4JBWF

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
492
Chain Sequence
b'SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
molecule tags Transport protein
source organism Escherichia coli
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
total genus 119
structure length 492
sequence length 492
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4jbwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4jbwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4jbwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4jbwF02
4KHZF 3RLFF 3D31C 4YMVC 4XTCM 4TQUM 4JBWF 3PUWF 3PUWG 4KI0G 4XIGN 4YMSC 3PUXG 3PV0G 4TQUN 3PUXF 3PV0F 3TUIA 3RLFG 3PUYG 4YMTB 2ONKC 3PUYF 4XIGM 3PUZF 4JBWG 3PUVF 2R6GG 3PUZG 3PUVG 2R6GF 4XTCN 4KI0F 3TUJA 4YMUC 3TUZA 4YMWC 3DHWA 4KHZG
chains in the Genus database with same CATH superfamily
3AAAB 3HKDE 3I9WA 4YXDA 5M4YA 1W0BA 1FJGT 2BDEA 2GK9A 3OPCA 4ILUA 4EXTA 4BAYB 2E9XC 3P4WA 4FJOA 4YJ3E 5F3JA 4DUYT 3N5LA 1U4QA 1QUUA 3SFEA 4MALA 1NENA 2IDOB 4GYSA 2HH7A 4O4IE 2MTQA 2PG8A 2W61A 5JQGE 2XM1A 4KX6A 5L3FB 1B7TA 1WLXA 3KBTA 3C50A 2WBLA 4ILAA 5AQNB 2XAQB 3QB5K 1SUMB 2FJAA 1HX1B 5HXRA 4EOZB 2KWIB 4B3TT 3RKGA 3BQKA 4O2AE 2VVNA 2XQ9A 4HE8A 4CN1A 2BG9C 2D0TA 2EHOD 1M7KA 2VURA 1UUSA 5FP3A 3LK2B 4JI5T 3RYIE 5LJMA 3TLSA 3IEEA 4ILBA 1XDOA 5AQSB 4ZHQE 1VRBA 2J4GA 3KVBA 4YMVC 5CGMA 2H89A 2XAJB 4YJ2E 1SE7A 4P0BA 2Y8DA 2LSGA 5HXEA 1VOMA 5AQQB 2DCFA 3N9OA 4QWNB 3I1AA 5L4HA 2JQHA 4ZS3A 5AQIB 3ZKRA 5HYAA 4DV5T 4DV4T 1I94T 4ZI2D 4UF0A 3J9X1 4GYRA 4HN9A 2D5UA 3CKDA 2CMRA 2LE8A 3AE6A 2YN6A 2K24A 2VKDA 3PUGA 4PJNA 1D0XA 4H63H 3OBVE 4AKHA 4CQIA 1WCRA 2XQ7A 3ABVA 3C51A 3ZMZB 1NEKA 3UU6A 2Q9QC 1X79A 2PBIA 1HX8A 2VL0A 3RGLA 3HKEE 3ZT7A 2XUEA 5AQFB 5FYMA 2VASA 3UTKA 2W66A 2UUBT 1MIYA 3L09A 1E7PA 2WDVA 2BG9E 3RKOA 5ETWA 5L4EA 1YQ3A 5AQHB 2W0GA 5FVLA 4EIWA 3MXZA 5FKYA 1N36T 4UR9A 3RYHE 4YMSC 3C4WA 4ZOLE 5F8PA 5IYZE 3T1YT 3P4PA 4NXMT 3AEGA 3UQ7A 5EK2A 2NTXA 4DV0T 4HFCA 5FL1A 4JEUB 4O8SA 3AEBA 4I0UA 1U5PA 4HFBA 2UUAT 3O1IA 4Z90A 4JI7T 4YTMA 1HNWT 2BKPA 5JRCA 3CIRA 3C4XA 2HHHT 1VCTA 3RC8A 4UXNB 3ZYKA 2WDRA 3AXJB 4EAHA 4N78D 3H3MA 3QB5A 3EVYA 4LMKA 2KZ7B 2V7KA 5KDMC 3FB2A 2WU5A 2J1DG 1UCUA 5FY1A 2X66A 1YD8G 2M6IA 2Z6EA 2UXNB 2XAHB 4YTNA 5FY7A 3RI5A 4CZZB 5JDMA 4DR6T 4HWFA 4PAGA 2ACXA 4JI4T 3CVRA 1QSDA 3UUXB 3PUWG 3NRXA 5L3BB 5JR9C 2C0SA 5JDGA 2CWOA 1G73A 1UX4A 2WZIA 3AVSA 2BBHA 2NP9A 2WMNA 3UT5E 4IDQA 3PE0A 5LYJE 3EDUA 2LHRA 3V5UA 2DNXA 1D0ZA 2XAFB 2CEAA 4JUYA 4X1KE 3ZLIA 1KNPA 2XASB 4LF5T 2J47A 2CHNA 3E08A 3UUNA 4JI8T 5J2UE 2X9HA 2NOXA 2LLYA 1M62A 4JBWG 2R6GG 4ADZA 2R6GF 4ZZBA 4CI3B 2LRKA 2CCQA 3GA8A 3OVUA 1US7B 4CXYA 3LFMA 5LMNT 3EAMA 1ZEEA 3KBUA 4JI1T 1NWMX 3ZCIA 1FMVA 1Z0PA 3BQLA 1W9RA 2Q9QB 3EABA 4QH1A 2HPLA 4QH5A 2B1EA 3TLWA 3UUBA 4EEDA 1MNEA 2K3WA 2LOSA 2WS3A 2XZEA 3KINB 2CLYC 1D1AA 2V8SV 2MBGA 4CI1B 4TQUM 