4JBWF

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
492
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 119
structure length 492
sequence length 492
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4jbwF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4jbwF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4jbwF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4jbwF02
4KHZF 4KHZG 4JBWF 4XTCN 4JBWG 3PUYG 3PUYF 3PUVF 3PUVG 4XTCM 3DHWA 2ONKC 3RLFF 3RLFG 4YMTB 3TUZA 4XIGN 4YMSC 3PUZF 3D31C 3PUXF 3TUJA 3PUZG 2R6GF 2R6GG 4XIGM 3PUXG 3PUWF 3PUWG 4YMWC 3PV0F 3PV0G 4KI0G 4KI0F 4TQUN 3TUIA 4YMUC 4TQUM 4YMVC
chains in the Genus database with same CATH superfamily
2CLYB 1MNEA 2DI4A 3EDUA 4FJOA 4QWNB 5EK4A 4ZOLE 4UXNB 4WBNE 4TNWA 5LGUB 2V7KA 3QUJA 5JRCB 1XMOT 2CWOA 4KHZG 3EABA 3AA7B 3O1HA 5FVKA 2V6YA 1LVKA 3RLFF 3HKBE 3RRWA 5KXJA 3SFDA 2G0UA 4HFDA 2N2NA 2H7VC 5E0OA 2BG9B 2BVMA 1XDPA 2L3LA 1YW0A 3RQWA 1AJ3A 2HH7A 5AFUL 5FP3A 2C0SA 2LLYA 3A8YC 2VKDA 2X9XA 3RHWA 4ISSA 3ZJ2A 4X65T 3HKDE 2KINB 4EYUA 4DV3T 4ZS3A 3UULA 2YDQA 2JMHA 4IIJE 2H89A 4YMUC 2Q9QB 2XAHB 5LGTB 4DR7T 1E7PA 1M62A 2QVAA 1ZOYA 3JC6D 5AQQB 3UU3A 2MBGA 3X1DA 3TKLB 3NVOA 4V1Av 2YOEA 3HA4A 1OWAA 3RKGA 4AISA 4M1PA 5C2TA 1WR0A 4JUYA 1KFYA 3KVBA 3FZLB 1HG5A 5CB4E 4I43B 3ZYMA 3KV5A 3RIUA 2XASB 5ADXL 2H7OA 4IE7A 4ILBA 3ZT5A 2WWUA 2UU9T 5DABA 3PV0G 2BZBA 3KBUA 3PUQA 4ZHQE 2QRXA 3VHLA 4YFSA 3QB5A 1YKHB 3BQIA 1MIVA 4O4IE 3PJAA 3ABVA 2L9QA 5LHHB 4IE0A 3ZMZB 2W62A 2PG8A 3AA0B 3DP7A 5AQLB 5L3DB 3N9MA 4H9OC 1QUUA 2V7LA 2V6XA 3W15B 3FZKB 4JI8T 3LSVA 4IT4A 3I9WA 3MJXA 2YDRA 2J1DG 2E2AA 4IL4A 4CN4A 4MHCA 3PUSA 3PJAJ 5LJNA 5CJ5A 2ZM2A 4C91A 2PTFA 4O2BE 4OYKA 2XSBA 3VRAA 4B3RT 2M67A 4HEAA 2C5KT 4H63H 4NUUA 3P4RA 5FYMA 3E0ZA 5L3BB 1ZP0A 3AE8A 3ZMVB 2F4VT 2VWAA 3Q5WA 3ZYKA 3J9X1 4ZI3C 4OFZA 2YINA 2XM2A 4XTCM 4PK4A 2LM9A 2BVLA 3PURA 4JI1T 3EHZA 1XNRT 2FUPA 4IGUA 3CWZB 4U7IA 4JI7T 2IW5B 4EZ4A 1EZ3A 3K3NA 1FMWA 3AECA 3AEDA 5C8YE 2QYWA 2YDSA 4H9NC 2I6HA 4U72A 1QSDA 3ZC1A 1WYCA 2IIUA 4IE6A 4JI6T 5L3FB 2XQYA 2D0TA 4LFCT 2WU2A 2KWIB 4P09A 3AA6B 3R6NA 4B6XA 1G8XA 2CCQA 4BAYB 2UXBT 3K3OA 3GWHA 2ACZA 4KI0G 3J7Yq 2Z6EA 3BK9A 2BKPA 2A2FX 3AAIA 3RQUA 4C90A 2CHOA 2LT3A 4AQYT 2J47A 5LHGB 2WZHA 3UU5A 4YMSC 5KX5E 4NXMT 4AQGA 3TUJA 4DO0A 2NWBA 2X9WA 2KZ7B 1Y01A 2WU5A 4YY3T 4WW0A 1WRDA 3FZMB 1V9DA 3AVSA 4Z90A 4I0UA 2BKNA 1Z8UA 2V5DA 1LRZA 4Z91A 4GIWA 3UQ4A 1Y64B 3IF8B 4TWDA 2JQHA 4JV5T 1NAFA 3CX7B 2RA1A 4AI6A 5ABFB 2B76A 2V7JA 5LMUT 3AVRA 3NKZA 1T72A 2IMLA 5LGNB 4EV6A 1WFDA 3AAAB 4X20E 4AKLA 3GN5A 4EEDA 1L0VA 4EIWA 1UCUA 4PJMA 4DIDB 3AXJB 4E7SA 3ZT6A 2V5CA 5LP6E 5L3EB 4ZI3D 2VKOA 2MTQA 5FKYA 3E22E 1US7B 3LJCA 4DVDA 1HNXT 3DJBA 3L39A 3ZMSB 1VCTA 3PDYA 5J2TE 3N9OA 2A9UA 1FJGT 3N5LA 3UUXB 3UUNA 2N9DA 4X1KE 1IJ6A 5L4HA 2VK9A 2I0MA 4AXPA 2ZMAA 1KK7A 1N33T 3EVYA 