4KHZF

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
488
structure length
483
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
total genus 143
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4khzF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4khzF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4khzF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4khzF02
3PUWG 3PUYG 4JBWF 4KHZF 4YMSC 4TQUN 2R6GF 4XTCN 3PV0G 3RLFF 3D31C 2ONKC 3PUXG 3PUVF 3PUZF 3TUZA 4JBWG 4TQUM 4XIGN 4YMUC 4KI0F 4YMWC 4KHZG 3PUWF 2R6GG 4XTCM 3PUYF 3RLFG 3TUJA 4YMVC 4YMTB 3DHWA 3PUVG 3PUZG 3TUIA 4XIGM 3PV0F 4KI0G 3PUXF
chains in the Genus database with same CATH superfamily
1OEDE 5KDMC 4ZS2A 3RYIE 2XQ8A 1OEDB 4DR2T 4YLHA 2PJQA 4C91A 5LHHB 4ERRA 4DBQA 4TN7B 3UUMA 3O1HA 3ONXA 2BKNA 3WI3A 1N34T 3TLSA 2YKSA 3PUQA 3TUZA 3FBLA 5DJQC 1I94T 2CBJA 2X9HA 3LK3B 3N9NA 1HNZT 2BS2A 3VRAA 5L3EB 3Q5XA 5JRCA 2NP9A 4M1PA 3UU4A 3P4SA 4B3ST 2YU2A 4L5GA 1JNRA 4UF0A 2LM9A 4QXBB 3NWIA 4X5TA 5AQTB 5FKYA 3ZC0A 3PUVF 4KI0F 2WZIA 4EB6E 5J2UE 4QH5A 4YJ3E 5J1GA 3ZYMA 2KLQA 2SPCA 4B3RT 3LBXA 3RRWA 3KFWX 5LB7B 3RYCE 4TUYE 2KT9A 4AKHA 3CX7B 5JR9C 1ZHCA 2K3WA 4YT0A 1ZEEA 3IBPA 2E5VA 2WSSV 2WS3A 2L3LA 4DBRA 2D5UA 2LKGA 2X0LB 4IDPA 3V5UA 3FXEB 1FIOA 2JRKA 3CIRA 5CB4E 3JAEA 2NTYA 3AE1A 2YOEA 4IE6A 4H9SE 4TWFA 4O2AE 1UGOA 5L3DB 2WBLA 4GOUA 2CXLA 2BS3A 1DU2A 2YDSA 3R6NA 2V1DB 3UU3A 1T72A 5EK4A 1MIWA 4U3CA 2BVLA 5C3JA 2E5LT 4LF7T 2A72A 4AQGA 3VKHA 1WCRA 2XTLA 4EZHA 4YMWC 2KZ7B 2H7OA 4X1IE 3TUJA 2E9XC 3B57A 2PG8A 2LEHA 2QYWA 5AQIB 1MNDA 5HEOA 5LMUT 2ZMAA 2Q9QA 2XASB 3HI2A 3I0QA 4CN6A 3DJBA 3H37A 4CN1A 3BK9A 1T8BA 5HXEA 1G8XA 5LOVE 4HFEA 1G73A 2MAWA 1HTJF 2V7JA 3N2KE 2WWVA 2XAJB 4JEHB 3I1AA 2K24A 3KBTA 1QUUA 4IDNA 4EYYR 5L4EA 5LJMA 3RYHE 3P50A 5AQRB 2UXNB 4HFCA 3IEEA 2V6YA 3RX6A 5LBQB 5HEGA 3QOFA 4I55E 5A1LA 3ZC1A 1SUMB 5ABEA 3UQ4A 2VQET 2Z6EA 2I59A 3PUXF 1VCTA 2FJDA 4IDZA 4NXNT 4QH1A 3U78A 3N9PA 4IT4A 4AIUA 4E7ZA 3BQKA 3RI5A 2JMHA 1Z0PA 5LYJE 5ABFB 3ZYKA 2XAFB 