4JBWF

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
492
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 119
structure length 492
sequence length 492
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4jbwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4jbwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4jbwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4jbwF02
3PV0G 4YMTB 3PUXF 3TUIA 3PUVF 3RLFG 4KHZF 4KI0F 3DHWA 2R6GF 4TQUM 4JBWF 4XIGN 3D31C 4XTCN 4YMWC 3TUZA 3PUWG 2ONKC 3PUYF 3PV0F 3PUZF 3PUXG 3PUVG 3RLFF 3TUJA 4YMUC 4KHZG 4YMVC 4XIGM 4KI0G 4XTCM 4JBWG 2R6GG 3PUWF 4YMSC 4TQUN 3PUYG 3PUZG
chains in the Genus database with same CATH superfamily
5AQOB 2CWYA 4ZI7E 3NWIA 4EEBA 5AQNB 5JDHA 3ANWA 3PJAJ 4ANJA 5C2TA 4U2YA 2W61A 3UULA 4IE5A 5F3JA 2LM2A 4YHHT 2CEAA 2LSGA 3HR0A 3AEEA 2ZM8A 4ILUA 3ZJ2A 3L8RA 4LMJA 3HKCE 2WBLA 5AQVB 5JH7E 3AAIA 2WQYA 3RGLA 5HEGA 3EABA 2V7JA 2VWAA 5LB7B 1QUUA 5IHYA 4CN6A 4DNDA 4HFDA 1Z0PA 3G06A 3H3MA 3E08A 2ODVA 4WYVA 3DTOA 2M67A 3WAJA 4H9OC 4QXBB 2FBWA 2BVMA 2NOXA 3LJCA 3ZEFB 4ZEYA 1FMWA 4QX7B 3UUNA 4H9NC 4L0RA 1B7TA 2DWGA 2XY8B 4JEUB 1FJGT 4WW0A 4EB6E 1KNPA 2H89A 4JI8T 5KDMC 2RA1A 3ABVA 4KUMB 3QK6A 4IE7A 4PW8A 3UU3A 2J62A 3JC6D 4JYAT 5FL0A 2LLYA 3CVRA 5LHHB 3RYIE 3AE5A 4TQUM 5AQTB 2WM9A 2BKPA 3ONLC 4H9QC 1E7PA 2V7LA 3QB5K 4XTCM 3EDVA 2XSAA 3VKHA 3EHZA 3N9OA 3N9MA 2H7OA 2JPFA 5JRCA 4WBNE 3ONJA 2WDRA 5HXEA 3SWHA 4U74A 4I50E 2CE7A 1CHUA 3JADA 3LBXB 4DR6T 1VCSA 4YLHA 3BQIA 3LDQB 2XQAA 2XQ9A 3AE3A 3ZMSB 2HPJA 2NP9A 3AXJB 4KHPT 4HFCA 5AFUL 3BQLA 1W0BA 4UEMA 3PURA 5L3GB 4DV5T 3FBLA 2ZM0A 2CXFA 1EZ3A 1MMAA 3PUWG 2LSIA 5DQVA 3WI3A 5JTGA 2W00A 2KNDA 3EAMA 3EI0A 4EEDA 1IJ5A 4NUUA 3V5SA 3AAEB 3IF8B 5EK2A 3IHRA 2PTFA 3ZMVB 4XTCN 3U3IA 4CXWA 2VURA 3E0ZA 4Z8XA 4UF0B 4YT0A 3PUZF 1N34T 2WU2A 3L09A 3B57A 3RPUA 4GKKT 4HFHA 5JR9B 2UXCT 1W0AA 2XAJB 2YU2A 2OLTA 1XWMA 5FY0A 2JQ9A 5HEJA 2C0SA 4PK4A 2FJEA 3HA4A 3RLFF 1YKEB 2BS4A 2IMLA 1MMNA 1HX1B 4NUVA 2DWKA 5FXVA 2V6XA 2ZMAA 3CWZB 2BG9A 2CLYC 2XAHB 2E5LT 2XQ8A 1J5ET 4U3CA 1D1BA 4I4TE 1N36T 1W9RA 2NTYA 2JMHA 5LGUB 2QYWA 4UIGA 5HEUA 5AQUB 5CFBA 2LM9A 1D0XA 4OYKA 3MA9A 2YDRA 4TX5A 2L8KA 2RP4A 2V6YA 5CA0E 4KX6A 2YK0A 4LF8T 3FBZA 3ZT7A 2E9XD 3ZT6A 4TNWA 3V5UA 2Y8DA 3MXZA 5EK4A 1MMGA 2LT3A 4AQGA 2BZBA 2BBJA 4YMWC 1U5PA 1HG2A 4DMWA 1SUMB 2UXDT 1VRBA 1OWAA 5AQLB 4ZZCA 3UU6A 4QHOA 5IYZE 3CX8B 2W63A 2XZEA 4U2ZA 4X62T 4KHZF 3C50A 4C90A 2XQ4A 3RC8A 4ZHQE 1OEDC 2Q9QD 3LK2B 5L3DB 4OK0A 3RIFA 1OEDB 3CQXC 4C91A 2HHHT 4UXNB 4PK5A 4PAGA 3L3PA 5JREA 4X1YE 5F5WA 1ZKEA 4O4LE 4JBWF 4DBRA 3LSVA 4YTMA 4H9SE 3ETVA 4ZI2C 2J1DG 5FY1A 2YN6A 1ZEEA 3PUVG 3RQWA 5FP3A 3NVOA 2L3LA 4AXPA 4I0UA 4TN7B 5AQKB 4AIUA 4A5XA 1WCRA 4MHCA 4JLEA 2ZM2A 5H6RB 3RQUA 4OX9T 1UUSA 2BDEA 3GA8A 2D9DA 3QNUA 5C3JA 1N33T 3RIUC 3J9X1 2NWBA 3K8PC 3N2GE 3UU5A 3ZN0B 