4K0UA 5ABGA 4P0BA 1HNZT 2IAKA 3H3AA 5M4YA 3ANWA 3KINB 4PK5A 4O4LE 2XQ9A 4BJNA 4EOZB 2P9BA 5LG3A 1D0ZA 2MPKA 3AEAA 2XQ3A 2V7IA 3IA3A 4ISTA 5AQRB 3FHNA 2NW9A 4ANJA 1OEDB 3L09A 3O1JA 3N2KE 4YHJA 4CN1A 4OK0A 3JC6C 2X67A 4U33A 2YEVC 2LOPA 4ZZBA 5F5WA 3I9YA 3ZT7A 4IDQA 3PUYG 4QKNA 5HEJA 3PUAA 2VKHA 5J1GA 2FJDA 4IHJE 2K5BB 5JH7E 4JI3T 2XSAA 4DR3T 3PUXF 2PBIA 3RH3A 3ETVA 4UV9B 4HWFA 1VCSA 3QOFA 2MOZA 3UU6A 2CHNA 4O8SA 4JI2T 2IHR1 3L3PA 2FJEA 2WAUA 4PNIA 4H9RC 4XIGM 4EXTA 2EHOB 2JMKA 4WBOA 2J4GA 5HXHA 3PUVF 4JEHB 2ONKC 2LOSA 5J0ZA 2E8IA 3EAMA 2VQET 4H9SE 3LK2B 4TV8E 4A5XA 2LKGA 1U5PA 4EEBA 1FIOA 1MIWA 2VURA 2WSSV 5JR9C 2M6IA 2JPFA 3RYCE 3U3IA 4YTPA 1IBKT 4HFVA 4PAGA 1UX4A 3RIFA 5FXZA 4QX7B 4AKRB 2LJLA 2VVSA 5FMNA 4KBMB 4F6RC 3PV0F 1HFAA 5FNVE 5AQTB 3PU3A 1N32T 4HFEA 3N2OA 2LSGA 1SA0E 2BBHA 2XZEA 5C3JA 2EHOA 4GK0E 2XQ4A 4IE5A 5KMGP 4LF9T 3PUXG 3MK7C 4DR5T 2ZM8A 4U74A 3N9LA 3QK6A 3MACA 3CK6A 1ZKEA 5FXVA 2UXNB 3T8OA 3I1AA 2D5UA 5HXRA 5IYZE 1BR0A 5LXTE 4B3ST 2XQAA 4TQUN 3ZCIA 3RC3A 2CM0A 2A3DA 4MLKA 5FL0A 4ILUA 4A97A 4P0AA 3ZJ1A 3UTKA 3PUVG 5JRCA 3CX6B 3B13A 3T1YT 4UEMA 4X64T 4CI1B 2DCFA 4YMWC 5CA1E 4DUZT 3CQXC 3C51A 3SFEA 2UUCT 3IHRA 3JCFA 4AKHA 3RI5A 2BG9A 2VB6A 4COFA 2WZIA 3M3ZB 1YKEB 2I59A 4XBFB 1LKXA 2X68A 4QXCB 3KV6A 3ZEFB 3AE1A 4A98A 4JI5T 2LRKA 5HXSA 5JDHA 2Q9QA 3C64A 3N9PA 4ZXLA 2OV9A 3CMLA 5EK3A 1KNPA 2CLYC 4YJ3E 2K24A 4WYVA 4U2ZA 5HYAA 4HTEA 5DQWA 4I50E 1J1JA 3KV4A 2CE7A 2E5LT 1NENA 5FL1A 2Y8DA 1D1AA 4EYYR 4WZXA 4IREA 2M6BA 2Y48B 4DV7T 3B5MA 4KI0F 2A72A 4BA9A 4TZ4C 2X9HA 4QX8B 5L47A 4LMJA 2AXDS 2UUAT 2DL1A 3FXDB 3FBZA 2BG9C 4O4HE 5LNKA 4HFIA 3RIUC 2XAGB 1UGOA 2KNDA 1X9BA 5AQNB 3N2GE 2XJ7A 2HPJA 2W67A 2V26A 4KP3C 5JDQA 4ERRA 5LBMA 3AE4A 3FZFB 2ACXA 3AEEA 4NPPA 3A7MA 4HWIB 3HKCE 2ZM6T 5HAXA 5LJMA 1KF6A 2XQ5A 5CFBA 4G63A 5CGMA 1XNQT 2NW7A 2DLRA 3OYZA 3ZMTB 4CQIA 5A1LA 3UT5E 3RF1A 4DV0T 2IUBA 3RYHE 4G2AA 5LG4A 3FZHB 4FI5A 3LK42 2LSYA 4QHOA 4H63V 4PJJA 1DU2A 4L5GA 3PU8A 4TUYE 2WCAA 1OXZA 4OYJA 5BR8T 3R84B 3AEBA 1U4QA 3NRYA 2OLTA 5L4EA 2R6GG 2D2SA 4ZEYA 3K8PC 2WQYA 3RC8A 2EHOD 4I55E 4KHPT 4JLEA 3UUBA 3F2EA 3CKDA 2WDQA 2UXXB 2V8SV 2VVNA 3RX6A 3LBXB 4ILCA 2H3RA 4OHFA 3O9XA 1NWMX 1D0YA 4DV1T 3FB2A 2W63A 3JAFA 2LSIA 4UF0B 2XM1A 4IE4A 2QA7A 4PJLA 2D9DA 2HN1A 4O4JE 4KMCA 4QH4A 5FVLA 2V1DB 3VRBA 2ODVA 5L3GB 3UFEA 2WMOA 5HXCA 3AE9A 1HNWT 4XZCA 3F31A 5FXXA 3NBXX 1I6ZA 4TN7B 4DR6T 2XQ8A 2YKSA 1BR4A 5FXWA 5EK2A 2AE9A 2K3WA 2W66A 2LSJA 4IL9A 5DJQC 2MYSA 1WCRA 3AE2A 2B1EA 2WS3A 4TWHA 1XMQT 4BJMA 3PUYF 3TLWA 3F57A 4ADZA 4YT0A 4N78D 3PUWF 3K1SA 2CWYA 3VR9A 5F8PA 5JDLA 2BBJA 4MBQA 5AQGB 4JBWF 4HN9A 2JQKA 4CN6A 2Q9QD 5LA6E 3EI0A 2VQFT 2SPCA 4L0RA 5DQVA 1FEWA 4I4TE 1CUNA 3GA8A 1J5ET 1N34T 4DBQA 5ABFA 3FXEB 2E9XB 1I94T 2NTYA 3Q5DA 5AQOB 4EAHA 2XHEB 4U31A 4Q25A 1XZYA 5CA0E 3HKEE 3UFGA 2FBWA 2LKHA 1BR1A 3AXJA 4YSZA 1HR0T 