1EZ3A 2QGSA 1HS7A 4XAXB 2BVMA 1MMNA 1XMQT 2BBHA 2BG9B 5JDNA 2FBWA 2VL8A 3Q5DA 3QK6A 3AVRA 3PU3A 1IBKT 5JH7E 3N2OA 4DR3T 2IMLA 2C0SA 3F31A 1N33T 4QXCB 4X62T 1IBLT 2QRXA 4TV8E 1D1AA 2MOZA 3IF8B 4Z91A 2X9XA 4EGWA 3QUJA 4ANJA 5HWYA 2WY2A 2E2AA 3P4RA 3ETUA 5FYMA 4DR5T 3PUAA 4UVAB 2KWIB 3ZEFB 2N2NA 3LJCA 2W63A 2XQ4A 3ANWB 3RQWA 3NZQA 2DLRA 5JTGA 2M67A 5LGTB 4ZI3D 2WQYA 2BDEA 2H3RA 4DV5T 1N36T 1S35A 5L3CB 1FMVA 5HEHA 3AEFA 5KXJA 4UIGA 4COFA 1J5WA 3UFGA 2WAUA 2W62A 4EEDA 2N9DA 2JPFA 3ETVA 4H63H 3HKCE 3AAIA 3VR9A 3ZSSA 5JR9A 4U2YA 4LF5T 4UELA 3C4XA 5F8PA 4HFBA 2B76A 3CQCB 4I43B 2ACZA 1IZNB 3JC6D 3TLWA 3AEDA 4PNIA 3NRYA 2LE8A 3OTOT 3GN5B 5AQLB 3A8YC 4JI2T 3C64A 5L3GB 1KNZA 2X9WA 3JADA 4IGUA 2BKOA 3K3OA 3N5LA 2J62A 2WDVA 3EHZA 3OYXA 2X0YA 3Q9DA 4DR1T 3M3ZB 5EK2A 2FJBA 1D1BA 3OKQA 3LSVA 2E9XD 2E9XA 4EZ4A 2WU2A 1M62A 3C4WA 2XQYA 3I9YA 2VK9A 2YN6A 3PV0G 3D31C 5IYZE 5AQKB 4V1Av 2XHEB 2XQ7A 3VKGA 2EHOC 1JNZA 2XQ9A 3VRBA 4WNKA 2M6IA 2CPTA 2JMKA 1E2AA 3RPUA 1UUSA 2XAGB 2ODVA 2KMFA 3PURA 3ZMUB 2Q9QB 3HKEE 4DV7T 3CX8B 5KMGP 2WB5A 2BBJA 4IIJE 2VL0A 4P1NA 3CQXC 2X67A 3P7IA 3MK7C 2A2FX 3GWHA 3P4QA 2CHOA 2PBIA 1T98A 3RIFA 4JUYA 1OEDC 1KF6A 2BS4A 1KFYA 3S4UA 2LSYA 4DUYT 4LMJA 2ODUA 2IC9A 3FZMB 2WU5A 4DV4T 3ZT6A 3EABA 1HCIA 3O1IA 4YHJA 4CXXA 3RQUA 4ZOLE 1GQEA 5FXVA 1XWMA 2V7MA 3PUVG 2M6BA 4KI0G 3SS1A 1B7TA 2P9BA 3B13A 4WBNE 3TLUA 3CKDA 2CRBA 2KXPB 1D0XA 4DV6T 2NW7A 4LF8T 3FXDB 1D0YA 4JI5T 3ZLIA 2DCFA 4HFVA 2OA5A 3TKLB 1N32T 4PAGA 3EI0A 3CMLA 3T1HT 5ABGA 5LXTE 1MMAA 3AAAB 2VKDA 2VVNA 5EZYE 4JI7T 5M4YA 4HWFA 4ZI3C 4YSXA 2H89A 5HXSA 4XIGM 4AKLA 3Q5EA 4LFBT 5DQVA 2V5CA 3ZT7A 4K0UA 2DWKA 1YKEB 2PFVA 2IIUA 1MIYA 2ZM2A 4QKNA 4WBOA 4EYUA 4ISTA 4IHJE 1X79A 3KDSE 4ZZBA 3SWHA 2CXFA 2JJ9A 3UU6A 4HFIA 2DHRA 4LMKA 3M65A 4YY3T 4KHZF 4BAYB 2I0MA 1YQ4A 3OBVE 1KNRA 4P0BA 1WFDA 2XSBA 4XTCM 2N1GA 3UT5E 2HH7A 3UU8A 2W61A 2J4GA 3AXJA 3A7MA 3K3QC 4BJMA 2Y8DA 3EDVA 3B5MA 4YMSC 4CXWA 2HPLA 3CVRA 3JC6C 2JQHA 4ADZA 3KINB 1VCSA 1MNEA 5AQFB 3EUHA 3PJAA 4ASKA 3HL6A 5J0ZA 1NEKA 