3FZHB 4ZI3D 1WFDA 1MMDA 3MJXA 2J62A 2XQ4A 5AQRB 5FY0A 5LB7B 5HXSA 4TZ4C 3ETUA 4QXCB 4A98A 1CHUA 3CX7B 3B57A 3Q5EA 4L5GA 5AQMB 4UVCB 4ZZCA 2DLRA 3NBXX 5HXCA 5LOVE 5JH7E 5JTGA 3AE4A 4K0UA 4EYYR 3RH3A 5L3CB 2MAWA 4HEAA 3JAEA 4UEMA 5FNVE 3NVOA 4BJNA 5HEHA 4AKGA 4LF9T 3LBXA 4LMJA 3SFDA 4AKIA 4HFVA 4XTCN 2OA5A 1HF8A 1NAFA 4PNIA 4WNKA 1IAPA 3AEAA 3B13A 4MFRA 5DJQC 2WU2A 5HCMA 2A72A 4P1NA 3AAIA 5ADXL 4JI0T 2VL8A 4V1Av 5JDNA 2NW8A 3X1DA 2BG9B 2WDQA 4JI3T 3IF8B 5J1GA 4B3ST 5LG4A 1JNRA 1IBMT 4HWIB 4TNVA 2DHRA 4HFIA 2WM9A 3LJCA 3MACA 4AKRB 5L3EB 4OHFA 3RIFA 3VHLA 2G0UA 2IIUA 5HEUA 3ZMSB 1T98A 1XNRT 4OX9T 3KV4A 4QKNA 1J5WA 3P50A 4I43B 3TUIA 4IHJE 2ODVA 2H3RA 1IBKT 3RLFG 2I59A 5LHIB 2XSBA 2XQ5A 3PUYF 2QYWA 1OWAA 2YDSA 2ZLYA 2WB5A 3I9YA 4E7SA 4B6XA 5C2TA 5JDQA 3HKBE 2H7OA 3EI0A 4DBRA 4IE7A 3IA3A 3M3ZB 3JCFA 4KI0F 1O3XA 3QOFA 4UV9B 2KXPB 5FMNA 2IUBA 3RQWA 3TUZA 2DWGA 3ZYMA 3EDVA 1UX5A 4H9SE 4NPPA 4U3CA 2KMFA 1CUNA 4X20E 4A56A 3G06A 3E0ZA 3HKCE 3QUJA 5ABFB 4KHZG 3PU3A 3AAEB 1ZHCA 1YKEB 3AEEA 3MK7C 2JJ9A 4PK5A 2E2AA 3K3OA 2CRBA 4DR5T 4B3RT 1V9DA 3NWIA 4YLHA 5KX5E 2BKOA 2UUCT 1N33T 5FXWA 5LBMA 4UELA 5EK3A 1T8BA 4QXHB 4QX7B 2M67A 2KSRA 4IE4A 5FL0A 3A7MA 2BVLA 2CBJA 1MIVA 2VK9A 1GQEA 2YEVC 4WBOA 4ZI7E 5KMGP 4JEHB 2X9YA 2N2NA 2WMOA 2JMHA 3PTRB 3FBZA 4MBQA 4COFA 4AI6A 4O2BE 2YDRA 3PUVF 2KNDA 4AQFC 4LFCT 3FBLA 2WQYA 3MA9A 5L2LA 3OTOT 4ZEYA 3KV6A 4HKAA 1LVKA 1YQ4A 2UU9T 1UURA 4PFPA 2XQ6A 3HR0A 3K3QC 5LGUB 3TKLB 1QLBA 4AQYT 3F2EA 3FZFB 2EHOB 4GIWA 1SHZC 1JNZA 3BK9A 3LK42 4O4JE 3KFWX 3D31C 1IJ6A 5ABFA 1KF6A 4DIDB 2WZHA 1E1HB 2QVAA 2Y6XA 2XPKA 3KDSE 4EV6A 4DV3T 1N32T 1WR0A 1ZKEA 2JMKA 2XSAA 5LGTB 2CA5A 1N34T 2W00A 5HEJA 3MKDA 2BBJA 4GOUA 4AXPA 5LJNA 5ABHA 3J7Yq 1WR6A 1XZYA 2RA1A 2BVMA 4X1YE 2CBIA 2NW9A 2V5DA 3P8CD 2CXLA 2KINB 3CPZA 4XIGM 1KFYA 3ZT5A 4H9PC 3PUZF 4LF7T 1DU2A 1Y64B 3VKHA 2D0UA 3AE9A 2CHOA 4U7YA 5JDFA 3AXJA 2A9UA 4Z91A 4ZI3C 5LG3A 1L0VA 4HWCA 4IT4A 3GMIA 5AQGB 4P09A 3RYFE 4YMWC 3Q5DA 4U31A 5LXTE 3UU4A 3ONXA 2LSIA 2P9BA 1UGOA 1D0YA 2FJBA 4GKKT 3GN5A 4Z8XA 3QK6A 2ACZA 3WAKA 2ZM6T 5DQWA 4IE0A 4XAXB 4JI2T 3SRZA 3WI3A 1EZ3A 2L3LA 1R8IA 5AQTB 5ABGA 5IWAT 3KVAA 3I0QA 2VKJA 4XIGN 5BR8T 1XDPA 2WWUA 3P4QA 4OK0A 5H6QB 4MLKA 2WY2A 4C90A 5E0OA 5H6RB 2E5VA 4EZ4A 2JIWA 3BQIA 2VQET 3PV0F 1ZOYA 4HWHA 3W15B 2H88A 3FHNA 1W0AA 4O4HE 5IUXA 2E5LT 2YOEA 4AKLA 2D2SA 2K9AA 5L3GB 4LFBT 4KHPT 4H9RC 1OEDE 2ES0A 5JRCB 2K48A 4I50E 5CA1E 4YMUC 3OKQA 3T8OA 1MMNA 5HCJA 3UQ4A 4UV8B 3RYCE 4U2YA 3H3AA 5F5WA 2Q9QA 1Y01A 3PJAA 4HFDA 3P4RA 5C3JA 3N2OA 3C64A 3WAJA 4IDOA 3R84B 4DV1T 4TV9E 2QRXA 3ANWA 4DO0A 4B3MT 2CPTA 4PJJA 1WYCA 4F8HA 4XBFB 2HN2A 3UU5A 3T1HT 2I6HA 2C5JA 4PFOA 3ESLA 3ZYLA 4C91A 5L47A 5HWYA 4G2AA 2X9WA 5FXVA 3RHWA 4NXNT 2LM2A 3AE3A 3SOLA 3JAFA 3ONJA 5EZYE 5AQUB 3OYXA 3TLVA 3PUYG 3CK6A 4IL4A 2BS2A 2SPCA 2ZMAA 2FUPA 5GONE 1MMGA 1BR1A 3TUJA 1BR4A 