1H7CA 4AKIA 2C5IT 2XTLA 4X1YE 3UQ7A 2YU2A 4WNKA 3BQLA 2OA5A 4U7YA 3NWIA 2CMRA 2WM9A 4CXWA 5JDGA 2PFVA 3P4SA 3OBVE 5LMNT 1T7SA 2XPKA 3CIRA 2RPAA 3HI2A 2VL0A 3DHWA 4LFBT 3AE3A 2GK9A 3TUZA 3H3MA 4H9PC 3PUZF 4UIGA 2E9XA 2NR4A 2CXLA 2VASA 3PUWG 4QXBB 1E2AA 1WLXA 4PJNA 4UVCB 2BS4A 4HE8A 4JBWG 1IBMT 3Q5XA 1HF8A 4DR1T 1D1BA 5AQSB 3P50A 3PE0A 2KXPB 2UXDT 5L3CB 2W4XA 3PTRB 3N9QA 2CBIA 3TUIA 2FJAA 2IC6A 2ODUA 3ZSTA 1OEDA 1KNRA 2YK0A 2WY2A 3ONJA 5IUXA 4CI3B 3I0OA 3ESLA 3RYFE 3IBPA 2WDVA 3FBLA 5EZYE 4JI4T 1IZNB 5IHYA 3Q5EA 1W0BA 4X5TA 2KMFA 5FY1A 3BQKA 4IDZA 3CVRA 3LDQB 2MAWA 5LYJE 3LK3B 4LF4T 3VKHA 1MMNA 4U2YA 3NZPA 2UUBT 3RRCA 4ZS2A 3ZSSA 2K48A 3P4PA 2K9AA 3MKDA 4HWDA 4TX5A 5AQUB 4LF5T 1UX5A 1CHUA 1HX8A 3PUZG 3NRXA 2X9YA 1IAPA 3Q9DA 5HWXA 1M7KA 4QH5A 4DNDA 1BR2A 4ZI2D 4GKKT 4DV5T 4DR4T 3T1HT 1OEDC 1ZEEA 3ZMUB 3QNUA 1MMGA 4HGAA 3RPUA 4DMWA 3KV9A 5TAOA 2KSRA 2JIWA 4LFAT 1UK5A 2WB5A 2JJ9A 4XTCN 4YHHT 4LMLA 4PK6A 4OX9T 1GQEA 2J62A 1UURA 2L8KA 3CQGB 3ZCJA 1IBLT 2WWVA 3D0TA 2BS2A 4TNVA 1XDOA 2JQQA 4O2AE 4IDNA 5H6RB 3QB5K 5HEUA 1G73A 1JNRA 3IEEA 5HCMA 2EHOC 3SRZA 1D0XA 4UVBB 4EZHA 2BG9E 3ZKRA 1YD8G 1ZV4X 2W61A 4HFHA 3NZQA 1MMAA 2XAQB 3C4XA 4HWCA 1JNZA 4GYSA 4YJ2E 3AA1B 4UVAB 5LB7B 5AQPB 4GKJT 3P8CD 5HCJA 1X79A 3RLFG 5AQMB 2PJQA 2XAJB 5JQGE 1QLBA 2R6GF 3HL6A 4L9IA 4DV4T 3V5UA 3UU4A 4F8HA 2KT9A 3A5XA 3EUHA 3LG7A 5JVDE 3AAEB 1SHZC 4YLHA 3C98B 1W0AA 4QH1A 2WDRA 4EGWA 2H88A 4CXYA 4MFRA 2E9XD 4AQFA 4B3MT 3GMIA 1T98A 2HPLA 1J5WA 2CRBA 4DR2T 2DWGA 2RP4A 2UXCT 3OPCA 1SE7A 2X0YA 3C50A 1R8IA 1FMVA 4EB6E 4KX6A 3HR0A 3P4QA 1LVFA 3LFMA 2Q9QC 5L2LA 4NXNT 2CA5A 2NOXA 4TQUM 4Z8XA 2X0LB 1YXRA 2LE8A 5JDMA 4PFPA 4HWHA 3KVAA 3O4XE 1VRBA 2XUEA 2ZM0A 4YSXA 2FJBA 5LHIB 2C5JA 3P4WA 1KEYA 3ZN1B 3SOLA 3OJAA 5ABEA 4YMTB 4NUVA 3AE6A 4X66T 2X66A 3WAKA 1VOMA 1HS7A 5JDNA 3RKOA 5KDMC 4AQFC 3RGLA 1HTJF 3AB3B 5AQHB 2HN2A 3VU7H 4DMVA 3TLUA 3RYIE 3JADA 3WI3A 5IWAT 4ZZCA 1N36T 2LSKA 4P1NA 1O3XA 3AEGA 3TLSA 3KDSE 2DWKA 3B57A 4UELA 2CBJA 2XQ7A 3GN5B 4J2CA 5H6QB 2ZLYA 3M65A 5HWYA 2W0GA 2NP9A 5HXEA 4K0KT 2X51A 3I0QA 4PW8A 4AIUA 2JQ9A 4HFCA 3SS1A 1B7TA 1S35A 2LM2A 3JAEA 2BKOA 2X0HA 4MALA 2N1GA 4AKGA 3DTOA 5HEHA 1NEKA 5BMVE 2W00A 4JEUB 3LBXA 2CPTA 2LEHA 3VKGA 3VR8A 4GYRA 4LF7T 2CXDA 2LHNA 4XIGN 3ANWB 5LCYA 4TV9E 1YQ4A 3ZLIA 3MZKB 4HKAA 3EDVA 2YU1A 4UF0A 2IDOB 3P7IA 2XQ6A 3SWHA 3N9NA 3RIAA 3O1IA 2NTXA 4HFBA 2CEAA 2BDEA 1ZHCA 3U78A 4ASKA 2E5VA 4UV8B 3CQCB 5ETWA 2DHRA 4IDPA 1HG2A 4DV6T 4JYAT 5F3JA 3L8RA 4GK5E 3OKQA 1S94A 2BS3A 2KWHA 4CI2B 2QGSA 4DV2T 3CPZA 5JR9B 4KUMB 3KBTA 4YTNA 4YSYA 1W9RA 1HX1B 2WP9A 3WAJA 4ZI2C 3D31C 1D1CA 3H37A 3CX8B 3TLTA 3Q2MA 3QC9A 4CZZB 4ILAA 5AQIB 1XWMA 5AQVB 2JRKA 3ONXA 4QXHB 4YTMA 2WBLA 1YQ3A 1IJ5A 5HEGA 3ZPOA 2WMNA 1WR6A 5AQJB 3ETUA 2LHRA 2VKJA 3MA9A 4YMVC 3OYXA 3C4WA 2NW8A 2CXFA 3V5SA 3E08A 1W09A 3KFWX 1WYBA 3AE5A 5JDFA 5LOVE 