3RH3A 3PTRB 2XQ6A 5L3FB 1YQ3A 2C5JA 4ILBA 3RC3A 3AE5A 3BQIA 3RYFE 2X0HA 3H3AA 4GIWA 3NVOA 4AQFC 5JDQA 3AEAA 3LG7A 3N2GE 5L47A 3NBXX 3KVBA 3SRZA 3RKGA 2VASA 4TZ4C 1I6ZA 1YKHB 5FY7A 2CEAA 4GK5E 1S94A 1HNWT 1W9RA 1OWAA 5FMNA 3PUXG 2DNXA 2MYSA 1YD8G 5LA6E 4KP3C 2YINA 4ZI7E 4DV1T 4H9OC 4IE4A 4DV0T 1WYCA 4OYKA 4IL9A 4TQUN 4PJNA 2ACXA 1FJGT 3AVSA 5HEJA 4G2AA 2VURA 2LOPA 2C5IT 2NW9A 1XMOT 3NRXA 1T7SA 2HN2A 5LG4A 2H7VC 2MTQA 1HX1B 2DL1A 2FJEA 2EHOD 2EHOA 3QB5K 3MJXA 5FXWA 4EV6A 1O3XA 3H3MA 5F5WA 4ZS3A 5FVLA 1KNPA 4UV9B 4YTNA 4PJLA 1IAPA 4EIWA 2LKHA 2K9AA 4JBWF 5LCYA 2IHR1 2WCAA 4IDQA 4O4JE 4C90A 1ZKEA 4QX7B 3AECA 2VKHA 3P4PA 4CI3B 5HWXA 2W2UA 1HF8A 4A56A 2WMOA 4IE0A 3AE3A 5C8YE 1OEDA 3RHWA 1KEYA 2ZM0A 4I0UA 3K1SA 5LHIB 4J2CA 2BG9E 3N9QA 1IBMT 2XQAA 3Q5WA 2PTFA 4ZZCA 1R8IA 3G06A 3LK2B 2CCQA 4X1YE 4YSYA 2XY8B 2LOSA 2UXBT 5FL0A 2L8KA 1WYBA 4WW0A 4XZCA 1HR0T 3UUBA 2K5BB 3DTOA 2QA7A 4HN9A 5L4HA 3U3IA 4P0AA 5AQGB 5FNVE 1UURA 2D9DA 5ABHA 4P09A 4GYSA 2VQFT 3ZPOA 1D1CA 3LDQB 1NENA 4XTCN 2LRKA 4OK0A 3OYZA 2V8SV 3J9X1 5GONE 4MALA 3UUNA 5CFBA 1L0VA 3AB3B 2IAKA 3UULA 4DO0A 4YJ2E 1D0ZA 4KMCA 3IHRA 1QSDA 2FJAA 2LM2A 4DV2T 1SE7A 1IJ6A 4G63A 5AQSB 2DWGA 4DR4T 2CM0A 1Y64B 2E8IA 5HXCA 2J47A 3AA0B 4GK0E 3LFMA 3KVAA 2CWYA 2RA1A 2LT3A 4CXYA 1VOMA 1BR1A 2XM1A 4YFSA 3UU5A 4UV8B 5J2TE 5JREA 5CA1E 3AEBA 2V7KA 5JRCB 4EXTA 3EDUA 4A5XA 2IW5B 4UF0B 5ETWA 3JCFA 5LP6E 1LKXA 4HFDA 4NPPA 3EAMA 4IL4A 3NZPA 4YHHT 1XZYA 1U4QA 4UXNB 2B1EA 3RLFF 2XZEA 3LBXB 3AA1B 3HA4A 1Y01A 4PFPA 2LLYA 3L39A 3DP7A 3PUYF 4DMWA 1XDOA 3OPCA 1KK7A 4YXDA 4L0RA 3DHWA 4PK5A 3N9OA 2DI4A 1WRDA 3ZKRA 2WZHA 4HWHA 5LHGB 2D0UA 5CA0E 3FHNA 2XQ3A 3AEEA 5AQOB 5BMVE 3PUWF 4YTMA 3RRCA 3AE9A 3ESLA 4AQFA 5FXXA 1J5ET 4MHCA 4F6RC 5LBMA 1Z8UA 1YXRA 4L9IA 3FB2A 4HE8A 4X66T 1LRZA 5FY1A 4JV5T 1XDPA 4X20E 4CI2B 5AQNB 3AE8A 5AQPB 3MACA 3O1JA 4DUZT 2CLYB 1UX5A 3GA8A 2WWUA 1UX4A 4Z90A 3RF1A 4ZI2D 2D2SA 3L3PA 4U72A 4GYRA 4H9QC 2UXCT 1UCUA 3ZCJA 4B3MT 2ES0A 4F8HA 4ZEYA 4H63V 3AA6B 2Y6XA 2UXDT 3ZMSB 4LF4T 4A97A 