4JLEA 2DL1A 1YW0A 3CX6B 4HFEA 4YSYA 4DR7T 4J2CA 3O4XE 4LMLA 5HXHA 2VKOA 4X65T 2A2FX 3N9LA 2IMLA 1T72A 3DJBA 3RPUA 5LHHB 4TN7B 3NRYA 2WCAA 2Q9QD 2V5CA 3Q5WA 4Q25A 1YXRA 3EHZA 3LDQB 3ZPOA 4OFZA 4ZXLA 2LEHA 1OEDA 2IC9A 4PK4A 3RQUA 3CMLA 3AE8A 3MZKB 1HFAA 2W62A 3P4SA 2DWKA 3DTOA 3PUQA 2PJQA 4QHOA 5AQOB 1HR0T 2W2UA 1D1BA 2XY8B 3PUSA 4DR1T 3FZMB 4HTEA 5JR9A 2X51A 3V5SA 3RX6A 3HI2A 2LSJA 4DVDA 4EGWA 4DBQA 3AA7B 2IW5B 2MOZA 4KP3C 4HWDA 2E9XB 2N9DA 2YDQA 2D9DA 3F57A 5AQVB 3ZT6A 2BS4A 2XQ3A 1LKXA 4TV8E 3PUVG 3TLUA 5LNKA 2CLYB 4ILCA 4OYKA 5CJ5A 1H7CA 4A97A 4GK5E 2LT3A 4YHJA 2JRKA 2F4VT 4X1IE 4EB6E 3K1SA 3UFGA 3UUMA 4X62T 1KNZA 5JDLA 2BZBA 2X68A 3L8RA 2H7VC 3R6NA 3RLFF 2CXFA 2JQ9A 2QGSA 3O1HA 3Q9DA 4L0RA 3RIUA 4H9OC 4IE5A 1J1JA 1HCIA 3FZLB 4U74A 2NTYA 3C98B 3NZPA 4M1PA 4PJLA 1LVFA 3EUHA 3VR8A 4CN4A 1D1CA 4H9NC 4F6RC 4LFAT 3F31A 2CXDA 2LOPA 4X5TA 3S4UA 5FXXA 1OEDB 2NR4A 3ZSTA 4QXBB 1HG5A 2V6YB 4LF8T 3ZMTB 2XJ7A 3AECA 3CQCB 4UF0B 4YTPA 5AQJB 3ZMVB 2ZM8A 2NWBA 3AE1A 3KV9A 3GWHA 3PDYA 1SA0E 3ZC1A 4IE6A 5LP6E 3ZN0B 2PFVA 2Y48B 5JR9B 2JQKA 4JYAT 4NUUA 4YFSA 2CM0A 3SS1A 4YT0A 5JREA 1HNXT 3RC3A 3PU8A 1IJ5A 2FJDA 3M65A 4I4TE 1KEYA 4QH4A 3QNUA 2VB6A 3A5XA 3C4ZA 3DP7A 2V26A 3GN5B 4A5XA 2XQAA 5LHGB 2KWHA 2MPKA 4LF4T 3AEFA 3ZJ2A 4YY3T 5BMVE 3IBPA 3K3NA 1HTJF 4H63V 2LJLA 3DHWA 5LA6E 3RIAA 1WRDA 2W63A 2ODUA 4ZI2C 4CXXA 3H37A 4GKJT 4I55E 2X67A 1IBLT 3PURA 4IIJE 3NKZA 5HEOA 1ZP0A 3PJAJ 2X0YA 5LBQB 4DR3T 4TWFA 5C8YE 5HWXA 5J2TE 2B76A 2V7LA 2ZM2A 2V1DB 3VRBA 5TAOA 1S94A 1XWMA 2HN1A 3FZKB 3O1JA 3ZCJA 1J5ET 3PV0G 3HA4A 5DABA 4ZS2A 4BJMA 3IHRA 2KT9A 4CI2B 5KXJA 2UXDT 1W09A 2XAGB 2V6YA 1WYBA 3VKGA 2AE9A 3KV5A 2EHOC 4OYJA 1E2AA 3LSVA 2YK0A 4WZXA 3P7IA 3CQGB 4DNDA 1I6ZA 4CN6A 5FXZA 1XNQT 2I0MA 4NUVA 2E8IA 3TLTA 2XQYA 2X0LB 3AEDA 3ANWB 2JQQA 3N9MA 4ISTA 1Z8UA 3B5MA 4DMVA 1G8XA 4O4LE 4U33A 5LCYA 4DMWA 4KUMB 2NW7A 4DUZT 3JC6C 1MMAA 3Q5XA 2EHOA 2K5BB 4XZCA 2XTLA 3A8YC 4LF6T 2RP4A 2V7MA 4GK0E 4AQFA 4UIGA 1T7SA 2C5IT 2E9XD 2WSSV 5AQKB 1KNRA 4IDNA 4DV6T 2DI4A 2VKHA 1FEWA 4UVAB 1X9BA 2LSKA 3ZMUB 3N2KE 2AXDS 3RRCA 4BA9A 4TQUN 1LRZA 5LGNB 2WWVA 2XHEB 3UULA 2VVSA 2RPAA 3AA0B 4IL9A 4KBMB 3RF1A 3PUAA 3LG7A 1ZV4X 2PTFA 2V7JA 1HG2A 3AE2A 4TUYE 4IDZA 3ZJ1A 4TNWA 4MHCA 2YU1A 2HPJA 2YU2A 3VRAA 4AIUA 4ERRA 3ZEFB 2LHNA 1BR0A 2WAUA 4HFHA 4X64T 2N1GA 3ZN1B 3HL6A 4YHHT 2LRLA 2IHR1 3E22E 3U78A 1XMQT 1HS7A 1VCSA 1AJ3A 4DV2T 4DR2T 1IZNB 2IC6A 4FI5A 3SWHA 4KHZF 3UU8A 4EYUA 5EK4A 3UFEA 4JV5T 4DV7T 4DR4T 2IAKA 2LKGA 4JBWF 2YKSA 3K8PC 4P0AA 3I0OA 3O9XA 1MIWA 3CQXC 4QX8B 1YKHB 1S35A 2E9XA 4EZHA 4IREA 5AFUL 2ZM0A 3ONLC 1XMOT 4K0KT 4WBNE 4WW0A 4X66T 3N9NA 5A1LA 2W67A 4JI6T 1OEDC 2QA7A 3AVRA 2JPFA 3D0TA 5CFBA 1KK7A 2KLQA 4U72A 4E7ZA 3OJAA 3AA6B 2CWYA 1UK5A 3Q2MA 4TWHA 5DQVA 3QC9A 5CA0E 2V6XA 5AQPB 4PJMA 4KMCA 2M6BA 5JVDE 3VU7H 3ZC0A 5CB4E 2FBWA 2LM9A 2FJEA 2UXXB 2OV9A 2BG9A 2LSYA 