5JR9A 4LMKA 4NIQA 4U3CA 4JI0T 2V7MA 4GOUA 4LF8T 3AE7A 2D0UA 3C4ZA 1SUMB 4UR9A 4KHZF 3UU8A 1MIYA 3OTOT 3ONLC 3ZYLA 3MXZA 3ZC0A 5AQKB 5LBQB 4XAXB 2XAFB 1HCIA 1T8BA 3OVUA 4PFOA 4A56A 4ZI7E 5FY0A 4X1IE 1Z0PA 4TWFA 3K3QC 2HHHT 4H9QC 2LRLA 3AEFA 3TLVA 4X62T 2VL8A 2YN6A 1UUSA 5HEOA 4CXXA 3PUGA 3UUMA 5AQFB 1OEDE 2KLQA 2V6YB 5JTGA 2ES0A 2DNXA 4E7ZA 1MMDA 1MNDA 2Y6XA 4IDOA 4DUYT 5J2UE 3G06A 5JREA 5GONE 4LF6T 4YXDA 3ZN0B 2W2UA 4B3TT 5ABHA 4DBRA 2E9XC 2XY8B 3S4UA 2IC9A 5FY7A 1E1HB 1KNZA
chains in the Genus database with same CATH topology
4KHZF 4KHZG 4JBWF 4XTCN 4JBWG 3PUYG 3PUYF 3PUVF 3PUVG 4XTCM 3DHWA 2ONKC 3RLFF 3RLFG 4YMTB 3TUZA 4XIGN 4YMSC 3PUZF 3D31C 3PUXF 3TUJA 3PUZG 2R6GF 2R6GG 4XIGM 3PUXG 3PUWF 3PUWG 4YMWC 3PV0F 3PV0G 4KI0G 4KI0F 4TQUN 3TUIA 4YMUC 4TQUM 4YMVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ F;  4KHZ G;  4JBW F;  4XTC N;  4JBW G;  3PUY G;  3PUY F;  3PUV F;  3PUV G;  4XTC M;  3DHW A;  2ONK C;  3RLF F;  3RLF G;  4YMT B;  3TUZ A;  4XIG N;  4YMS C;  3PUZ F;  3D31 C;  3PUX F;  3TUJ A;  3PUZ G;  2R6G F;  2R6G G;  4XIG M;  3PUX G;  3PUW F;  3PUW G;  4YMW C;  3PV0 F;  3PV0 G;  4KI0 G;  4KI0 F;  4TQU N;  3TUI A;  4YMU C;  4TQU M;  4YMV C; 
#chains in the Genus database with same CATH topology
 2CLY B;  1MNE A;  2DI4 A;  3EDU A;  4FJO A;  4QWN B;  5EK4 A;  4ZOL E;  4UXN B;  4WBN E;  4TNW A;  5LGU B;  2V7K A;  3QUJ A;  5JRC B;  1XMO T;  2CWO A;  4KHZ G;  3EAB A;  3AA7 B;  3O1H A;  5FVK A;  2V6Y A;  1LVK A;  3RLF F;  3HKB E;  3RRW A;  5KXJ A;  3SFD A;  2G0U A;  4HFD A;  2N2N A;  2H7V C;  5E0O A;  2BG9 B;  2BVM A;  1XDP A;  2L3L A;  1YW0 A;  3RQW A;  1AJ3 A;  2HH7 A;  5AFU L;  5FP3 A;  2C0S A;  2LLY A;  3A8Y C;  2VKD A;  2X9X A;  3RHW A;  4ISS A;  3ZJ2 A;  4X65 T;  3HKD E;  2KIN B;  4EYU A;  4DV3 T;  4ZS3 A;  3UUL A;  2YDQ A;  2JMH A;  4IIJ E;  2H89 A;  4YMU C;  2Q9Q B;  2XAH B;  5LGT B;  4DR7 T;  1E7P A;  1M62 A;  2QVA A;  1ZOY A;  3JC6 D;  5AQQ B;  3UU3 A;  2MBG A;  3X1D A;  3TKL B;  3NVO A;  4V1A v;  2YOE A;  3HA4 A;  1OWA A;  3RKG A;  4AIS A;  4M1P A;  5C2T A;  1WR0 A;  4JUY A;  1KFY A;  3KVB A;  3FZL B;  1HG5 A;  5CB4 E;  4I43 B;  3ZYM A;  3KV5 A;  3RIU A;  2XAS B;  5ADX L;  2H7O A;  4IE7 A;  4ILB A;  3ZT5 A;  2WWU A;  2UU9 T;  5DAB A;  3PV0 G;  2BZB A;  3KBU A;  3PUQ A;  4ZHQ E;  2QRX A;  3VHL A;  4YFS A;  3QB5 A;  1YKH B;  3BQI A;  1MIV A;  4O4I E;  3PJA A;  3ABV A;  2L9Q A;  5LHH B;  4IE0 A;  3ZMZ B;  2W62 A;  2PG8 A;  3AA0 B;  3DP7 A;  5AQL B;  5L3D B;  3N9M A;  4H9O C;  1QUU A;  2V7L A;  2V6X A;  3W15 B;  3FZK B;  4JI8 T;  3LSV A;  4IT4 A;  3I9W A;  3MJX A;  2YDR A;  2J1D G;  2E2A A;  4IL4 A;  4CN4 A;  4MHC A;  3PUS A;  3PJA J;  5LJN A;  5CJ5 A;  2ZM2 A;  4C91 A;  2PTF A;  4O2B E;  4OYK A;  2XSB A;  3VRA A;  4B3R T;  2M67 A;  4HEA A;  2C5K T;  4H63 H;  4NUU A;  3P4R A;  5FYM