4WNKA 1HX8A 3ETUA 3A7MA 3MZKB 2UUBT 2V7IA 3GMIA 2DLRA 1KNZA 3TKLB 3P4QA 2C5JA 1HTJF 4K0KT 5A1LA 2A9UA 1YW0A 2DCFA 1NAFA 4CI1B 4DR3T 4JI0T 2XASB 1HG5A 3LK3B 5LG3A 4EZ4A 4X1IE 4HE8A 3LBXA 3PUYG 3J7Yq 1R8IA 1UGOA 3F2EA 2R6GG 4HFVA 3KV5A 2XPKA 2KXPB 4ZOLE 5AQFB 1US7B 3PUXF 3NRXA 1I94T 3N2KE 2HN1A 3AXJA 4V1Av 2MOZA 4DV4T 3O1HA 2D0UA 4NXNT 3CKDA 1LKXA 4DUZT 5LA6E 2ACZA 2BG9C 4IIJE 3JAFA 1MIYA 4AISA 5HXCA 4EAHA 3UT5E 4DV1T 5LJMA 3SOLA 4H63H 3TLWA 1MNEA 4O4HE 2FJDA 4P0BA 4PJMA 2PBIA 2V8SV 3ZKRA 2L9QA 5LP6E 2EHOD 4LF9T 4YMSC 1L0VA 3B5MA 4ILAA 3KV9A 3NKZA 4LMLA 5KX5E 2RPAA 2QRXA 2WP9A 4IDQA 3I9YA 4UF0A 2XHEB 2VASA 3LFMA 2E9XB 3N9NA 1D0YA 4KI0G 4DV2T 2GK9A 3PJAA 2E8IA 4JEHB 2WDVA 4AQYT 2VL8A 2A2FX 2FUPA 2YDSA 2W66A 4YTNA 2I6HA 4GK5E 2IUBA 2E2AA 4MBQA 4U7YA 4ERRA 4IREA 3ZCIA 4HN9A 4DV7T 5AQSB 3AAAB 2CXDA 2JQHA 3KDSE 2C5IT 3AE6A 3KVBA 2W2UA 4HWCA 4PK6A 4JI5T 4TZ4C 2AXDS 5JVDE 3ZC0A 2CPTA 5JDMA 3B13A 3KV4A 2UXXB 3NBXX 4CQIA 3ONXA 1G73A 2WAUA 1HCIA 2XQ7A 3ESLA 3AE7A 3O9XA 4B3MT 4EOZB 4ILBA 3ZSSA 5KMGP 5J0ZA 5LOVE 1LVKA 5FXXA 3AA1B 4F6RC 3RX6A 5AQMB 5LBQB 3ZC1A 5EK3A 2M6IA 3D31C 1XDPA 3AA7B 5H6QB 2KLQA 2F4VT 2MPKA 1HFAA 4X5TA 1ZP0A 1KF6A 1YD8G 4ZI3D 4DR1T 1CUNA 5HCMA 2K5BB 2X9XA 4EYUA 2XAGB 3EUHA 2X9WA 4X66T 2JIWA 2OV9A 2PG8A 2LOPA 3OTOT 5DABA 4H9RC 2MTQA 4YJ2E 1OEDA 2JMKA 3ZPOA 4MLKA 3UQ4A 1O3XA 3U78A 2IDOB 2N2NA 2K3WA 2CMRA 4BA9A 5FNVE 5IWAT 2WWUA 3NRYA 5ABGA 3ZLIA 2YKSA 1XNQT 3BQKA 4JI2T 4P09A 3RI5A 1SA0E 5AQIB 1HF8A 3I0QA 4B3ST 4LMKA 2R6GF 5CJ5A 4QH4A 4TUYE 4UELA 4IGUA 4B3TT 3KBUA 4G2AA 4HGAA 4ISSA 4JI4T 3GN5A 3E22E 2QGSA 5LYJE 3VRAA 1LRZA 4E7ZA 3DHWA 3RIUA 4DR7T 1BR2A 2CXLA 4G63A 2XJ7A 4FJOA 3CQCB 4TNVA 2EHOB 3CK6A 4NIQA 3Q9DA 5L3FB 4TQUN 5J2TE 2CBIA 2JJ9A 4XZCA 5F8PA 4DUYT 2W0GA 3Q5WA 3RYCE 3CIRA 2A72A 3OVUA 2D5UA 3OJAA 3T1YT 1E2AA 5JR9C 3FZMB 4DR4T 1IBMT 2VQET 4IL4A 3Q2MA 4DR2T 3AEDA 1KK7A 3RYFE 3QOFA 3PUGA 4P1NA 1UURA 3D0TA 3P8CD 4QWNB 2H88A 2BKOA 2VK9A 3PUYF 1MMDA 1VCTA 3BK9A 3CQGB 3Q5EA 4EXTA 5L3CB 1WR0A 1T7SA 4LF6T 5HXRA 1IJ6A 4GYRA 2VKDA 1X9BA 3SRZA 3ANWB 2B1EA 1Y64B 3TLVA 3OYXA 3PDYA 4I55E 2FJAA 4EV6A 3ZJ1A 4DV0T 4CXXA 4BJMA 4PJJA 2LOSA 1T98A 2NW8A 4ISTA 5JDFA 1WRDA 2E9XA 2JRKA 2CHOA 3HKDE 4IE0A 3P7IA 3SFDA 4AKLA 3I0OA 3OYZA 4KP3C 4IDPA 3RKGA 3CPZA 2MYSA 3FXEB 3GWHA 3FZLB 1XNRT 4AI6A 3JC6C 1UCUA 2VKHA 3LG7A 2DHRA 2LKGA 2LRKA 1N32T 1BR4A 2KMFA 3Q5DA 2ACXA 1IBKT 3ZSTA 4L5GA 2LSJA 3UUXB 3I1AA 2BBHA 3ZMTB 2D0TA 2UUAT 2V26A 4TV8E 2YEVC 3RF1A 4DO0A 4MFRA 3TUZA 2KZ7B 2X9YA 4KBMB 4O8SA 2DI4A 4ZS3A 3ZYMA 5FVLA 3AEFA 4HWHA 4UR9A 1ZOYA 2BG9E 5EZYE 4U33A 3PUSA 4EZHA 4AKHA 3FHNA 4HWIB 4B3RT 5AQGB 2J4GA 2H3RA 2X68A 4IDZA 3T1HT 2BVLA 1XMQT 2ZLYA 4YHJA 3K3NA 4HWDA 2OA5A 2CWOA 2B76A 1HS7A 4YJ3E 4GIWA 4MALA 3AVRA 4PJLA 3S4UA 3A5XA 4YXDA 4J2CA 3ZYKA 4QH1A 2YDQA 5JDNA 2XTLA 2K48A 3L39A 5HXHA 1XDOA 3P4RA 2QA7A 3PUWF 