2OLTA 2X9XA 3JC6D 4AISA 4YSZA 3JADA 3LK3B 3NZQA 2VWAA 4NIQA 4PK6A 5J0ZA 4U7IA 4ISSA 5JDHA 4XTCM 2VQFT 4HGAA 3OYZA 2XM2A 2C5KT 3N9QA 2X0HA 3PUWF 1FIOA 3ETVA 4ASKA 4KI0G 3FXDB 1HNZT 4L9IA 3N2GE 3VR9A 3PUXG 3RRWA 3PUXF 4IGUA 2CE7A 1FMWA 3U3IA 4ANJA 3L3PA 3RIUC 2V7IA 4YMTB 3FXEB 4PW8A 2ONKC 1OXZA 3UU3A 5IHYA 5ABEA 4G63A 2LKHA 4H9QC 4U2ZA 5FVKA 2MYSA 2W4XA 4CXWA 3CWZB 4YSXA 2A3DA 2L9QA 3LBXB 3PUZG 4TWDA 1BR2A 3N9PA 4TX5A 3AB3B 2L8KA 3ZSSA 1MNDA 2UXCT 5AQLB 5LMUT 2UXBT 4AQGA 3AA1B 2YINA 4UVBB 4EEBA 4IDPA 2BKNA 2BS3A 4WYVA 5HEGA 3L39A 3AE7A 5HAXA 2WP9A 5L3DB 2XQ8A 3CX8B 3AE5A
chains in the Genus database with same CATH topology
4KHZF 3RLFF 3D31C 4YMVC 4XTCM 4TQUM 4JBWF 3PUWF 3PUWG 4KI0G 4XIGN 4YMSC 3PUXG 3PV0G 4TQUN 3PUXF 3PV0F 3TUIA 3RLFG 3PUYG 4YMTB 2ONKC 3PUYF 4XIGM 3PUZF 4JBWG 3PUVF 2R6GG 3PUZG 3PUVG 2R6GF 4XTCN 4KI0F 3TUJA 4YMUC 3TUZA 4YMWC 3DHWA 4KHZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ F;  3RLF F;  3D31 C;  4YMV C;  4XTC M;  4TQU M;  4JBW F;  3PUW F;  3PUW G;  4KI0 G;  4XIG N;  4YMS C;  3PUX G;  3PV0 G;  4TQU N;  3PUX F;  3PV0 F;  3TUI A;  3RLF G;  3PUY G;  4YMT B;  2ONK C;  3PUY F;  4XIG M;  3PUZ F;  4JBW G;  3PUV F;  2R6G G;  3PUZ G;  3PUV G;  2R6G F;  4XTC N;  4KI0 F;  3TUJ A;  4YMU C;  3TUZ A;  4YMW C;  3DHW A;  4KHZ G; 
#chains in the Genus database with same CATH topology
 3AAA B;  3HKD E;  3I9W A;  4YXD A;  5M4Y A;  1W0B A;  1FJG T;  2BDE A;  2GK9 A;  3OPC A;  4ILU A;  4EXT A;  4BAY B;  2E9X C;  3P4W A;  4FJO A;  4YJ3 E;  5F3J A;  4DUY T;  3N5L A;  1U4Q A;  1QUU A;  3SFE A;  4MAL A;  1NEN A;  2IDO B;  4GYS A;  2HH7 A;  4O4I E;  2MTQ A;  2PG8 A;  2W61 A;  5JQG E;  2XM1 A;  4KX6 A;  5L3F B;  1B7T A;  1WLX A;  3KBT A;  3C50 A;  2WBL A;  4ILA A;  5AQN B;  2XAQ B;  3QB5 K;  1SUM B;  2FJA A;  1HX1 B;  5HXR A;  4EOZ B;  2KWI B;  4B3T T;  3RKG A;  3BQK A;  4O2A E;  2VVN A;  2XQ9 A;  4HE8 A;  4CN1 A;  2BG9 C;  2D0T A;  2EHO D;  1M7K A;  2VUR A;  1UUS A;  5FP3 A;  3LK2 B;  4JI5 T;  3RYI E;  5LJM A;  3TLS A;  3IEE A;  4ILB A;  1XDO A;  5AQS B;  4ZHQ E;  1VRB A;  2J4G A;  3KVB A;  4YMV C;  5CGM A;  2H89 A;  2XAJ B;  4YJ2 E;  1SE7 A;  4P0B A;  2Y8D A;  2LSG A;  5HXE A;  1VOM A;  5AQQ B;  2DCF A;  3N9O A;  4QWN B;  3I1A A;  5L4H A;  2JQH A;  4ZS3 A;  5AQI B;  3ZKR A;  5HYA A;  4DV5 T;  4DV4 T;  1I94 T;  4ZI2 D;  4UF0 A;  3J9X 1;  4GYR A;  4HN9 A;  2D5U A;  3CKD A;  2CMR A;  2LE8 A;  3AE6 A;  2YN6 A;  2K24 A;  2VKD A;  3PUG A;  4PJN A;  1D0X A;  4H63 H;  3OBV E;  4AKH A;  4CQI A;  1WCR A;  2XQ7 A;  3ABV A;  3C51 A;  3ZMZ B;  1NEK A;  3UU6 A;  2Q9Q C;  1X79 A;  2PBI A;  1HX8 A;  2VL0 A;  3RGL A;  3HKE E;  3ZT7 A;  2XUE A;  5AQF B;  5FYM A;  2VAS A;  3UTK A;  2W66 A;  2UUB T;  1MIY A;  3L09 A;  1E7P A;  2WDV A;  2BG9 E;  3RKO A;  5ETW A;  5L4E A;  1YQ3 A;  5AQH B;  2W0G A;  5FVL A;  4EIW A;  3MXZ A;  5FKY