OEDE 5LHGB 4EIWA 4NIQA 2FUPA 2W0GA 2H7VC 3KV5A 4DV0T 3TUIA 2YINA 4PJMA 3LJCA 4JLEA 3GA8A 5LP6E 5L47A 1HG2A 5KDMC 3AAIA 3PJAJ 5HXEA 4PJNA 4NUVA 5M4YA 3UFEA 4M1PA 4HWCA 3CQXC 3CQGB 3NKZA 5IHYA 1LVFA 1E7PA 2XAGB 3OKQA 4TQUN 3PURA 2W66A 2JIWA 1XZYA 3FZFB 4B3ST 1S35A 3TUJA 1UX5A 5FVKA 5LBQB 1WR0A 2E9XD 3P4PA 4HFBA 4IHJE 4Z8XA 4LFBT 4MHCA 4IREA 4HFHA 1W09A 3GWHA 3AVRA 2PJQA 3RLFG 1MMNA 2ACXA 5LMNT 4DR2T 3KINB 2ONKC 2V5DA 2J62A 5DABA 5L3EB 5IYZE 3ZC1A 3PUVG 4H9SE 3AA1B 1XMOT 2QRXA 4XAXB 1YKHB 3BQKA 2KWHA 2MAWA 4E7ZA 2CHNA 4HN9A 2ODVA 3RQUA 3AVSA 5L3BB 1X79A 5HXCA 2BS3A 2YU1A 4TN7B 3SFEA 2PFVA 5FYMA 2M6IA 4JEUB 1IBMT 5FKYA 2WWVA 2UUCT 2CBJA 2BKNA 5AQJB 3DP7A 3EABA 1NENA 2W00A 3PUGA 4AKIA 3RIUA 3IF8B 3I0QA 3C98B 3RH3A 4KX6A 3RPUA 4CN1A 5LBMA 3L39A 5HWXA 4X64T
chains in the Genus database with same CATH topology
3PUXF 2R6GG 4YMVC 4KHZF 3PUVG 3PUYF 4XTCM 4JBWG 4KHZG 3PUXG 4XIGM 4YMWC 3PUYG 4YMSC 3TUZA 3DHWA 4KI0F 4TQUN 3TUIA 4KI0G 4YMUC 4XTCN 3RLFF 3PUWF 4TQUM 3PV0F 3PUZF 4XIGN 3TUJA 4YMTB 3PUWG 3RLFG 3PV0G 3PUZG 3D31C 2ONKC 2R6GF 4JBWF 3PUVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX F;  2R6G G;  4YMV C;  4KHZ F;  3PUV G;  3PUY F;  4XTC M;  4JBW G;  4KHZ G;  3PUX G;  4XIG M;  4YMW C;  3PUY G;  4YMS C;  3TUZ A;  3DHW A;  4KI0 F;  4TQU N;  3TUI A;  4KI0 G;  4YMU C;  4XTC N;  3RLF F;  3PUW F;  4TQU M;  3PV0 F;  3PUZ F;  4XIG N;  3TUJ A;  4YMT B;  3PUW G;  3RLF G;  3PV0 G;  3PUZ G;  3D31 C;  2ONK C;  2R6G F;  4JBW F;  3PUV F; 
#chains in the Genus database with same CATH topology
 3PUX F;  3GMI A;  4P1N A;  2CM0 A;  4HFI A;  2YU2 A;  2QYW A;  4ZXL A;  3KVA A;  2V6Y B;  4UEL A;  3AA7 B;  2BS4 A;  2XTL A;  3ZMU B;  3QB5 K;  3CPZ A;  4CI3 B;  4AKG A;  2UU9 T;  3VU7 H;  3TLW A;  2KIN B;  1UK5 A;  3K3O A;  4JI5 T;  5HCM A;  4CN6 A;  1NAF A;  2LE8 A;  4QH4 A;  2V6Y A;  5JDQ A;  3F2E A;  3UUM A;  2RPA A;  3WI3 A;  2X9X A;  3OJA A;  1HCI A;  2NTX A;  4YTM A;  2IHR 1;  3RIU C;  4YLH A;  3LK2 B;  4YHH T;  3ZYM A;  4YJ2 E;  1YKE B;  1KEY A;  2XQ5 A;  1HF8 A;  5HEO A;  4JI6 T;  