4QKNA 4LFBT 5HWYA 2NTXA 4DV3T 1X79A 4PNIA 4BAYB 3UU8A 1JNRA 4JV5T 4QXHB 2HN2A 3K3QC 3FXDB 4E7SA 4CI3B 1JNZA 3VRBA 4YY3T 3AB3B 2XM1A 5HEHA 2WDQA 1XZYA 2LEHA 3UUBA 2UXNB 2LHRA 2WZIA 2NW9A 2CHNA 4HKAA 4HFIA 4YFSA 2W62A 4COFA 4AKGA 2XM2A 3I9WA 5LG4A 5DJQC 2CCQA 3N9QA 4PJNA 4BJNA 4JUYA 1YQ3A 5J1GA 1OXZA 1KNRA 2EHOA 2IW5B 2UUCT 1D0ZA 2X0YA 4YSYA 3ZCJA 4YMTB 3KBTA 5LGTB 2E9XC 2X0LB 3OPCA 3KFWX 3RKOA 4Q25A 3C64A 3TUJA 5HAXA 3RHWA 5JR9A 2JQKA 3PUZG 1WFDA 2G0UA 1J1JA 2V1DB 3M3ZB 4JI1T 2KWHA 4OFZA 3UTKA 2QVAA 4WBOA 4YSZA 4IT4A 4X65T 3HI2A 1G8XA 1D1CA 2W4XA 3CX6B 3RLFG 2Z6EA 5HCJA 3AE2A 3R6NA 5ETWA 2Q9QC 4WZXA 5LNKA 4AQFA 2WS3A 5HYAA 2Q9QB 2LSYA 3AE1A 3MACA 4TWDA 3PUQA 4UV8B 1D1AA 2WWVA 2PJQA 4X64T 3IBPA 3VHLA 3O4XE 3FZHB 2IHR1 1LVFA 4JI3T 4P0AA 5ABFB 4LFAT 4HFBA 2MBGA 3AVSA 3P4SA 2HPLA 2KWIB 4AKIA 2I59A 4U72A 3PUVF 5ABHA 2LE8A 4HEAA 2P9BA 1HNWT 4EIWA 2ONKC 3SFEA 5L4HA 2X66A 5AQJB 2YU1A 1NWMX 2WMOA 5E0OA 5GONE 3MK7C 1WYCA 2ZM6T 3PE0A 1M7KA 3QC9A 4ADZA 2CA5A 2XUEA 5CA1E 5AQRB 1M62A 3CX7B 2IC6A 1S94A 4KHZG 2XQYA 1I6ZA 4Z91A 2XAQB 3F31A 4IE4A 1AJ3A 1FMVA 1KEYA 3KVAA 3N2OA 3RH3A 4OYJA 1ZHCA 1S35A 1WR6A 2D2SA 1E1HB 3AE9A 4UVBB 4AKRB 3K1SA 4JBWG 3ZN1B 5JDGA 5LXTE 2DL1A 3H37A 2XQ5A 3KV6A 2X9HA 2WB5A 2XAFB 3NZPA 4FI5A 4LFCT 4UVAB 3OKQA 5BMVE 4H9PC 5TAOA 1WLXA 3EDUA 4F8HA 4ZI2D 3QB5A 1HNZT 4ILCA 1MNDA 2IIUA 3OBVE 3TLSA 2E5VA 4DVDA 1NENA 3PU3A 4DBQA 4CZZB 4YSXA 2EHOC 1DU2A 4K0UA 5FKYA 4LF5T 4OHFA 2YOEA 4IDNA 5HXSA 4IE6A 2VKOA 3X1DA 5HWXA 4ZXLA 5DQWA 4A56A 4U31A 4IDOA 5L2LA 3P4WA 2V5DA 5L47A 2VQFT 2K24A 4XBFB 2WCAA 3O1JA 3UFGA 3RRWA 2UU9T 1HR0T 2I0MA 4TV9E 1IZNB 1QSDA 4O4JE 3UUMA 5AQQB 2VVNA 4KI0F 4GK0E 2A3DA 4M1PA 3FZFB 3MKDA 3KINB 1V9DA 3PUXG 3M65A 1OEDE 1UX5A 3AEGA 3QUJA 4JI7T 2KT9A 1UK5A 4PFPA 1HNXT 3C4ZA 3C4WA 2WSSV 3JAEA 5LHGB 2X67A 4O2AE 4AQFC 4TWHA 4U7IA 4I43B 3RIAA 3AEAA 4A98A 2BS3A 3P4PA 2HH7A 2VB6A 3R84B 4GOUA 3P50A 3IEEA 2C5KT 2YINA 3VKGA 2XSBA 3UQ7A 2M6BA 3PV0G 1FIOA 5JDQA 4DMVA 3F57A 2CLYB 4NXMT 3RRCA 3SS1A 2H7VC 4LF7T 4HWFA 4GKJT 4XIGM 1UX4A 3N9PA 1GQEA 5KXJA 3AEBA 2NR4A 2N9DA 3ZMUB 2X0HA 4ZI3C 3AA0B 1SHZC 2FJBA 5ABEA 5FMNA 2PFVA 5LBMA 3HL6A 5FY7A 5C8YE 4ZZBA 3UFEA 5LGNB 2BS2A 3EVYA 1W09A 3H3AA 4ASKA 3TUIA 4O2BE 1MIVA 4HFEA 2KINB 1IBLT 5LCYA 4CN4A 3MJXA 5M4YA 2Q9QA 3TLUA 3W15B 4KMCA 4TWFA 1T8BA 5J2UE 3O1IA 2NW7A 1Y01A 2XQ3A 5AQHB 2MAWA 4Z90A 4NPPA 1YKHB 1IAPA 4CXYA 3DJBA 4ZS2A 4JI6T 5ABFA 3C51A 5FXWA 2IAKA 2WU5A 2X51A 4YMVC 1ZV4X 3AE4A 4X1KE 1NEKA 5FVKA 2LHNA 4CN1A 4EYYR 2LKHA 1VOMA 5FYMA 4H63V 1KFYA 2ES0A 5CB4E 4DV6T 4XIGN 4PFOA 3VR9A 4DIDB 1FEWA 4L9IA 4O4IE 5JRCB 2WY2A 4LF4T 3AA6B 2Y6XA 5FXZA 2LRLA 4B6XA 2BKNA 3RC3A 3K3OA 3ZMZB 1YXRA 2V7MA 2J47A 1J5WA 2IC9A 3RYHE 2CM0A 4YMUC 3UU4A 4QH5A 5FL1A 3C4XA 3GN5B 3N5LA 2WZHA 3DP7A 2SPCA 3NZQA 3AECA 2VVSA 5AQPB 1SE7A 2VL0A 3LK42 4YTPA 2CRBA 3FZKB 5ADXL 5LMUT 