A;  1N36 T;  4UR9 A;  3RYH E;  4YMS C;  3C4W A;  4ZOL E;  5F8P A;  5IYZ E;  3T1Y T;  3P4P A;  4NXM T;  3AEG A;  3UQ7 A;  5EK2 A;  2NTX A;  4DV0 T;  4HFC A;  5FL1 A;  4JEU B;  4O8S A;  3AEB A;  4I0U A;  1U5P A;  4HFB A;  2UUA T;  3O1I A;  4Z90 A;  4JI7 T;  4YTM A;  1HNW T;  2BKP A;  5JRC A;  3CIR A;  3C4X A;  2HHH T;  1VCT A;  3RC8 A;  4UXN B;  3ZYK A;  2WDR A;  3AXJ B;  4EAH A;  4N78 D;  3H3M A;  3QB5 A;  3EVY A;  4LMK A;  2KZ7 B;  2V7K A;  5KDM C;  3FB2 A;  2WU5 A;  2J1D G;  1UCU A;  5FY1 A;  2X66 A;  1YD8 G;  2M6I A;  2Z6E A;  2UXN B;  2XAH B;  4YTN A;  5FY7 A;  3RI5 A;  4CZZ B;  5JDM A;  4DR6 T;  4HWF A;  4PAG A;  2ACX A;  4JI4 T;  3CVR A;  1QSD A;  3UUX B;  3PUW G;  3NRX A;  5L3B B;  5JR9 C;  2C0S A;  5JDG A;  2CWO A;  1G73 A;  1UX4 A;  2WZI A;  3AVS A;  2BBH A;  2NP9 A;  2WMN A;  3UT5 E;  4IDQ A;  3PE0 A;  5LYJ E;  3EDU A;  2LHR A;  3V5U A;  2DNX A;  1D0Z A;  2XAF B;  2CEA A;  4JUY A;  4X1K E;  3ZLI A;  1KNP A;  2XAS B;  4LF5 T;  2J47 A;  2CHN A;  3E08 A;  3UUN A;  4JI8 T;  5J2U E;  2X9H A;  2NOX A;  2LLY A;  1M62 A;  4JBW G;  2R6G G;  4ADZ A;  2R6G F;  4ZZB A;  4CI3 B;  2LRK A;  2CCQ A;  3GA8 A;  3OVU A;  1US7 B;  4CXY A;  3LFM A;  5LMN T;  3EAM A;  1ZEE A;  3KBU A;  4JI1 T;  1NWM X;  3ZCI A;  1FMV A;  1Z0P A;  3BQL A;  1W9R A;  2Q9Q B;  3EAB A;  4QH1 A;  2HPL A;  4QH5 A;  2B1E A;  3TLW A;  3UUB A;  4EED A;  1MNE A;  2K3W A;  2LOS A;  2WS3 A;  2XZE A;  3KIN B;  2CLY C;  1D1A A;  2V8S V;  2MBG A;  4CI1 B;  4TQU M;  3FZH B;  4ZI3 D;  1WFD A;  1MMD A;  3MJX A;  2J62 A;  2XQ4 A;  5AQR B;  5FY0 A;  5LB7 B;  5HXS A;  4TZ4 C;  3ETU A;  4QXC B;  4A98 A;  1CHU A;  3CX7 B;  3B57 A;  3Q5E A;  4L5G A;  5AQM B;  4UVC B;  4ZZC A;  2DLR A;  3NBX X;  5HXC A;  5LOV E;  5JH7 E;  5JTG A;  3AE4 A;  4K0U A;  4EYY R;  3RH3 A;  5L3C B;  2MAW A;  4HEA A;  3JAE A;  4UEM A;  5FNV E;  3NVO A;  4BJN A;  5HEH A;  4AKG A;  4LF9 T;  3LBX A;  4LMJ A;  3SFD A;  4AKI A;  4HFV A;  4XTC N;  2OA5 A;  1HF8 A;  1NAF A;  4PNI A;  4WNK A;  1IAP A;  3AEA A;  3B13 A;  4MFR A;  5DJQ C;  2WU2 A;  5HCM A;  2A72 A;  4P1N A;  3AAI A;  5ADX L;  4JI0 T;  2VL8 A;  4V1A v;  5JDN A;  2NW8 A;  3X1D A;  2BG9 B;  2WDQ A;  4JI3 T;  3IF8 B;  5J1G A;  4B3S T;  5LG4 A;  1JNR A;  1IBM T;  4HWI B;  4TNV A;  2DHR A;  4HFI A;  2WM9 A;  3LJC A;  3MAC A;  4AKR B;  5L3E B;  4OHF A;  3RIF A;  3VHL A;  2G0U A;  2IIU A;  5HEU A;  3ZMS B;  1T98 A;  1XNR T;  4OX9 T;  3KV4 A;  4QKN A;  1J5W A;  3P50 A;  4I43 B;  3TUI A;  4IHJ E;  2ODV A;  2H3R A;  1IBK T;  3RLF G;  2I59 A;  5LHI B;  2XSB A;  2XQ5 A;  3PUY F;  2QYW A;  1OWA A;  2YDS A;  2ZLY A;  2WB5 A;  3I9Y A;  4E7S A;  4B6X A;  5C2T A;  5JDQ A;  3HKB E;  2H7O A;  3EI0 A;  4DBR A;  4IE7 A;  3IA3 A;  3M3Z B;  3JCF A;  4KI0 F;  1O3X A;  3QOF A;  4UV9 B;  2KXP B;  5FMN A;  2IUB A;  3RQW A;  3TUZ A;  2DWG A;  3ZYM A;  3EDV A;  