A;  3E0Z A;  5L3B B;  1ZP0 A;  3AE8 A;  3ZMV B;  2F4V T;  2VWA A;  3Q5W A;  3ZYK A;  3J9X 1;  4ZI3 C;  4OFZ A;  2YIN A;  2XM2 A;  4XTC M;  4PK4 A;  2LM9 A;  2BVL A;  3PUR A;  4JI1 T;  3EHZ A;  1XNR T;  2FUP A;  4IGU A;  3CWZ B;  4U7I A;  4JI7 T;  2IW5 B;  4EZ4 A;  1EZ3 A;  3K3N A;  1FMW A;  3AEC A;  3AED A;  5C8Y E;  2QYW A;  2YDS A;  4H9N C;  2I6H A;  4U72 A;  1QSD A;  3ZC1 A;  1WYC A;  2IIU A;  4IE6 A;  4JI6 T;  5L3F B;  2XQY A;  2D0T A;  4LFC T;  2WU2 A;  2KWI B;  4P09 A;  3AA6 B;  3R6N A;  4B6X A;  1G8X A;  2CCQ A;  4BAY B;  2UXB T;  3K3O A;  3GWH A;  2ACZ A;  4KI0 G;  3J7Y q;  2Z6E A;  3BK9 A;  2BKP A;  2A2F X;  3AAI A;  3RQU A;  4C90 A;  2CHO A;  2LT3 A;  4AQY T;  2J47 A;  5LHG B;  2WZH A;  3UU5 A;  4YMS C;  5KX5 E;  4NXM T;  4AQG A;  3TUJ A;  4DO0 A;  2NWB A;  2X9W A;  2KZ7 B;  1Y01 A;  2WU5 A;  4YY3 T;  4WW0 A;  1WRD A;  3FZM B;  1V9D A;  3AVS A;  4Z90 A;  4I0U A;  2BKN A;  1Z8U A;  2V5D A;  1LRZ A;  4Z91 A;  4GIW A;  3UQ4 A;  1Y64 B;  3IF8 B;  4TWD A;  2JQH A;  4JV5 T;  1NAF A;  3CX7 B;  2RA1 A;  4AI6 A;  5ABF B;  2B76 A;  2V7J A;  5LMU T;  3AVR A;  3NKZ A;  1T72 A;  2IML A;  5LGN B;  4EV6 A;  1WFD A;  3AAA B;  4X20 E;  4AKL A;  3GN5 A;  4EED A;  1L0V A;  4EIW A;  1UCU A;  4PJM A;  4DID B;  3AXJ B;  4E7S A;  3ZT6 A;  2V5C A;  5LP6 E;  5L3E B;  4ZI3 D;  2VKO A;  2MTQ A;  5FKY A;  3E22 E;  1US7 B;  3LJC A;  4DVD A;  1HNX T;  3DJB A;  3L39 A;  3ZMS B;  1VCT A;  3PDY A;  5J2T E;  3N9O A;  2A9U A;  1FJG T;  3N5L A;  3UUX B;  3UUN A;  2N9D A;  4X1K E;  1IJ6 A;  5L4H A;  2VK9 A;  2I0M A;  4AXP A;  2ZMA A;  1KK7 A;  1N33 T;  3EVY A;  4K0U A;  5ABG A;  4P0B A;  1HNZ T;  2IAK A;  3H3A A;  5M4Y A;  3ANW A;  3KIN B;  4PK5 A;  4O4L E;  2XQ9 A;  4BJN A;  4EOZ B;  2P9B A;  5LG3 A;  1D0Z A;  2MPK A;  3AEA A;  2XQ3 A;  2V7I A;  3IA3 A;  4IST A;  5AQR B;  3FHN A;  2NW9 A;  4ANJ A;  1OED B;  3L09 A;  3O1J A;  3N2K E;  4YHJ A;  4CN1 A;  4OK0 A;  3JC6 C;  2X67 A;  4U33 A;  2YEV C;  2LOP A;  4ZZB A;  5F5W A;  3I9Y A;  3ZT7 A;  4IDQ A;  3PUY G;  4QKN A;  5HEJ A;  3PUA A;  2VKH A;  5J1G A;  2FJD A;  4IHJ E;  2K5B B;  5JH7 E;  4JI3 T;  2XSA A;  4DR3 T;  3PUX F;  2PBI A;  3RH3 A;  3ETV A;  4UV9 B;  4HWF A;  1VCS A;  3QOF A;  2MOZ A;  3UU6 A;  2CHN A;  4O8S A;  4JI2 T;  2IHR 1;  3L3P A;  2FJE A;  2WAU A;  4PNI A;  4H9R C;  4XIG M;  4EXT A;  2EHO B;  2JMK A;  4WBO A;  2J4G A;  5HXH A;  3PUV F;  4JEH B;  2ONK C;  2LOS A;  5J0Z A;  2E8I A;  3EAM A;  2VQE T;  4H9S E;  3LK2 B;  4TV8 E;  4A5X A;  2LKG A;  1U5P A;  4EEB A;  1FIO A;  1MIW A;  2VUR A;  2WSS V;  5JR9 C;  2M6I A;  2JPF A;  3RYC E;  3U3I A;  4YTP A;  1IBK T;  4HFV A;  4PAG A;  1UX4 A;  3RIF A;  5FXZ A;  4QX7 B;  4AKR B;  2LJL A;  2VVS A;  5FMN A;  4KBM B;  4F6R C;  3PV0 F;  1HFA A;  5FNV E;  5AQT B;  3PU3 A;  1N32 T;  4HFE A;  3N2O A;  2LSG A;  1SA0 E;  