4QX8B 5IUXA 3VU7H 5CGMA 3A8YC 3Q5XA 4UV9B 1XMOT 4X20E 1T72A 1H7CA 5LMNT 3HKEE 3CMLA 2LJLA 3ZYLA 3TLTA 3T8OA 2UXBT 1QLBA 2K9AA 2WMNA 2CBJA 2KSRA 3N9LA 4N78D 1Z8UA 3ZT5A 2DNXA 3PUAA 2AE9A 3IA3A 4UVCB 5L3BB 4CI2B 4HTEA 4A97A 5L3EB 1MIWA 3JCFA 2V5CA 2JQQA 2N1GA 2BG9B 1WYBA 2ODUA 3WAKA 5L4EA 3PTRB 4XAXB 3AE8A 3PV0F 2Y48B 1U4QA 4IL9A 2VKJA 1BR0A 4GYSA 3PU8A 5JDLA 2V7KA 2XQ6A 4EGWA 3VR8A 3FB2A 4DR5T 5JQGE 5LHIB 2V6YB 5HEOA 3HKBE 4QXCB 4IHJE 2W67A 5BR8T 1YQ4A 5LJNA 1BR1A 2LSKA 3C98B
chains in the Genus database with same CATH topology
3PV0G 4YMTB 3PUXF 3TUIA 3PUVF 3RLFG 4KHZF 4KI0F 3DHWA 2R6GF 4TQUM 4JBWF 4XIGN 3D31C 4XTCN 4YMWC 3TUZA 3PUWG 2ONKC 3PUYF 3PV0F 3PUZF 3PUXG 3PUVG 3RLFF 3TUJA 4YMUC 4KHZG 4YMVC 4XIGM 4KI0G 4XTCM 4JBWG 2R6GG 3PUWF 4YMSC 4TQUN 3PUYG 3PUZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 G;  4YMT B;  3PUX F;  3TUI A;  3PUV F;  3RLF G;  4KHZ F;  4KI0 F;  3DHW A;  2R6G F;  4TQU M;  4JBW F;  4XIG N;  3D31 C;  4XTC N;  4YMW C;  3TUZ A;  3PUW G;  2ONK C;  3PUY F;  3PV0 F;  3PUZ F;  3PUX G;  3PUV G;  3RLF F;  3TUJ A;  4YMU C;  4KHZ G;  4YMV C;  4XIG M;  4KI0 G;  4XTC M;  4JBW G;  2R6G G;  3PUW F;  4YMS C;  4TQU N;  3PUY G;  3PUZ G; 
#chains in the Genus database with same CATH topology
 5AQO B;  2CWY A;  4ZI7 E;  3NWI A;  4EEB A;  5AQN B;  5JDH A;  3ANW A;  3PJA J;  4ANJ A;  5C2T A;  4U2Y A;  2W61 A;  3UUL A;  4IE5 A;  5F3J A;  2LM2 A;  4YHH T;  2CEA A;  2LSG A;  3HR0 A;  3AEE A;  2ZM8 A;  4ILU A;  3ZJ2 A;  3L8R A;  4LMJ A;  3HKC E;  2WBL A;  5AQV B;  5JH7 E;  3AAI A;  2WQY A;  3RGL A;  5HEG A;  3EAB A;  2V7J A;  2VWA A;  5LB7 B;  1QUU A;  5IHY A;  4CN6 A;  4DND A;  4HFD A;  1Z0P A;  3G06 A;  3H3M A;  3E08 A;  2ODV A;  4WYV A;  3DTO A;  2M67 A;  3WAJ A;  4H9O C;  4QXB B;  2FBW A;  2BVM A;  2NOX A;  3LJC A;  3ZEF B;  4ZEY A;  1FMW A;  4QX7 B;  3UUN A;  4H9N C;  4L0R A;  1B7T A;  2DWG A;  2XY8 B;  4JEU B;  1FJG T;  4WW0 A;  4EB6 E;  1KNP A;  2H89 A;  4JI8 T;  5KDM C;  2RA1 A;  3ABV A;  4KUM B;  3QK6 A;  4IE7 A;  4PW8 A;  3UU3 A;  2J62 A;  3JC6 D;  4JYA T;  5FL0 A;  2LLY A;  3CVR A;  5LHH B;  3RYI E;  3AE5 A;  4TQU M;  5AQT B;  2WM9 A;  2BKP A;  3ONL C;  4H9Q C;  1E7P A;  2V7L A;  3QB5 K;  4XTC M;  3EDV A;  2XSA A;  3VKH A;  3EHZ A;  3N9O A;  3N9M A;  2H7O A;  2JPF A;  5JRC A;  4WBN E;  3ONJ A;  2WDR A;  5HXE A;  3SWH A;  4U74 A;  4I50 E;  2CE7 A;  1CHU A;  3JAD A;  3LBX B;  4DR6 T;  1VCS A;  4YLH A;  3BQI A;  3LDQ B;  2XQA A;  2XQ9 A;  3AE3 A;  3ZMS B;  2HPJ A;  2NP9 A;  3AXJ B;  4KHP T;  4HFC A;  5AFU L;  3BQL A;  1W0B A;  4UEM A;  3PUR A;  5L3G B;  4DV5 T;  3FBL A;  2ZM0 A;  2CXF A;  1EZ3 A;  1MMA A;  3PUW G;  2LSI A;  5DQV A;  3WI3 A;  5JTG A;  2W00 A;  2KND A;  3EAM A;  3EI0 A;  4EED A;  1IJ5 A;  4NUU A;  3V5S A;  3AAE B;  3IF8 B;  5EK2 A;  3IHR A;  2PTF A;  3ZMV B;  4XTC N;  