1E7PA 3FZHB 5ABFA 4MBQA 4PFOA 2UUAT 4Q25A 2IUBA 5AFUL 3X1DA 2NR4A 2X9YA 3AE4A 4DR7T 3PUSA 4QXHB 4UEMA 3KV6A 4NIQA 5AQQB 5H6RB 2OV9A 4WYVA 2W0GA 4LFCT 4OFZA 3AE2A 3RGLA 2LHNA 2V6YB 2V5DA 3LK42 3NKZA 2WP9A 5LJNA 3N9MA 4JLEA 4H9RC 3A5XA 4UR9A 4AXPA 2UUBT 5AQVB 4DIDB 1BR4A 2D0TA 4KHZG 4PW8A 4KX6A 4TWHA 2CMRA 5LG3A 1HNXT 3ANWA 2CHNA 2R6GF 5HAXA 3HR0A 3AAEB 2CBIA 4TX5A 3PUZF 4TWDA 4O4IE 3TLTA 5H6QB 2LHRA 1US7B 3E0ZA 5CGMA 3RIUC 4ISSA 1WR0A 3UQ7A 5DABA 5DQWA 4Z8XA 2AXDS 3I0OA 2VB6A 2QVAA 1BR2A 4JI1T 5FXZA 2LSJA 1UK5A 4EEBA 4JI8T 4JYAT 5ADXL 5LGUB 2HN1A 4IDOA 2W00A 5L2LA 3T8OA 4KHPT 4U74A 4MFRA 1W09A 1XNRT 3GN5A 3GMIA 3OJAA 3ONJA 4X65T 3HKBE 3WAKA 3KV9A 2XPKA 3P4WA 2K48A 4YSZA 3ZN1B 1CUNA 3PE0A 3PUGA 3C51A 2VWAA 1XNQT 3AE7A 4YMUC 2CE7A 2CWOA 4E7SA 4CZZB 4JI0T 5JDMA 2XAHB 2V6XA 4OHFA 4ILUA 4O4LE 3E22E 3Q2MA 5EK3A 4JI6T 1SHZC 2UU9T 2XSAA 3MA9A 4TV9E 4UVCB 2VKOA 1FMWA 5JR9B 3AA7B 2Y48B 1OXZA 1MMDA 5LGNB 4A98A 4KBMB 5C2TA 2W67A 4JBWG 4JI4T 4OX9T 2MPKA 1W0AA 4ZI2C 2YDRA 4IE7A 2JIWA 4DVDA 3CX6B 1ZOYA 3O4XE 5JDGA 2Q9QD 5AQHB 1QLBA 2LSIA 2RPAA 4AI6A 4HWIB 3C98B 4O2BE 4U7YA 4B6XA 5JVDE 4BA9A 4HGAA 3UFEA 3I9WA 3CWZB 3QB5A 2ZM6T 1VRBA 3QC9A 4NXMT 2IDOB 2AE9A 3K8PC 4U31A 3ZN0B 2MBGA 4LF9T 1WLXA 2E9XB 2BG9C 3MZKB 4PK6A 4H9NC 4JI3T 4OYJA 3CPZA 5IHYA 2X66A 2YEVC 2KINB 2NW8A 3D0TA 5LNKA 2KNDA 2WDQA 3N9LA 3R84B 4U7IA 4HWCA 2LJLA 3OVUA 2YU1A 1AJ3A 4WZXA 5TAOA 3KBUA 4I4TE 2V7LA 2V7IA 3RKOA 5HCJA 3ZT5A 4NUUA 4TNVA 4YTPA 5HXRA 4XIGN 3UTKA 4QWNB 2ZLYA 4O4HE 2FUPA 2HHHT 2CXDA 2J1DG 2VVSA 1HX8A 1H7CA 2WMNA 3TLVA 5JDLA 2ONKC 2VKJA 5HEUA 4DNDA 2OLTA 2I6HA 1V9DA 3CK6A 2GK9A 1J1JA 5FVKA 3BQLA 1MIVA 5F3JA 5FL1A 4AISA 4NUVA 5JDHA 1BR0A 5IWAT 4FI5A 4HFHA 4GKJT 4ILCA 3RLFG 2KSRA 3SOLA 4YMVC 4I50E 1ZV4X 4ILAA 4IREA 2KWHA 4CI1B 3PUYG 4PJMA 3P8CD 1MMGA 4HEAA 1HG5A 2C5KT 3PJAJ 3ONLC 3MXZA 1NAFA 5AQMB 4KUMB 4HKAA 3ZYLA 3RIUA 3FZFB 4ZHQE 2X51A 5FY0A 4YMTB 1YW0A 2UXXB 5JQGE 3PUWG 1HFAA 5FP3A 2L9QA 3EVYA 3ZMVB 1U5PA 5CJ5A 4UVBB 1NWMX 3CQGB 2W66A 1IJ5A 4H9PC 2BZBA 2RP4A 