3GN5 B;  5E0O A;  2BG9 E;  3ZEF B;  2WCA A;  4H63 V;  3NVO A;  3VRB A;  4ILA A;  3LFM A;  4BJN A;  1CUN A;  1NEK A;  2M6B A;  2CA5 A;  4Z91 A;  2CXF A;  2V8S V;  3GN5 A;  3RX6 A;  5IWA T;  2C5I T;  1ZOY A;  1I6Z A;  4H9R C;  3E0Z A;  2CE7 A;  2H3R A;  2XQY A;  5FY1 A;  3A8Y C;  5HWY A;  4I4T E;  5AQO B;  2ZM2 A;  3C4X A;  2VQF T;  4CXX A;  1H7C A;  1J1J A;  3VRA A;  2KMF A;  1SUM B;  2JQK A;  2X9H A;  4B6X A;  1XDP A;  4X62 T;  3ZLI A;  2BDE A;  3EUH A;  4LML A;  4CZZ B;  3ONJ A;  2D0U A;  2X66 A;  2CCQ A;  2XAS B;  3S4U A;  4LFA T;  3T1Y T;  2XAF B;  3AE6 A;  3A5X A;  5LGU B;  2X0Y A;  2CBI A;  2YDS A;  4UF0 B;  3ZMV B;  3AE4 A;  3AEA A;  3JAE A;  4GK0 E;  2WQY A;  4MLK A;  4X1I E;  2VKO A;  3RI5 A;  2V5C A;  3F31 A;  4DR1 T;  4CQI A;  3OBV E;  4A98 A;  3ABV A;  4YHJ A;  3O9X A;  3HKE E;  4FJO A;  4UF0 A;  2XQ7 A;  3JAD A;  2NOX A;  3O1H A;  4IL4 A;  3IHR A;  2FJB A;  3C64 A;  4KBM B;  2OLT A;  3PJA A;  2V7J A;  4L0R A;  1WLX A;  1QLB A;  5LCY A;  4ILC A;  2LSY A;  5FY0 A;  4UIG A;  4HGA A;  2QVA A;  1U4Q A;  3TLV A;  2LSG A;  2I0M A;  5FY7 A;  1W0A A;  3PUY G;  4ZS3 A;  3FZH B;  2J4G A;  4ZOL E;  4NPP A;  1UX4 A;  5LXT E;  3AA6 B;  5ABF B;  5FVL A;  4XTC N;  3PUZ F;  2LSJ A;  4U74 A;  1YW0 A;  3ZMT B;  1ZV4 X;  4ERR A;  3ZCJ A;  2CHO A;  3TUZ A;  4IE7 A;  2FJA A;  4KI0 F;  5JR9 A;  5KX5 E;  1T8B A;  5ABF A;  3RYH E;  2JJ9 A;  3IBP A;  4DR5 T;  1Y01 A;  4UEM A;  4ANJ A;  2Y8D A;  4QX7 B;  4AKH A;  5AQK B;  2WP9 A;  5LG4 A;  2H7O A;  3L09 A;  4MAL A;  3CK6 A;  5FXV A;  4A56 A;  3QUJ A;  2UXN B;  3LBX B;  4XIG N;  2LEH A;  4ZS2 A;  4LF9 T;  3D31 C;  3UUN A;  5TAO A;  5C8Y E;  1N34 T;  4H9O C;  4AQG A;  3KV9 A;  3UQ7 A;  2IML A;  2YOE A;  4LMK A;  4BAY B;  3MKD A;  2JQH A;  3LBX A;  2V6X A;  3WAK A;  4O2B E;  5LNK A;  2ZMA A;  1YQ4 A;  1G8X A;  2IW5 B;  4CXW A;  2DHR A;  4E7S A;  2W2U A;  4YY3 T;  5L3D B;  2HN1 A;  3MZK B;  4DR6 T;  3ANW B;  1M62 A;  3M65 A;  5JRC B;  4PJL A;  2ZM0 A;  3B13 A;  1LRZ A;  3NBX X;  2GK9 A;  3N2G E;  4LMJ A;  3ZC0 A;  2HHH T;  4A97 A;  