3U3I A;  4CXW A;  2VUR A;  3E0Z A;  4Z8X A;  4UF0 B;  4YT0 A;  3PUZ F;  1N34 T;  2WU2 A;  3L09 A;  3B57 A;  3RPU A;  4GKK T;  4HFH A;  5JR9 B;  2UXC T;  1W0A A;  2XAJ B;  2YU2 A;  2OLT A;  1XWM A;  5FY0 A;  2JQ9 A;  5HEJ A;  2C0S A;  4PK4 A;  2FJE A;  3HA4 A;  3RLF F;  1YKE B;  2BS4 A;  2IML A;  1MMN A;  1HX1 B;  4NUV A;  2DWK A;  5FXV A;  2V6X A;  2ZMA A;  3CWZ B;  2BG9 A;  2CLY C;  2XAH B;  2E5L T;  2XQ8 A;  1J5E T;  4U3C A;  1D1B A;  4I4T E;  1N36 T;  1W9R A;  2NTY A;  2JMH A;  5LGU B;  2QYW A;  4UIG A;  5HEU A;  5AQU B;  5CFB A;  2LM9 A;  1D0X A;  4OYK A;  3MA9 A;  2YDR A;  4TX5 A;  2L8K A;  2RP4 A;  2V6Y A;  5CA0 E;  4KX6 A;  2YK0 A;  4LF8 T;  3FBZ A;  3ZT7 A;  2E9X D;  3ZT6 A;  4TNW A;  3V5U A;  2Y8D A;  3MXZ A;  5EK4 A;  1MMG A;  2LT3 A;  4AQG A;  2BZB A;  2BBJ A;  4YMW C;  1U5P A;  1HG2 A;  4DMW A;  1SUM B;  2UXD T;  1VRB A;  1OWA A;  5AQL B;  4ZZC A;  3UU6 A;  4QHO A;  5IYZ E;  3CX8 B;  2W63 A;  2XZE A;  4U2Z A;  4X62 T;  4KHZ F;  3C50 A;  4C90 A;  2XQ4 A;  3RC8 A;  4ZHQ E;  1OED C;  2Q9Q D;  3LK2 B;  5L3D B;  4OK0 A;  3RIF A;  1OED B;  3CQX C;  4C91 A;  2HHH T;  4UXN B;  4PK5 A;  4PAG A;  3L3P A;  5JRE A;  4X1Y E;  5F5W A;  1ZKE A;  4O4L E;  4JBW F;  4DBR A;  3LSV A;  4YTM A;  4H9S E;  3ETV A;  4ZI2 C;  2J1D G;  5FY1 A;  2YN6 A;  1ZEE A;  3PUV G;  3RQW A;  5FP3 A;  3NVO A;  2L3L A;  4AXP A;  4I0U A;  4TN7 B;  5AQK B;  4AIU A;  4A5X A;  1WCR A;  4MHC A;  4JLE A;  2ZM2 A;  5H6R B;  3RQU A;  4OX9 T;  1UUS A;  2BDE A;  3GA8 A;  2D9D A;  3QNU A;  5C3J A;  1N33 T;  3RIU C;  3J9X 1;  2NWB A;  3K8P C;  3N2G E;  3UU5 A;  3ZN0 B;  4WNK A;  1HX8 A;  3ETU A;  3A7M A;  3MZK B;  2UUB T;  2V7I A;  3GMI A;  2DLR A;  1KNZ A;  3TKL B;  3P4Q A;  2C5J A;  1HTJ F;  4K0K T;  5A1L A;  2A9U A;  1YW0 A;  2DCF A;  1NAF A;  4CI1 B;  4DR3 T;  4JI0 T;  2XAS B;  1HG5 A;  3LK3 B;  5LG3 A;  4EZ4 A;  4X1I E;  4HE8 A;  3LBX A;  3PUY G;  3J7Y q;  1R8I A;  1UGO A;  3F2E A;  2R6G G;  4HFV A;  3KV5 A;  2XPK A;  2KXP B;  4ZOL E;  5AQF B;  1US7 B;  3PUX F;  3NRX A;  1I94 T;  3N2K E;  2HN1 A;  3AXJ A;  4V1A v;  2MOZ A;  4DV4 T;  3O1H A;  2D0U A;  4NXN T;  3CKD A;  1LKX A;  4DUZ T;  5LA6 E;  2ACZ A;  2BG9 C;  4IIJ E;  3JAF A;  1MIY A;  4AIS A;  5HXC A;  4EAH A;  3UT5 E;  4DV1 T;  5LJM A;  3SOL A;  4H63 H;  3TLW A;  1MNE A;  4O4H E;  2FJD A;  4P0B A;  4PJM A;  2PBI A;  2V8S V;  3ZKR A;  2L9Q A;  5LP6 E;  2EHO D;  4LF9 T;  4YMS C;  1L0V A;  3B5M A;  4ILA A;  3KV9 A;  3NKZ A;  4LML A;  5KX5 E;  2RPA A;  2QRX A;  2WP9 A;  4IDQ A;  3I9Y A;  4UF0 A;  2XHE B;  2VAS A;  3LFM A;  2E9X B;  3N9N A;  1D0Y A;  4KI0 G;  4DV2 T;  2GK9 A;  3PJA A;  2E8I A;  4JEH B;  2WDV A;  4AQY T;  2VL8 A;  2A2F X;  2FUP A;  2YDS A;  2W66 A;  4YTN A;  2I6H A;  4GK5 E;  2IUB A;  2E2A A;  4MBQ A;  4U7Y A;  4ERR A;  4IRE A;  3ZCI A;  4HN9 A;  4DV7 T;  5AQS