2BBH A;  2XZE A;  5C3J A;  2EHO A;  4GK0 E;  2XQ4 A;  4IE5 A;  5KMG P;  4LF9 T;  3PUX G;  3MK7 C;  4DR5 T;  2ZM8 A;  4U74 A;  3N9L A;  3QK6 A;  3MAC A;  3CK6 A;  1ZKE A;  5FXV A;  2UXN B;  3T8O A;  3I1A A;  2D5U A;  5HXR A;  5IYZ E;  1BR0 A;  5LXT E;  4B3S T;  2XQA A;  4TQU N;  3ZCI A;  3RC3 A;  2CM0 A;  2A3D A;  4MLK A;  5FL0 A;  4ILU A;  4A97 A;  4P0A A;  3ZJ1 A;  3UTK A;  3PUV G;  5JRC A;  3CX6 B;  3B13 A;  3T1Y T;  4UEM A;  4X64 T;  4CI1 B;  2DCF A;  4YMW C;  5CA1 E;  4DUZ T;  3CQX C;  3C51 A;  3SFE A;  2UUC T;  3IHR A;  3JCF A;  4AKH A;  3RI5 A;  2BG9 A;  2VB6 A;  4COF A;  2WZI A;  3M3Z B;  1YKE B;  2I59 A;  4XBF B;  1LKX A;  2X68 A;  4QXC B;  3KV6 A;  3ZEF B;  3AE1 A;  4A98 A;  4JI5 T;  2LRK A;  5HXS A;  5JDH A;  2Q9Q A;  3C64 A;  3N9P A;  4ZXL A;  2OV9 A;  3CML A;  5EK3 A;  1KNP A;  2CLY C;  4YJ3 E;  2K24 A;  4WYV A;  4U2Z A;  5HYA A;  4HTE A;  5DQW A;  4I50 E;  1J1J A;  3KV4 A;  2CE7 A;  2E5L T;  1NEN A;  5FL1 A;  2Y8D A;  1D1A A;  4EYY R;  4WZX A;  4IRE A;  2M6B A;  2Y48 B;  4DV7 T;  3B5M A;  4KI0 F;  2A72 A;  4BA9 A;  4TZ4 C;  2X9H A;  4QX8 B;  5L47 A;  4LMJ A;  2AXD S;  2UUA T;  2DL1 A;  3FXD B;  3FBZ A;  2BG9 C;  4O4H E;  5LNK A;  4HFI A;  3RIU C;  2XAG B;  1UGO A;  2KND A;  1X9B A;  5AQN B;  3N2G E;  2XJ7 A;  2HPJ A;  2W67 A;  2V26 A;  4KP3 C;  5JDQ A;  4ERR A;  5LBM A;  3AE4 A;  3FZF B;  2ACX A;  3AEE A;  4NPP A;  3A7M A;  4HWI B;  3HKC E;  2ZM6 T;  5HAX A;  5LJM A;  1KF6 A;  2XQ5 A;  5CFB A;  4G63 A;  5CGM A;  1XNQ T;  2NW7 A;  2DLR A;  3OYZ A;  3ZMT B;  4CQI A;  5A1L A;  3UT5 E;  3RF1 A;  4DV0 T;  2IUB A;  3RYH E;  4G2A A;  5LG4 A;  3FZH B;  4FI5 A;  3LK4 2;  2LSY A;  4QHO A;  4H63 V;  4PJJ A;  1DU2 A;  4L5G A;  3PU8 A;  4TUY E;  2WCA A;  1OXZ A;  4OYJ A;  5BR8 T;  3R84 B;  3AEB A;  1U4Q A;  3NRY A;  2OLT A;  5L4E A;  2R6G G;  2D2S A;  4ZEY A;  3K8P C;  2WQY A;  3RC8 A;  2EHO D;  4I55 E;  4KHP T;  4JLE A;  3UUB A;  3F2E A;  3CKD A;  2WDQ A;  2UXX B;  2V8S V;  2VVN A;  3RX6 A;  3LBX B;  4ILC A;  2H3R A;  4OHF A;  3O9X A;  1NWM X;  1D0Y A;  4DV1 T;  3FB2 A;  2W63 A;  3JAF A;  2LSI A;  4UF0 B;  2XM1 A;  4IE4 A;  2QA7 A;  4PJL A;  2D9D A;  2HN1 A;  4O4J E;  4KMC A;  4QH4 A;  5FVL A;  2V1D B;  3VRB A;  2ODV A;  5L3G B;  3UFE A;  2WMO A;  5HXC A;  3AE9 A;  1HNW T;  4XZC A;  3F31 A;  5FXX A;  3NBX X;  1I6Z A;  4TN7 B;  4DR6 T;  2XQ8 A;  2YKS A;  1BR4 A;  5FXW A;  5EK2 A;  2AE9 A;  2K3W A;  2W66 A;  2LSJ A;  4IL9 A;  5DJQ C;  2MYS A;  1WCR A;  3AE2 A;  2B1E A;  2WS3 A;  4TWH A;  1XMQ T;  4BJM A;  3PUY F;  3TLW A;  3F57 A;  4ADZ A;  4YT0 A;  4N78 D;  3PUW F;  3K1S A;  2CWY A;  3VR9 A;  5F8P A;  5JDL A;  2BBJ A;  4MBQ A;  5AQG B;  4JBW F;  4HN9 A;  2JQK A;  4CN6 A;  2Q9Q D;  5LA6 E;  3EI0 A;  2VQF T;  2SPC A;  4L0R A;  5DQV A;  1FEW A;  4I4T E;  1CUN A;  3GA8 A;  1J5E T;  1N34 T;  4DBQ A;  5ABF A;  3FXE B;  2E9X B;  1I94 T;  2NTY A;  3Q5D A;  5AQO B;  4EAH A;  2XHE B;  4U31 A;  4Q25 A;  1XZY A;  5CA0 E;  3HKE E;  3UFG A;  2FBW A;  2LKH A;  1BR1 A;  3AXJ A;  4YSZ A;  1HR0 T;  1H7C A;  4AKI A;  2C5I T;  2XTL A;  4X1Y E;  3UQ7 A;  2YU2 A;  4WNK A;  3BQL A;  2OA5 A;  4U7Y A;  3NWI A;  2CMR A;  2WM9 A;  4CXW A;  5JDG A;  2PFV A;  3P4S A;  3OBV E;  5LMN T;  1T7S A;  2XPK A;  3CIR A;  2RPA A;  3HI2 A;  2VL0 A;  3DHW A;  4LFB T;  3AE3 A;  2GK9 A;  3TUZ A;  3H3M A;  4H9P C;  3PUZ F;  4UIG A;  2E9X A;  2NR4 A;  2CXL A;  2VAS A;  3PUW G;  4QXB B;  1E2A A;  1WLX A;  4PJN A;  4UVC B;  2BS4 A;  4HE8 A;  4JBW G;  1IBM T;  3Q5X A;  1HF8 A;  4DR1 T;  1D1B A;  5AQS B;  3P50 A;  3PE0 A;  2KXP B;  2UXD T;  5L3C B;  2W4X A;  3PTR B;  3N9Q A;  2CBI A;  3TUI A;  2FJA A;  2IC6 A;  2ODU A;  3ZST A;  1OED A;  1KNR A;  2YK0 A;  2WY2 A;  3ONJ A;  5IUX A;  4CI3 B;  3I0O A;  3ESL A;  3RYF E;  3IBP A;  2WDV A;  3FBL A;  5EZY E;  4JI4 T;  1IZN B;  5IHY A;  3Q5E A;  1W0B A;  4X5T A;  2KMF A;  5FY1 A;  3BQK A;  4IDZ A;  3CVR A;  3LDQ B;  2MAW A;  5LYJ E;  3LK3 B;  4LF4 T;  3VKH A;  1MMN A;  4U2Y A;  3NZP A;  2UUB T;  3RRC A;  4ZS2 A;  3ZSS A;  2K48 A;  3P4P A;  2K9A A;  3MKD A;  4HWD A;  4TX5 A;  5AQU B;  4LF5 T;  1UX5 A;  1CHU A;  1HX8 A;  3PUZ G;  3NRX A;  2X9Y A;  1IAP A;  3Q9D A;  5HWX A;  1M7K A;  4QH5 A;  4DND A;  1BR2 A;  4ZI2 D;  4GKK T;  4DV5 T;  4DR4 T;  3T1H T;  1OED C;  1ZEE A;  3ZMU B;  3QNU A;  1MMG A;  4HGA A;  3RPU A;  4DMW A;  3KV9 A;  5TAO A;  2KSR A;  2JIW A;  4LFA T;  1UK5 A;  2WB5 A;  2JJ9 A;  4XTC N;  4YHH T;  4LML A;  4PK6 A;  4OX9 T;  1GQE A;  2J62 A;  1UUR A;  2L8K A;  3CQG B;  3ZCJ A;  1IBL T;  2WWV A;  3D0T A;  2BS2 A;  4TNV A;  1XDO A;  2JQQ A;  4O2A E;  4IDN A;  5H6R B;  3QB5 K;  5HEU A;  1G73 A;  1JNR A;  3IEE A;  5HCM A;  2EHO C;  3SRZ A;  1D0X A;  4UVB B;  4EZH A;  2BG9 E;  3ZKR A;  1YD8 G;  1ZV4 X;  2W61 A;  4HFH A;  3NZQ A;  1MMA A;  2XAQ B;  3C4X A;  4HWC A;  1JNZ A;  4GYS A;  4YJ2 E;  3AA1 B;  4UVA B;  5LB7 B;  5AQP B;  4GKJ T;  3P8C D;  5HCJ A;  1X79 A;  3RLF G;  5AQM B;  2PJQ A;  2XAJ B;  5JQG E;  1QLB A;  2R6G F;  3HL6 A;  4L9I A;  4DV4 T;  3V5U A;  3UU4 A;  4F8H A;  2KT9 A;  3A5X A;  3EUH A;  3LG7 A;  5JVD E;  3AAE B;  1SHZ C;  4YLH A;  3C98 B;  1W0A A;  4QH1 A;  2WDR A;  4EGW A;  2H88 A;  4CXY A;  4MFR A;  2E9X D;  4AQF A;  4B3M T;  3GMI A;  1T98 A;  2HPL A;  1J5W A;  2CRB A;  4DR2 T;  2DWG A;  2RP4 A;  2UXC T;  3OPC A;  1SE7 A;  2X0Y A;  3C50 A;  1R8I A;  1FMV A;  4EB6 E;  4KX6 A;  3HR0 A;  3P4Q A;  1LVF A;  3LFM A;  2Q9Q C;  5L2L A;  4NXN T;  2CA5 A;  2NOX A;  4TQU M;  4Z8X A;  2X0L B;  1YXR A;  2LE8 A;  5JDM A;  4PFP A;  4HWH A;  3KVA A;  3O4X E;  1VRB A;  2XUE A;  2ZM0 A;  4YSX A;  2FJB A;  5LHI B;  2C5J A;  3P4W A;  1KEY A;  3ZN1 B;  3SOL A;  3OJA A;  5ABE A;  