3ANW A;  5EK4 A;  4DV6 T;  2RP4 A;  3U78 A;  5JRC A;  4YMT B;  2J47 A;  3RRC A;  3OVU A;  5L4E A;  2JMH A;  3PUS A;  5HXH A;  3EVY A;  1WYC A;  3N9O A;  3OTO T;  1KNP A;  2HH7 A;  3FBZ A;  3PU8 A;  4CI2 B;  1MIY A;  2XM2 A;  4HE8 A;  5JTG A;  3RYI E;  3ETV A;  4OHF A;  4HKA A;  3O1I A;  2K3W A;  4EZ4 A;  5FNV E;  5LOV E;  4EOZ B;  3N9L A;  2Q9Q B;  4G2A A;  4PFP A;  2MPK A;  5ABE A;  4AIS A;  2YKS A;  4H9Q C;  2LM2 A;  3EI0 A;  2NP9 A;  4YMS C;  4U72 A;  3H3A A;  4TX5 A;  5HEJ A;  4O4H E;  4DMV A;  2LRL A;  2V7I A;  3BK9 A;  3LG7 A;  2WM9 A;  3N9P A;  3QK6 A;  3I9Y A;  3H3M A;  3RYF E;  4QX8 B;  4TNW A;  4YTN A;  1MMG A;  5AQV B;  2Q9Q A;  5ABG A;  1V9D A;  4ZI7 E;  5LHI B;  3AE7 A;  2W62 A;  3AEE A;  4PFO A;  1U5P A;  3PUA A;  3AE2 A;  5LJM A;  4OX9 T;  1NWM X;  3AEF A;  1UUS A;  3RC8 A;  1GQE A;  4QHO A;  5LGN B;  2CRB A;  1MIW A;  1D0Y A;  3ZMS B;  2VVS A;  1QUU A;  3BQI A;  4PNI A;  2W4X A;  4XBF B;  3KBU A;  4DBR A;  4HFC A;  3PUQ A;  4JBW F;  3P4W A;  2ES0 A;  2ODU A;  4IIJ E;  3PUW F;  3MJX A;  4DUZ T;  2Q9Q C;  5J0Z A;  3AEC A;  4LF7 T;  4ILB A;  3VKG A;  2L3L A;  3AE9 A;  2V7M A;  4K0K T;  2JQ9 A;  1HX8 A;  2C5K T;  5ETW A;  2XPK A;  2XAQ B;  5AQF B;  1D1A A;  2X0H A;  2VWA A;  5LGT B;  2BBH A;  3QB5 A;  5JDM A;  4C91 A;  4UXN B;  4TV8 E;  3MK7 C;  5HCJ A;  3AED A;  4K0U A;  3UU6 A;  4Q25 A;  4LF6 T;  3RKO A;  4TQU M;  3P4S A;  3J9X 1;  2I59 A;  3N9N A;  5JDG A;  5AQL B;  4QXB B;  5FL0 A;  3OYZ A;  1KNZ A;  2K48 A;  2XSA A;  4P09 A;  5H6R B;  5CGM A;  1JNZ A;  4UR9 A;  3ZST A;  4G63 A;  3NRX A;  2P9B A;  1WR6 A;  3E08 A;  4YMW C;  4DV1 T;  4AXP A;  3FHN A;  4EXT A;  1D1B A;  4ASK A;  4F8H A;  2A9U A;  1ZP0 A;  5IUX A;  3AE5 A;  4X5T A;  3L8R A;  1N33 T;  2LT3 A;  1VRB A;  2E5V A;  2JQQ A;  4HFE A;  5ABH A;  5JDL A;  3ZYK A;  2DI4 A;  2HN2 A;  5JH7 E;  5ADX L;  3RQW A;  3UQ4 A;  3CX6 B;  4O4L E;  4U7I A;  4GKJ T;  3P7I A;  1HTJ F;  4WBN E;  1KF6 A;  2D0T A;  4EYY R;  3TLS A;  2UXB T;  5L2L A;  3HI2 A;  1W0B A;  3PUZ G;  4AQF A;  4LF8 T;  4YXD A;  3K3Q C;  