B;  3AAA B;  2CXD A;  2JQH A;  3KDS E;  2C5I T;  3AE6 A;  3KVB A;  2W2U A;  4HWC A;  4PK6 A;  4JI5 T;  4TZ4 C;  2AXD S;  5JVD E;  3ZC0 A;  2CPT A;  5JDM A;  3B13 A;  3KV4 A;  2UXX B;  3NBX X;  4CQI A;  3ONX A;  1G73 A;  2WAU A;  1HCI A;  2XQ7 A;  3ESL A;  3AE7 A;  3O9X A;  4B3M T;  4EOZ B;  4ILB A;  3ZSS A;  5KMG P;  5J0Z A;  5LOV E;  1LVK A;  5FXX A;  3AA1 B;  4F6R C;  3RX6 A;  5AQM B;  5LBQ B;  3ZC1 A;  5EK3 A;  2M6I A;  3D31 C;  1XDP A;  3AA7 B;  5H6Q B;  2KLQ A;  2F4V T;  2MPK A;  1HFA A;  4X5T A;  1ZP0 A;  1KF6 A;  1YD8 G;  4ZI3 D;  4DR1 T;  1CUN A;  5HCM A;  2K5B B;  2X9X A;  4EYU A;  2XAG B;  3EUH A;  2X9W A;  4X66 T;  2JIW A;  2OV9 A;  2PG8 A;  2LOP A;  3OTO T;  5DAB A;  4H9R C;  2MTQ A;  4YJ2 E;  1OED A;  2JMK A;  3ZPO A;  4MLK A;  3UQ4 A;  1O3X A;  3U78 A;  2IDO B;  2N2N A;  2K3W A;  2CMR A;  4BA9 A;  5FNV E;  5IWA T;  2WWU A;  3NRY A;  5ABG A;  3ZLI A;  2YKS A;  1XNQ T;  3BQK A;  4JI2 T;  4P09 A;  3RI5 A;  1SA0 E;  5AQI B;  1HF8 A;  3I0Q A;  4B3S T;  4LMK A;  2R6G F;  5CJ5 A;  4QH4 A;  4TUY E;  4UEL A;  4IGU A;  4B3T T;  3KBU A;  4G2A A;  4HGA A;  4ISS A;  4JI4 T;  3GN5 A;  3E22 E;  2QGS A;  5LYJ E;  3VRA A;  1LRZ A;  4E7Z A;  3DHW A;  3RIU A;  4DR7 T;  1BR2 A;  2CXL A;  4G63 A;  2XJ7 A;  4FJO A;  3CQC B;  4TNV A;  2EHO B;  3CK6 A;  4NIQ A;  3Q9D A;  5L3F B;  4TQU N;  5J2T E;  2CBI A;  2JJ9 A;  4XZC A;  5F8P A;  4DUY T;  2W0G A;  3Q5W A;  3RYC E;  3CIR A;  2A72 A;  3OVU A;  2D5U A;  3OJA A;  3T1Y T;  1E2A A;  5JR9 C;  3FZM B;  4DR4 T;  1IBM T;  2VQE T;  4IL4 A;  3Q2M A;  4DR2 T;  3AED A;  1KK7 A;  3RYF E;  3QOF A;  3PUG A;  4P1N A;  1UUR A;  3D0T A;  3P8C D;  4QWN B;  2H88 A;  2BKO A;  2VK9 A;  3PUY F;  1MMD A;  1VCT A;  3BK9 A;  3CQG B;  3Q5E A;  4EXT A;  5L3C B;  1WR0 A;  1T7S A;  4LF6 T;  5HXR A;  1IJ6 A;  4GYR A;  2VKD A;  1X9B A;  3SRZ A;  3ANW B;  2B1E A;  1Y64 B;  3TLV A;  3OYX A;  3PDY A;  4I55 E;  2FJA A;  4EV6 A;  3ZJ1 A;  4DV0 T;  4CXX A;  4BJM A;  4PJJ A;  2LOS A;  1T98 A;  2NW8 A;  4IST A;  5JDF A;  1WRD A;  2E9X A;  2JRK A;  2CHO A;  3HKD E;  4IE0 A;  3P7I A;  3SFD A;  4AKL A;  3I0O A;  3OYZ A;  4KP3 C;  4IDP A;  3RKG A;  3CPZ A;  2MYS A;  3FXE B;  3GWH A;  3FZL B;  1XNR T;  4AI6 A;  3JC6 C;  1UCU A;  2VKH A;  3LG7 A;  2DHR A;  2LKG A;  2LRK A;  1N32 T;  1BR4 A;  2KMF A;  3Q5D A;  2ACX A;  1IBK T;  3ZST A;  4L5G A;  2LSJ A;  3UUX B;  3I1A A;  2BBH A;  3ZMT B;  2D0T A;  2UUA T;  2V26 A;  4TV8 E;  2YEV C;  3RF1 A;  4DO0 A;  4MFR A;  3TUZ A;  2KZ7 B;  2X9Y A;  4KBM B;  4O8S A;  2DI4 A;  4ZS3 A;  3ZYM A;  5FVL A;  3AEF A;  4HWH A;  4UR9 A;  1ZOY A;  2BG9 E;  5EZY E;  4U33 A;  3PUS A;  4EZH A;  4AKH A;  3FHN A;  4HWI B;  4B3R T;  5AQG B;  2J4G A;  2H3R A;  2X68 A;  4IDZ A;  3T1H T;  2BVL A;  1XMQ T;  2ZLY A;  4YHJ A;  3K3N A;  4HWD A;  2OA5 A;  2CWO A;  2B76 A;  1HS7 A;  