1UX5 A;  4H9S E;  4NPP A;  4U3C A;  2KMF A;  1CUN A;  4X20 E;  4A56 A;  3G06 A;  3E0Z A;  3HKC E;  3QUJ A;  5ABF B;  4KHZ G;  3PU3 A;  3AAE B;  1ZHC A;  1YKE B;  3AEE A;  3MK7 C;  2JJ9 A;  4PK5 A;  2E2A A;  3K3O A;  2CRB A;  4DR5 T;  4B3R T;  1V9D A;  3NWI A;  4YLH A;  5KX5 E;  2BKO A;  2UUC T;  1N33 T;  5FXW A;  5LBM A;  4UEL A;  5EK3 A;  1T8B A;  4QXH B;  4QX7 B;  2M67 A;  2KSR A;  4IE4 A;  5FL0 A;  3A7M A;  2BVL A;  2CBJ A;  1MIV A;  2VK9 A;  1GQE A;  2YEV C;  4WBO A;  4ZI7 E;  5KMG P;  4JEH B;  2X9Y A;  2N2N A;  2WMO A;  2JMH A;  3PTR B;  3FBZ A;  4MBQ A;  4COF A;  4AI6 A;  4O2B E;  2YDR A;  3PUV F;  2KND A;  4AQF C;  4LFC T;  3FBL A;  2WQY A;  3MA9 A;  5L2L A;  3OTO T;  4ZEY A;  3KV6 A;  4HKA A;  1LVK A;  1YQ4 A;  2UU9 T;  1UUR A;  4PFP A;  2XQ6 A;  3HR0 A;  3K3Q C;  5LGU B;  3TKL B;  1QLB A;  4AQY T;  3F2E A;  3FZF B;  2EHO B;  4GIW A;  1SHZ C;  1JNZ A;  3BK9 A;  3LK4 2;  4O4J E;  3KFW X;  3D31 C;  1IJ6 A;  5ABF A;  1KF6 A;  4DID B;  2WZH A;  1E1H B;  2QVA A;  2Y6X A;  2XPK A;  3KDS E;  4EV6 A;  4DV3 T;  1N32 T;  1WR0 A;  1ZKE A;  2JMK A;  2XSA A;  5LGT B;  2CA5 A;  1N34 T;  2W00 A;  5HEJ A;  3MKD A;  2BBJ A;  4GOU A;  4AXP A;  5LJN A;  5ABH A;  3J7Y q;  1WR6 A;  1XZY A;  2RA1 A;  2BVM A;  4X1Y E;  2CBI A;  2NW9 A;  2V5D A;  3P8C D;  2CXL A;  2KIN B;  3CPZ A;  4XIG M;  1KFY A;  3ZT5 A;  4H9P C;  3PUZ F;  4LF7 T;  1DU2 A;  1Y64 B;  3VKH A;  2D0U A;  3AE9 A;  2CHO A;  4U7Y A;  5JDF A;  3AXJ A;  2A9U A;  4Z91 A;  4ZI3 C;  5LG3 A;  1L0V A;  4HWC A;  4IT4 A;  3GMI A;  5AQG B;  4P09 A;  3RYF E;  4YMW C;  3Q5D A;  4U31 A;  5LXT E;  3UU4 A;  3ONX A;  2LSI A;  2P9B A;  1UGO A;  1D0Y A;  2FJB A;  4GKK T;  3GN5 A;  4Z8X A;  3QK6 A;  2ACZ A;  3WAK A;  2ZM6 T;  5DQW A;  4IE0 A;  4XAX B;  4JI2 T;  3SRZ A;  3WI3 A;  1EZ3 A;  2L3L A;  1R8I A;  5AQT B;  5ABG A;  5IWA T;  3KVA A;  3I0Q A;  2VKJ A;  4XIG N;  5BR8 T;  1XDP A;  2WWU A;  3P4Q A;  4OK0 A;  5H6Q B;  4MLK A;  2WY2 A;  4C90 A;  5E0O A;  5H6R B;  2E5V A;  4EZ4 A;  2JIW A;  3BQI A;  2VQE T;  3PV0 F;  1ZOY A;  4HWH A;  3W15 B;  2H88 A;  3FHN A;  1W0A A;  4O4H E;  5IUX A;  2E5L T;  2YOE A;  4AKL A;  2D2S A;  2K9A A;  5L3G B;  4LFB T;  4KHP T;  4H9R C;  1OED E;  2ES0 A;  5JRC B;  2K48 A;  4I50 E;  5CA1 E;  4YMU C;  3OKQ A;  3T8O A;  1MMN A;  5HCJ A;  3UQ4 A;  4UV8 B;  3RYC E;  4U2Y A;  3H3A A;  5F5W A;  2Q9Q A;  1Y01 A;  3PJA A;  4HFD A;  3P4R A;  5C3J A;  3N2O A;  3C64 A;  3WAJ A;  4IDO A;  3R84 B;  4DV1 T;  4TV9 E;  2QRX A;  3ANW A;  4DO0 A;  4B3M T;  2CPT A;  4PJJ A;  1WYC A;  4F8H A;  4XBF B;  2HN2 A;  3UU5 A;  3T1H T;  2I6H A;  2C5J A;  4PFO A;  3ESL A;  3ZYL A;  4C91 A;  5L47 A;  5HWY A;  4G2A A;  2X9W A;  5FXV A;  3RHW A;  4NXN T;  2LM2 A;  3AE3 A;  3SOL A;  3JAF A;  3ONJ A;  5EZY E;  5AQU B;  3OYX A;  3TLV A;  3PUY G;  3CK6 A;  4IL4 A;  2BS2 A;  2SPC A;  2ZMA