4YMT B;  4NUV A;  3AE6 A;  4X66 T;  2X66 A;  3WAK A;  1VOM A;  1HS7 A;  5JDN A;  3RKO A;  5KDM C;  4AQF C;  3RGL A;  1HTJ F;  3AB3 B;  5AQH B;  2HN2 A;  3VU7 H;  4DMV A;  3TLU A;  3RYI E;  3JAD A;  3WI3 A;  5IWA T;  4ZZC A;  1N36 T;  2LSK A;  4P1N A;  1O3X A;  3AEG A;  3TLS A;  3KDS E;  2DWK A;  3B57 A;  4UEL A;  2CBJ A;  2XQ7 A;  3GN5 B;  4J2C A;  5H6Q B;  2ZLY A;  3M65 A;  5HWY A;  2W0G A;  2NP9 A;  5HXE A;  4K0K T;  2X51 A;  3I0Q A;  4PW8 A;  4AIU A;  2JQ9 A;  4HFC A;  3SS1 A;  1B7T A;  1S35 A;  2LM2 A;  3JAE A;  2BKO A;  2X0H A;  4MAL A;  2N1G A;  4AKG A;  3DTO A;  5HEH A;  1NEK A;  5BMV E;  2W00 A;  4JEU B;  3LBX A;  2CPT A;  2LEH A;  3VKG A;  3VR8 A;  4GYR A;  4LF7 T;  2CXD A;  2LHN A;  4XIG N;  3ANW B;  5LCY A;  4TV9 E;  1YQ4 A;  3ZLI A;  3MZK B;  4HKA A;  3EDV A;  2YU1 A;  4UF0 A;  2IDO B;  3P7I A;  2XQ6 A;  3SWH A;  3N9N A;  3RIA A;  3O1I A;  2NTX A;  4HFB A;  2CEA A;  2BDE A;  1ZHC A;  3U78 A;  4ASK A;  2E5V A;  4UV8 B;  3CQC B;  5ETW A;  2DHR A;  4IDP A;  1HG2 A;  4DV6 T;  4JYA T;  5F3J A;  3L8R A;  4GK5 E;  3OKQ A;  1S94 A;  2BS3 A;  2KWH A;  4CI2 B;  2QGS A;  4DV2 T;  3CPZ A;  5JR9 B;  4KUM B;  3KBT A;  4YTN A;  4YSY A;  1W9R A;  1HX1 B;  2WP9 A;  3WAJ A;  4ZI2 C;  3D31 C;  1D1C A;  3H37 A;  3CX8 B;  3TLT A;  3Q2M A;  3QC9 A;  4CZZ B;  4ILA A;  5AQI B;  1XWM A;  5AQV B;  2JRK A;  3ONX A;  4QXH B;  4YTM A;  2WBL A;  1YQ3 A;  1IJ5 A;  5HEG A;  3ZPO A;  2WMN A;  1WR6 A;  5AQJ B;  3ETU A;  2LHR A;  2VKJ A;  3MA9 A;  4YMV C;  3OYX A;  3C4W A;  2NW8 A;  2CXF A;  3V5S A;  3E08 A;  1W09 A;  3KFW X;  1WYB A;  3AE5 A;  5JDF A;  5LOV E;  5JR9 A;  4LMK A;  4NIQ A;  4U3C A;  4JI0 T;  2V7M A;  4GOU A;  4LF8 T;  3AE7 A;  2D0U A;  3C4Z A;  1SUM B;  4UR9 A;  4KHZ F;  3UU8 A;  1MIY A;  3OTO T;  3ONL C;  3ZYL A;  3MXZ A;  3ZC0 A;  5AQK B;  5LBQ B;  4XAX B;  2XAF B;  1HCI A;  1T8B A;  3OVU A;  4PFO A;  4A56 A;  4ZI7 E;  5FY0 A;  4X1I E;  1Z0P A;  4TWF A;  3K3Q C;  2HHH T;  4H9Q C;  2LRL A;  3AEF A;  3TLV A;  4X62 T;  2VL8 A;  2YN6 A;  1UUS A;  5HEO A;  4CXX A;  3PUG A;  3UUM A;  5AQF B;  1OED E;  2KLQ A;  2V6Y B;  5JTG A;  2ES0 A;  2DNX A;  4E7Z A;  1MMD A;  1MND A;  2Y6X A;  4IDO A;  4DUY T;  5J2U E;  3G06 A;  5JRE A;  5GON E;  4LF6 T;  4YXD A;  3ZN0 B;  2W2U A;  4B3T T;  5ABH A;  4DBR A;  2E9X C;  2XY8 B;  3S4U A;  2IC9 A;  5FY7 A;  1E1H B;  1KNZ A; 
#chains in the Genus database with same CATH homology
 4KHZ F;  4KHZ G;  4JBW F;  4XTC N;  4JBW G;  3PUY G;  3PUY F;  3PUV F;  3PUV G;  4XTC M;  3DHW A;  2ONK C;  3RLF F;  3RLF G;  4YMT B;  3TUZ A;  4XIG N;  4YMS C;  3PUZ F;  3D31 C;  3PUX F;  3TUJ A;  3PUZ G;  2R6G F;  2R6G G;  4XIG M;  3PUX G;  3PUW F;  3PUW G;  4YMW C;  3PV0 F;  3PV0 G;  4KI0 G;  4KI0 F;  4TQU N;  3TUI A;  4YMU C;  4TQU M;  4YMV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...