4YJ3 E;  4GIW A;  4MAL A;  3AVR A;  4PJL A;  3S4U A;  3A5X A;  4YXD A;  4J2C A;  3ZYK A;  4QH1 A;  2YDQ A;  5JDN A;  2XTL A;  2K48 A;  3L39 A;  5HXH A;  1XDO A;  3P4R A;  2QA7 A;  3PUW F;  4QKN A;  4LFB T;  5HWY A;  2NTX A;  4DV3 T;  1X79 A;  4PNI A;  4BAY B;  3UU8 A;  1JNR A;  4JV5 T;  4QXH B;  2HN2 A;  3K3Q C;  3FXD B;  4E7S A;  4CI3 B;  1JNZ A;  3VRB A;  4YY3 T;  3AB3 B;  2XM1 A;  5HEH A;  2WDQ A;  1XZY A;  2LEH A;  3UUB A;  2UXN B;  2LHR A;  2WZI A;  2NW9 A;  2CHN A;  4HKA A;  4HFI A;  4YFS A;  2W62 A;  4COF A;  4AKG A;  2XM2 A;  3I9W A;  5LG4 A;  5DJQ C;  2CCQ A;  3N9Q A;  4PJN A;  4BJN A;  4JUY A;  1YQ3 A;  5J1G A;  1OXZ A;  1KNR A;  2EHO A;  2IW5 B;  2UUC T;  1D0Z A;  2X0Y A;  4YSY A;  3ZCJ A;  4YMT B;  3KBT A;  5LGT B;  2E9X C;  2X0L B;  3OPC A;  3KFW X;  3RKO A;  4Q25 A;  3C64 A;  3TUJ A;  5HAX A;  3RHW A;  5JR9 A;  2JQK A;  3PUZ G;  1WFD A;  2G0U A;  1J1J A;  2V1D B;  3M3Z B;  4JI1 T;  2KWH A;  4OFZ A;  3UTK A;  2QVA A;  4WBO A;  4YSZ A;  4IT4 A;  4X65 T;  3HI2 A;  1G8X A;  1D1C A;  2W4X A;  3CX6 B;  3RLF G;  2Z6E A;  5HCJ A;  3AE2 A;  3R6N A;  5ETW A;  2Q9Q C;  4WZX A;  5LNK A;  4AQF A;  2WS3 A;  5HYA A;  2Q9Q B;  2LSY A;  3AE1 A;  3MAC A;  4TWD A;  3PUQ A;  4UV8 B;  1D1A A;  2WWV A;  2PJQ A;  4X64 T;  3IBP A;  3VHL A;  3O4X E;  3FZH B;  2IHR 1;  1LVF A;  4JI3 T;  4P0A A;  5ABF B;  4LFA T;  4HFB A;  2MBG A;  3AVS A;  3P4S A;  2HPL A;  2KWI B;  4AKI A;  2I59 A;  4U72 A;  3PUV F;  5ABH A;  2LE8 A;  4HEA A;  2P9B A;  1HNW T;  4EIW A;  2ONK C;  3SFE A;  5L4H A;  2X66 A;  5AQJ B;  2YU1 A;  1NWM X;  2WMO A;  5E0O A;  5GON E;  3MK7 C;  1WYC A;  2ZM6 T;  3PE0 A;  1M7K A;  3QC9 A;  4ADZ A;  2CA5 A;  2XUE A;  5CA1 E;  5AQR B;  1M62 A;  3CX7 B;  2IC6 A;  1S94 A;  4KHZ G;  2XQY A;  1I6Z A;  4Z91 A;  2XAQ B;  3F31 A;  4IE4 A;  1AJ3 A;  1FMV A;  1KEY A;  3KVA A;  3N2O A;  3RH3 A;  4OYJ A;  1ZHC A;  1S35 A;  1WR6 A;  2D2S A;  1E1H B;  3AE9 A;  4UVB B;  4AKR B;  3K1S A;  4JBW G;  3ZN1 B;  5JDG A;  5LXT E;  2DL1 A;  3H37 A;  2XQ5 A;  3KV6 A;  2X9H A;  2WB5 A;  2XAF B;  3NZP A;  4FI5 A;  4LFC T;  4UVA B;  3OKQ A;  5BMV E;  4H9P C;  5TAO A;  1WLX A;  3EDU A;  4F8H A;  4ZI2 D;  3QB5 A;  1HNZ T;  4ILC A;  1MND A;  2IIU A;  3OBV E;  3TLS A;  2E5V A;  4DVD A;  1NEN A;  3PU3 A;  4DBQ A;  4CZZ B;  4YSX A;  2EHO C;  1DU2 A;  4K0U A;  5FKY A;  4LF5 T;  4OHF A;  2YOE A;  4IDN A;  5HXS A;  4IE6 A;  2VKO A;  3X1D A;  5HWX A;  4ZXL A;  5DQW A;  4A56 A;  4U31 A;  4IDO A;  5L2L A;  3P4W A;  2V5D A;  5L47 A;  2VQF T;  2K24 A;  4XBF B;  2WCA A;  3O1J A;  3UFG A;  3RRW A;  2UU9 T;  1HR0 T;  2I0M A;  4TV9 E;  1IZN B;  1QSD A;  4O4J E;  3UUM A;  5AQQ B;  2VVN A;  4KI0 F;  4GK0 E;  2A3D A;  4M1P A;  3FZF B;  3MKD A;  3KIN B;  1V9D A;  3PUX G;  3M65 A;  1OED E;  1UX5 A;  3AEG A;  3QUJ A;  4JI7 T;  2KT9 A;  1UK5 A;  4PFP