5LG3 A;  1LKX A;  4X1Y E;  4GKK T;  2Z6E A;  1SHZ C;  4XZC A;  3PE0 A;  2OA5 A;  3RLF F;  2H89 A;  2WY2 A;  4AI6 A;  3PV0 F;  3X1D A;  1IZN B;  4J2C A;  2UUB T;  3SOL A;  3T8O A;  4I55 E;  1G73 A;  2J1D G;  2A3D A;  2D5U A;  3B57 A;  2ZM8 A;  3RYC E;  4AKL A;  3PU3 A;  4DR7 T;  3DJB A;  2XAH B;  5AQH B;  4CXY A;  2VB6 A;  1FMW A;  4AIU A;  2LHR A;  3O4X E;  1XMQ T;  3SWH A;  4B3R T;  4NXN T;  5AQR B;  1JNR A;  3A7M A;  2VKJ A;  2WSS V;  2C0S A;  4PK4 A;  4ISS A;  4GOU A;  4DO0 A;  4QXH B;  3RF1 A;  5HEH A;  4AQF C;  3ZYL A;  3K8P C;  4ADZ A;  1HFA A;  2YN6 A;  5F3J A;  2N1G A;  4TZ4 C;  5HXR A;  1N32 T;  4C90 A;  4ZZB A;  4QH1 A;  5FL1 A;  3I9W A;  5JQG E;  2VAS A;  5L3C B;  2WB5 A;  1J5W A;  4YJ3 E;  5J2U E;  1MIV A;  3FXE B;  4IDO A;  2NW7 A;  2MTQ A;  4P0B A;  2DCF A;  1SE7 A;  4GYR A;  4EB6 E;  4F6R C;  3CWZ B;  2Q9Q D;  4GYS A;  4TV9 E;  2VK9 A;  4WYV A;  5JDH A;  3RIA A;  3VR9 A;  3EDU A;  1UGO A;  3OYX A;  3PDY A;  1O3X A;  3V5S A;  3Q5E A;  4KHZ F;  4MBQ A;  4BJM A;  4UV8 B;  1YQ3 A;  2CWO A;  3FZM B;  4OFZ A;  2WU2 A;  4HWH A;  4HWF A;  5AQS B;  5KMG P;  2QA7 A;  5JR9 B;  4UVA B;  2RA1 A;  4JI8 T;  1IAP A;  3P4Q A;  3P8C D;  3RRW A;  5CB4 E;  1FEW A;  2FJD A;  4IL9 A;  1QSD A;  4Z90 A;  2MBG A;  1FIO A;  1D0Z A;  4DV5 T;  2LLY A;  4JI2 T;  4JUY A;  3UU3 A;  4DBQ A;  3FB2 A;  2WU5 A;  2AE9 A;  2WDV A;  1DU2 A;  3CX8 B;  3FBL A;  3ZT7 A;  4TNV A;  3KVB A;  4OYJ A;  3NZP A;  4YT0 A;  4YTP A;  2X9W A;  4KP3 C;  2XQ9 A;  3RKG A;  4H63 H;  2G0U A;  1ZHC A;  3LDQ B;  3RHW A;  4X1K E;  4AKR B;  4DMW A;  2BKO A;  2YDQ A;  2VUR A;  4QWN B;  3AE1 A;  3ZN0 B;  1FMV A;  4EAH A;  2W67 A;  3EHZ A;  4DVD A;  2V7K A;  2NR4 A;  3UUB A;  3Q5W A;  2ACZ A;  2XQA A;  4O4I E;  4TWF A;  3NWI A;  4LF5 T;  4XTC M;  2ZM6 T;  4PK6 A;  5AQT B;  5JR9 C;  1BR4 A;  1BR0 A;  1D1C A;  5H6Q B;  3CQC B;  2H88 A;  4U31 A;  3LK3 B;  3PUW G;  4OYK A;  3O1J A;  2CEA A;  2R6G F;  2V26 A;  2DLR A;  1WRD A;  2VKD A;  3Q5D A;  1VCT A;  2FBW A;  5DQV A;  5JVD E;  2MOZ A;  2IDO B;  1OXZ A;  2XY8 B;  4TWH A;  4UVB B;  3ZCI A;  2CLY B;  3F57 A;  2UUA T;  3DTO A;  4YSY A;  5LYJ E;  3JC6 C;  3CIR A;  4XIG M;  3PUX G;  3DHW A;  3T1H T;  5AQQ B;  5CA1 E;  2K5B B;  3ZT6 A;  2LHN A;  5C2T A;  3ZPO A;  4H9P C;  2WZH A;  2HPJ A;  4KUM B;  2XHE B;  3TKL B;  2VL8 A;  4U3C A;  2IAK A;  2XQ8 A;  3ZN1 B;  1M7K A;  2LRK A;  4IE4 A;  3KV6 A;  2XQ4 A;  1XNQ T;  3VKH A;  4P0A A;  2IIU A;  2KND A;  1HX1 B;  1XDO A;  3JAF A;  1IBL T;  3RGL A;  4ZI3 C;  4PW8 A;  1UCU A;  4B3M T;  4IST A;  1XNR T;  5L3G B;  4UVC B;  5AQP B;  4O4J E;  3E22 E;  5AQN B;  3QNU A;  4PAG A;  5LB7 B;  2IC9 A;  3AE3 A;  2E8I A;  3K1S A;  5HAX A;  2V1D B;  4JI0 T;  3M3Z B;  5HEU A;  1T72 A;  2W63 A;  3AEB A;  1SA0 E;  4MFR A;  3Q9D A;  2OV9 A;  2CLY C;  2E2A A;  2WS3 A;  3UTK A;  4YSX A;  1MNE A;  3U3I A;  3ONL C;  2X67 A;  2N2N A;  5J1G A;  2VVN A;  3UU8 A;  2IC6 A;  3W15 B;  5AFU L;  3AAE B;  4WNK A;  2D2S A;  3PV0 G;  2KSR A;  2XZE A;  5LA6 E;  3SS1 A;  4I43 B;  1HG5 A;  4I0U A;  2VKH A;  4PK5 A;  2DL1 A;  3NRY A;  2DNX A;  3AA0 B;  3G06 A;  3N5L A;  3ZMZ B;  3R84 B;  5F5W A;  4NXM T;  4DR4 T;  3KBT A;  5AQG B;  4U2Y A;  1WCR A;  2CMR A;  1J5E T;  1L0V A;  1HR0 T;  2X68 A;  1I94 T;  2X51 A;  3ZJ2 A;  3MXZ A;  3QOF A;  4DUY T;  2CXD A;  2WMN A;  4EZH A;  3N9Q A;  4NUU A;  3BQL A;  3EAM A;  3JCF A;  4HEA A;  3N2O A;  3TLT A;  4GIW A;  2D9D A;  2XM1 A;  2X0L B;  4ZEY A;  4I50 E;  3WAJ A;  4A5X A;  5F8P A;  2CWY A;  3UUX B;  2KWI B;  5CA0 E;  4JI3 T;  2LSK A;  2A72 A;  2EHO B;  2UXC T;  5HEG A;  4HFD A;  3UU4 A;  5DQW A;  2I6H A;  4O2A E;  3AB3 B;  2LKH A;  1B7T A;  3KV4 A;  3MAC A;  2JRK A;  4QH5 A;  4DV7 T;  2EHO A;  3PTR B;  3Q5X A;  3ESL A;  4OK0 A;  4X20 E;  1MMD A;  5LJN A;  2WDR A;  2E5L T;  4KHZ G;  2VL0 A;  2XSB A;  1BR2 A;  3AAA B;  4TWD A;  4U33 A;  5JRE A;  3OPC A;  3ONX A;  2LJL A;  1X9B A;  4DV2 T;  4JI4 T;  3IA3 A;  1OED B;  3JC6 D;  4IDQ A;  2LOS A;  2NTY A;  2PBI A;  5CJ5 A;  4PJJ A;  5EZY E;  2LKG A;  4JYA T;  2JMK A;  2XUE A;  3K3N A;  4DR3 T;  4COF A;  4ZZC A;  1LVK A;  4HWI B;  4U7Y A;  