A;  2FUP A;  5GON E;  1MMG A;  1BR1 A;  3TUJ A;  1BR4 A;  4JLE A;  2DL1 A;  1YW0 A;  3CX6 B;  4HFE A;  4YSY A;  4DR7 T;  4J2C A;  3O4X E;  4LML A;  5HXH A;  2VKO A;  4X65 T;  2A2F X;  3N9L A;  2IML A;  1T72 A;  3DJB A;  3RPU A;  5LHH B;  4TN7 B;  3NRY A;  2WCA A;  2Q9Q D;  2V5C A;  3Q5W A;  4Q25 A;  1YXR A;  3EHZ A;  3LDQ B;  3ZPO A;  4OFZ A;  4ZXL A;  2LEH A;  1OED A;  2IC9 A;  4PK4 A;  3RQU A;  3CML A;  3AE8 A;  3MZK B;  1HFA A;  2W62 A;  3P4S A;  2DWK A;  3DTO A;  3PUQ A;  2PJQ A;  4QHO A;  5AQO B;  1HR0 T;  2W2U A;  1D1B A;  2XY8 B;  3PUS A;  4DR1 T;  3FZM B;  4HTE A;  5JR9 A;  2X51 A;  3V5S A;  3RX6 A;  3HI2 A;  2LSJ A;  4DVD A;  4EGW A;  4DBQ A;  3AA7 B;  2IW5 B;  2MOZ A;  4KP3 C;  4HWD A;  2E9X B;  2N9D A;  2YDQ A;  2D9D A;  3F57 A;  5AQV B;  3ZT6 A;  2BS4 A;  2XQ3 A;  1LKX A;  4TV8 E;  3PUV G;  3TLU A;  5LNK A;  2CLY B;  4ILC A;  4OYK A;  5CJ5 A;  1H7C A;  4A97 A;  4GK5 E;  2LT3 A;  4YHJ A;  2JRK A;  2F4V T;  4X1I E;  4EB6 E;  3K1S A;  3UFG A;  3UUM A;  4X62 T;  1KNZ A;  5JDL A;  2BZB A;  2X68 A;  3L8R A;  2H7V C;  3R6N A;  3RLF F;  2CXF A;  2JQ9 A;  2QGS A;  3O1H A;  3Q9D A;  4L0R A;  3RIU A;  4H9O C;  4IE5 A;  1J1J A;  1HCI A;  3FZL B;  4U74 A;  2NTY A;  3C98 B;  3NZP A;  4M1P A;  4PJL A;  1LVF A;  3EUH A;  3VR8 A;  4CN4 A;  1D1C A;  4H9N C;  4F6R C;  4LFA T;  3F31 A;  2CXD A;  2LOP A;  4X5T A;  3S4U A;  5FXX A;  1OED B;  2NR4 A;  3ZST A;  4QXB B;  1HG5 A;  2V6Y B;  4LF8 T;  3ZMT B;  2XJ7 A;  3AEC A;  3CQC B;  4UF0 B;  4YTP A;  5AQJ B;  3ZMV B;  2ZM8 A;  2NWB A;  3AE1 A;  3KV9 A;  3GWH A;  3PDY A;  1SA0 E;  3ZC1 A;  4IE6 A;  5LP6 E;  3ZN0 B;  2PFV A;  2Y48 B;  5JR9 B;  2JQK A;  4JYA T;  4NUU A;  4YFS A;  2CM0 A;  3SS1 A;  4YT0 A;  5JRE A;  1HNX T;  3RC3 A;  3PU8 A;  1IJ5 A;  2FJD A;  3M65 A;  4I4T E;  1KEY A;  4QH4 A;  3QNU A;  2VB6 A;  3A5X A;  3C4Z A;  3DP7 A;  2V26 A;  3GN5 B;  4A5X A;  2XQA A;  5LHG B;  2KWH A;  2MPK A;  4LF4 T;  3AEF A;  3ZJ2 A;  4YY3 T;  5BMV E;  3IBP A;  3K3N A;  1HTJ F;  4H63 V;  2LJL A;  3DHW A;  5LA6 E;  3RIA A;  1WRD A;  2W63 A;  2ODU A;  4ZI2 C;  4CXX A;  3H37 A;  4GKJ T;  4I55 E;  2X67 A;  1IBL T;  3PUR A;  4IIJ E;  3NKZ A;  5HEO A;  1ZP0 A;  3PJA J;  2X0Y A;  5LBQ B;  4DR3 T;  4TWF A;  5C8Y E;  5HWX A;  5J2T E;  2B76 A;  2V7L A;  2ZM2 A;  2V1D B;  3VRB A;  5TAO A;  1S94 A;  1XWM A;  2HN1 A;  3FZK B;  3O1J A;  3ZCJ A;  1J5E T;  3PV0 G;  3HA4 A;  5DAB A;  4ZS2 A;  4BJM A;  3IHR A;  2KT9 A;  4CI2 B;  5KXJ A;  2UXD T;  1W09 A;  2XAG B;  2V6Y A;  1WYB A;  3VKG A;  2AE9 A;  3KV5 A;  2EHO C;  4OYJ A;  1E2A A;  3LSV A;  2YK0 A;  4WZX A;  3P7I A;  3CQG B;  4DND A;  1I6Z A;  4CN6 A;  5FXZ A;  1XNQ T;  2I0M A;  4NUV A;  2E8I A;  3TLT A;  2XQY A;  2X0L B;  3AED A;  3ANW B;  2JQQ A;  3N9M A;  4IST A;  1Z8U A;  3B5M A;  4DMV A;  1G8X A;  4O4L E;  4U33 A;  5LCY A;  4DMW A;  4KUM B;  