A;  1HNX T;  3C4Z A;  3C4W A;  2WSS V;  3JAE A;  5LHG B;  2X67 A;  4O2A E;  4AQF C;  4TWH A;  4U7I A;  4I43 B;  3RIA A;  3AEA A;  4A98 A;  2BS3 A;  3P4P A;  2HH7 A;  2VB6 A;  3R84 B;  4GOU A;  3P50 A;  3IEE A;  2C5K T;  2YIN A;  3VKG A;  2XSB A;  3UQ7 A;  2M6B A;  3PV0 G;  1FIO A;  5JDQ A;  4DMV A;  3F57 A;  2CLY B;  4NXM T;  3RRC A;  3SS1 A;  2H7V C;  4LF7 T;  4HWF A;  4GKJ T;  4XIG M;  1UX4 A;  3N9P A;  1GQE A;  5KXJ A;  3AEB A;  2NR4 A;  2N9D A;  3ZMU B;  2X0H A;  4ZI3 C;  3AA0 B;  1SHZ C;  2FJB A;  5ABE A;  5FMN A;  2PFV A;  5LBM A;  3HL6 A;  5FY7 A;  5C8Y E;  4ZZB A;  3UFE A;  5LGN B;  2BS2 A;  3EVY A;  1W09 A;  3H3A A;  4ASK A;  3TUI A;  4O2B E;  1MIV A;  4HFE A;  2KIN B;  1IBL T;  5LCY A;  4CN4 A;  3MJX A;  5M4Y A;  2Q9Q A;  3TLU A;  3W15 B;  4KMC A;  4TWF A;  1T8B A;  5J2U E;  3O1I A;  2NW7 A;  1Y01 A;  2XQ3 A;  5AQH B;  2MAW A;  4Z90 A;  4NPP A;  1YKH B;  1IAP A;  4CXY A;  3DJB A;  4ZS2 A;  4JI6 T;  5ABF A;  3C51 A;  5FXW A;  2IAK A;  2WU5 A;  2X51 A;  4YMV C;  1ZV4 X;  3AE4 A;  4X1K E;  1NEK A;  5FVK A;  2LHN A;  4CN1 A;  4EYY R;  2LKH A;  1VOM A;  5FYM A;  4H63 V;  1KFY A;  2ES0 A;  5CB4 E;  4DV6 T;  4XIG N;  4PFO A;  3VR9 A;  4DID B;  1FEW A;  4L9I A;  4O4I E;  5JRC B;  2WY2 A;  4LF4 T;  3AA6 B;  2Y6X A;  5FXZ A;  2LRL A;  4B6X A;  2BKN A;  3RC3 A;  3K3O A;  3ZMZ B;  1YXR A;  2V7M A;  2J47 A;  1J5W A;  2IC9 A;  3RYH E;  2CM0 A;  4YMU C;  3UU4 A;  4QH5 A;  5FL1 A;  3C4X A;  3GN5 B;  3N5L A;  2WZH A;  3DP7 A;  2SPC A;  3NZQ A;  3AEC A;  2VVS A;  5AQP B;  1SE7 A;  2VL0 A;  3LK4 2;  4YTP A;  2CRB A;  3FZK B;  5ADX L;  5LMU T;  4QX8 B;  5IUX A;  3VU7 H;  5CGM A;  3A8Y C;  3Q5X A;  4UV9 B;  1XMO T;  4X20 E;  1T72 A;  1H7C A;  5LMN T;  3HKE E;  3CML A;  2LJL A;  3ZYL A;  3TLT A;  3T8O A;  2UXB T;  1QLB A;  2K9A A;  2WMN A;  2CBJ A;  2KSR A;  3N9L A;  4N78 D;  1Z8U A;  3ZT5 A;  2DNX A;  3PUA A;  2AE9 A;  3IA3 A;  4UVC B;  5L3B B;  4CI2 B;  4HTE A;  4A97 A;  5L3E B;  1MIW A;  3JCF A;  2V5C A;  2JQQ A;  2N1G A;  2BG9 B;  1WYB A;  2ODU A;  3WAK A;  5L4E A;  3PTR B;  4XAX B;  3AE8 A;  3PV0 F;  2Y48 B;  1U4Q A;  4IL9 A;  2VKJ A;  1BR0 A;  4GYS A;  3PU8 A;  5JDL A;  2V7K A;  2XQ6 A;  4EGW A;  3VR8 A;  3FB2 A;  4DR5 T;  5JQG E;  5LHI B;  2V6Y B;  5HEO A;  3HKB E;  4QXC B;  4IHJ E;  2W67 A;  5BR8 T;  1YQ4 A;  5LJN A;  1BR1 A;  2LSK A;  3C98 B; 
#chains in the Genus database with same CATH homology
 3PV0 G;  4YMT B;  3PUX F;  3TUI A;  3PUV F;  3RLF G;  4KHZ F;  4KI0 F;  3DHW A;  2R6G F;  4TQU M;  4JBW F;  4XIG N;  3D31 C;  4XTC N;  4YMW C;  3TUZ A;  3PUW G;  2ONK C;  3PUY F;  3PV0 F;  3PUZ F;  3PUX G;  3PUV G;  3RLF F;  3TUJ A;  4YMU C;  4KHZ G;  4YMV C;  4XIG M;  4KI0 G;  4XTC M;  4JBW G;  2R6G G;  3PUW F;  4YMS C;  4TQU N;  3PUY G;  3PUZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...