4KI0 G;  5GON E;  2DWG A;  5L3F B;  4IE5 A;  5BR8 T;  3Q2M A;  1OED A;  3V5U A;  4TUY E;  3PUV F;  4YMV C;  1E1H B;  2HPL A;  4IDP A;  4IDZ A;  2BS2 A;  2E9X B;  2C5J A;  1KK7 A;  2WWU A;  3EDV A;  4EV6 A;  2EHO C;  4LFC T;  3VR8 A;  4X66 T;  2L9Q A;  3CX7 B;  5LMU T;  1YD8 G;  5FXZ A;  3HKB E;  4YFS A;  1W9R A;  4ZI3 D;  4ZI2 C;  2UXD T;  1WFD A;  2WDQ A;  3HR0 A;  4CI1 B;  3SFD A;  2E9X A;  3UFG A;  4JEH B;  1MMA A;  2PTF A;  2IUB A;  2WBL A;  1Z8U A;  2MYS A;  2AXD S;  2XQ3 A;  1Y64 B;  3C4W A;  3ETU A;  2B1E A;  3C4Z A;  5HXS A;  3KFW X;  3C51 A;  3N2K E;  2BZB A;  3J7Y q;  2YK0 A;  3HA4 A;  3FXD B;  3KDS E;  2DWK A;  2UXX B;  1ZEE A;  3CVR A;  2BBJ A;  1OED C;  5DJQ C;  4WBO A;  2R6G G;  2BKP A;  4WW0 A;  5L4H A;  2QGS A;  1E2A A;  4L5G A;  2A2F X;  3LK4 2;  4QKN A;  4HWD A;  3IEE A;  4IGU A;  4N78 D;  3I1A A;  4FI5 A;  4B3T T;  1VCS A;  2X9Y A;  4JI7 T;  2L8K A;  2SPC A;  5HYA A;  2E9X C;  4QXC B;  3ZSS A;  5J2T E;  4DV4 T;  2KT9 A;  4IDN A;  1OWA A;  1IJ6 A;  1T7S A;  4ILU A;  4O8S A;  3VHL A;  3FZL B;  4DV3 T;  1N36 T;  4ZHQ E;  3R6N A;  4HFV A;  2ZLY A;  2WAU A;  2XAJ B;  4EEB A;  2V7L A;  2Y6X A;  1Z0P A;  5AQM B;  3P4R A;  2NW8 A;  3ZKR A;  5C3J A;  2LSI A;  3RC3 A;  1WYB A;  3MA9 A;  1HNW T;  3QC9 A;  5AQU B;  2BG9 B;  4EGW A;  3HL6 A;  3AXJ B;  3CML A;  2N9D A;  4LF4 T;  2WMO A;  2K24 A;  3CKD A;  4IT4 A;  3LSV A;  5CFB A;  1HS7 A;  2VQE T;  2XJ7 A;  4IE0 A;  4YMU C;  2BG9 A;  2NWB A;  5FMN A;  4L9I A;  3AXJ A;  2B76 A;  4JV5 T;  2JPF A;  1BR1 A;  3RIF A;  4DND A;  4U2Z A;  3ZT5 A;  5FXX A;  5KXJ A;  4JBW G;  3P50 A;  1MND A;  2KZ7 B;  3N9M A;  5BMV E;  2W61 A;  2Y48 B;  1VOM A;  2CXL A;  4IE6 A;  4BA9 A;  3C50 A;  3HKC E;  5A1L A;  5LHH B;  1AJ3 A;  2NW9 A;  4GK5 E;  5JDF A;  1XWM A;  1IBK T;  4DID B;  5EK3 A;  3B5M A;  2LOP A;  1IJ5 A;  2LM9 A;  1HNZ T;  1US7 B;  1S94 A;  4UV9 B;  5JDN A;  4YSZ A;  3D0T A;  5FXW A;  5FP3 A;  5AQI B;  2F4V T;  1FJG T;  3I0O A;  3HKD E;  3UU5 A;  4CN4 A;  1EZ3 A;  1HNX T;  3FZK B;  4X65 T;  2XQ6 A;  1R8I A;  1UUR A;  