2NW7 A;  4DUZ T;  3JC6 C;  1MMA A;  3Q5X A;  2EHO A;  2K5B B;  4XZC A;  2XTL A;  3A8Y C;  4LF6 T;  2RP4 A;  2V7M A;  4GK0 E;  4AQF A;  4UIG A;  1T7S A;  2C5I T;  2E9X D;  2WSS V;  5AQK B;  1KNR A;  4IDN A;  4DV6 T;  2DI4 A;  2VKH A;  1FEW A;  4UVA B;  1X9B A;  2LSK A;  3ZMU B;  3N2K E;  2AXD S;  3RRC A;  4BA9 A;  4TQU N;  1LRZ A;  5LGN B;  2WWV A;  2XHE B;  3UUL A;  2VVS A;  2RPA A;  3AA0 B;  4IL9 A;  4KBM B;  3RF1 A;  3PUA A;  3LG7 A;  1ZV4 X;  2PTF A;  2V7J A;  1HG2 A;  3AE2 A;  4TUY E;  4IDZ A;  3ZJ1 A;  4TNW A;  4MHC A;  2YU1 A;  2HPJ A;  2YU2 A;  3VRA A;  4AIU A;  4ERR A;  3ZEF B;  2LHN A;  1BR0 A;  2WAU A;  4HFH A;  4X64 T;  2N1G A;  3ZN1 B;  3HL6 A;  4YHH T;  2LRL A;  2IHR 1;  3E22 E;  3U78 A;  1XMQ T;  1HS7 A;  1VCS A;  1AJ3 A;  4DV2 T;  4DR2 T;  1IZN B;  2IC6 A;  4FI5 A;  3SWH A;  4KHZ F;  3UU8 A;  4EYU A;  5EK4 A;  3UFE A;  4JV5 T;  4DV7 T;  4DR4 T;  2IAK A;  2LKG A;  4JBW F;  2YKS A;  3K8P C;  4P0A A;  3I0O A;  3O9X A;  1MIW A;  3CQX C;  4QX8 B;  1YKH B;  1S35 A;  2E9X A;  4EZH A;  4IRE A;  5AFU L;  2ZM0 A;  3ONL C;  1XMO T;  4K0K T;  4WBN E;  4WW0 A;  4X66 T;  3N9N A;  5A1L A;  2W67 A;  4JI6 T;  1OED C;  2QA7 A;  3AVR A;  2JPF A;  3D0T A;  5CFB A;  1KK7 A;  2KLQ A;  4U72 A;  4E7Z A;  3OJA A;  3AA6 B;  2CWY A;  1UK5 A;  3Q2M A;  4TWH A;  5DQV A;  3QC9 A;  5CA0 E;  2V6X A;  5AQP B;  4PJM A;  4KMC A;  2M6B A;  5JVD E;  3VU7 H;  3ZC0 A;  5CB4 E;  2FBW A;  2LM9 A;  2FJE A;  2UXX B;  2OV9 A;  2BG9 A;  2LSY A;  2OLT A;  2X9X A;  3JC6 D;  4AIS A;  4YSZ A;  3JAD A;  3LK3 B;  3NZQ A;  2VWA A;  4NIQ A;  4PK6 A;  5J0Z A;  4U7I A;  4ISS A;  5JDH A;  4XTC M;  2VQF T;  4HGA A;  3OYZ A;  2XM2 A;  2C5K T;  3N9Q A;  2X0H A;  3PUW F;  1FIO A;  3ETV A;  4ASK A;  4KI0 G;  3FXD B;  1HNZ T;  4L9I A;  3N2G E;  3VR9 A;  3PUX G;  3RRW A;  3PUX F;  4IGU A;  2CE7 A;  1FMW A;  3U3I A;  4ANJ A;  3L3P A;  3RIU C;  2V7I A;  4YMT B;  3FXE B;  4PW8 A;  2ONK C;  1OXZ A;  3UU3 A;  5IHY A;  5ABE A;  4G63 A;  2LKH A;  4H9Q C;  4U2Z A;  5FVK A;  2MYS A;  2W4X A;  4CXW A;  3CWZ B;  4YSX A;  2A3D A;  2L9Q A;  3LBX B;  3PUZ G;  4TWD A;  1BR2 A;  3N9P A;  4TX5 A;  3AB3 B;  2L8K A;  3ZSS A;  1MND A;  2UXC T;  5AQL B;  5LMU T;  2UXB T;  4AQG A;  3AA1 B;  2YIN A;  4UVB B;  4EEB A;  4IDP A;  2BKN A;  2BS3 A;  4WYV A;  5HEG A;  3L39 A;  3AE7 A;  5HAX A;  2WP9 A;  5L3D B;  2XQ8 A;  3CX8 B;  3AE5 A; 
#chains in the Genus database with same CATH homology
 4KHZ F;  3RLF F;  3D31 C;  4YMV C;  4XTC M;  4TQU M;  4JBW F;  3PUW F;  3PUW G;  4KI0 G;  4XIG N;  4YMS C;  3PUX G;  3PV0 G;  4TQU N;  3PUX F;  3PV0 F;  3TUI A;  3RLF G;  3PUY G;  4YMT B;  2ONK C;  3PUY F;  4XIG M;  3PUZ F;  4JBW G;  3PUV F;  2R6G G;  3PUZ G;  3PUV G;  2R6G F;  4XTC N;  4KI0 F;  3TUJ A;  4YMU C;  3TUZ A;  4YMW C;  3DHW A;  4KHZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...