4HTE A;  2M67 A;  2BG9 C;  3L3P A;  4JI1 T;  2EHO D;  2PG8 A;  3H37 A;  2WZI A;  1T98 A;  2K9A A;  2YEV C;  4KHP T;  1KFY A;  4ZI2 D;  4V1A v;  2CPT A;  3PUY F;  2KLQ A;  3SRZ A;  3NZQ A;  3ZJ1 A;  2BVL A;  2BVM A;  4WZX A;  1D0X A;  4AQY T;  1ZKE A;  3AEG A;  3TLU A;  1KNR A;  3UUL A;  3AE8 A;  4H9N C;  2FJE A;  4EYU A;  5EK2 A;  4EED A;  1YXR A;  2KXP B;  4KMC A;  1CHU A;  2YDR A;  3UT5 E;  1OED E;  5LHG B;  4EIW A;  4NIQ A;  2FUP A;  2W0G A;  2H7V C;  3KV5 A;  4DV0 T;  3TUI A;  2YIN A;  4PJM A;  3LJC A;  4JLE A;  3GA8 A;  5LP6 E;  5L47 A;  1HG2 A;  5KDM C;  3AAI A;  3PJA J;  5HXE A;  4PJN A;  4NUV A;  5M4Y A;  3UFE A;  4M1P A;  4HWC A;  3CQX C;  3CQG B;  3NKZ A;  5IHY A;  1LVF A;  1E7P A;  2XAG B;  3OKQ A;  4TQU N;  3PUR A;  2W66 A;  2JIW A;  1XZY A;  3FZF B;  4B3S T;  1S35 A;  3TUJ A;  1UX5 A;  5FVK A;  5LBQ B;  1WR0 A;  2E9X D;  3P4P A;  4HFB A;  4IHJ E;  4Z8X A;  4LFB T;  4MHC A;  4IRE A;  4HFH A;  1W09 A;  3GWH A;  3AVR A;  2PJQ A;  3RLF G;  1MMN A;  2ACX A;  5LMN T;  4DR2 T;  3KIN B;  2ONK C;  2V5D A;  2J62 A;  5DAB A;  5L3E B;  5IYZ E;  3ZC1 A;  3PUV G;  4H9S E;  3AA1 B;  1XMO T;  2QRX A;  4XAX B;  1YKH B;  3BQK A;  2KWH A;  2MAW A;  4E7Z A;  2CHN A;  4HN9 A;  2ODV A;  3RQU A;  3AVS A;  5L3B B;  1X79 A;  5HXC A;  2BS3 A;  2YU1 A;  4TN7 B;  3SFE A;  2PFV A;  5FYM A;  2M6I A;  4JEU B;  1IBM T;  5FKY A;  2WWV A;  2UUC T;  2CBJ A;  2BKN A;  5AQJ B;  3DP7 A;  3EAB A;  1NEN A;  2W00 A;  3PUG A;  4AKI A;  3RIU A;  3IF8 B;  3I0Q A;  3C98 B;  3RH3 A;  4KX6 A;  3RPU A;  4CN1 A;  5LBM A;  3L39 A;  5HWX A;  4X64 T; 
#chains in the Genus database with same CATH homology
 3PUX F;  2R6G G;  4YMV C;  4KHZ F;  3PUV G;  3PUY F;  4XTC M;  4JBW G;  4KHZ G;  3PUX G;  4XIG M;  4YMW C;  3PUY G;  4YMS C;  3TUZ A;  3DHW A;  4KI0 F;  4TQU N;  3TUI A;  4KI0 G;  4YMU C;  4XTC N;  3RLF F;  3PUW F;  4TQU M;  3PV0 F;  3PUZ F;  4XIG N;  3TUJ A;  4YMT B;  3PUW G;  3RLF G;  3PV0 G;  3PUZ G;  3D31 C;  2ONK C;  2R6G F;  4JBW F;  3PUV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...