3TUIA 4AKRB 4DMVA 3ZSTA 3C50A 3HKDE 2ZM8A 4AQYT 3FZLB 2A9UA 4QH4A 4U2ZA 4EOZB 4CN4A 4JEUB 1WR6A 2CLYC 5HYAA 2F4VT 4QX8B 4TNWA 3PU8A 3AXJB 4O8SA 3SFDA 2G0UA 2IC6A 4LFAT 2Q9QC 3MKDA 2V26A 2JQQA 4BJNA 3ZJ1A 3ZCIA 2CA5A 3C4ZA 3JAFA 4EAHA 3UUXB 3T1YT 3WAJA 4QHOA 4CQIA 5LMNT 3FZKB 3VR8A 2BKPA 3F2EA 4FJOA 1FEWA 3ZMTB 3L09A 3QNUA 3IA3A 5HXHA 1LVKA 5JDFA 5BR8T 2HPJA 2NTXA 1E1HB 3AE6A 3RIAA 2X68A 2YK0A 4IE5A 4N78D 3KV4A 2A3DA 3ZJ2A 4DR6T 3L8RA 2LSGA 3K3NA 1W0BA 4PJJA 2XQ5A 2JQ9A 4DV3T 4B3TT 4U33A 4LF6T 3W15B 2NWBA 3ZMZB 4X1KE 3VU7H 3KV5A 2NOXA 2XAQB 4MLKA 2W4XA 3E08A 2H88A 2LRLA 2XUEA 2LSKA 4AKIA 2R6GG 3RC8A 2YDQA 1M7KA 4PK4A 3PUZG 1HG2A 3F57A 2XM2A 1SA0E 3FBZA 2BG9A 3AEGA 5L3BB 2UUCT 2WDRA 3J7Yq 5AQJB 4HWDA 5IUXA 1CHUA 4ZXLA 4X64T 2JQKA 2XJ7A 4TQUM 3O9XA 1X9BA 3V5SA 3SFEA 2EHOB 5HCMA 3VHLA 4AKGA 5AQUB 3PV0F 4LMLA 1ZP0A 4HTEA 3ABVA 5KX5E 4GKKT 5E0OA 1LVFA 2WM9A 4XBFB 3PDYA 4K0KT
chains in the Genus database with same CATH topology
3PUWG 3PUYG 4JBWF 4KHZF 4YMSC 4TQUN 2R6GF 4XTCN 3PV0G 3RLFF 3D31C 2ONKC 3PUXG 3PUVF 3PUZF 3TUZA 4JBWG 4TQUM 4XIGN 4YMUC 4KI0F 4YMWC 4KHZG 3PUWF 2R6GG 4XTCM 3PUYF 3RLFG 3TUJA 4YMVC 4YMTB 3DHWA 3PUVG 3PUZG 3TUIA 4XIGM 3PV0F 4KI0G 3PUXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUW G;  3PUY G;  4JBW F;  4KHZ F;  4YMS C;  4TQU N;  2R6G F;  4XTC N;  3PV0 G;  3RLF F;  3D31 C;  2ONK C;  3PUX G;  3PUV F;  3PUZ F;  3TUZ A;  4JBW G;  4TQU M;  4XIG N;  4YMU C;  4KI0 F;  4YMW C;  4KHZ G;  3PUW F;  2R6G G;  4XTC M;  3PUY F;  3RLF G;  3TUJ A;  4YMV C;  4YMT B;  3DHW A;  3PUV G;  3PUZ G;  3TUI A;  4XIG M;  3PV0 F;  4KI0 G;  3PUX F; 
#chains in the Genus database with same CATH topology
 1OED E;  5KDM C;  4ZS2 A;  3RYI E;  2XQ8 A;  1OED B;  4DR2 T;  4YLH A;  2PJQ A;  4C91 A;  5LHH B;  4ERR A;  4DBQ A;  4TN7 B;  3UUM A;  3O1H A;  3ONX A;  2BKN A;  3WI3 A;  1N34 T;  3TLS A;  2YKS A;  3PUQ A;  3TUZ A;  3FBL A;  5DJQ C;  1I94 T;  2CBJ A;  2X9H A;  3LK3 B;  3N9N A;  1HNZ T;  2BS2 A;  3VRA A;  5L3E B;  3Q5X A;  5JRC A;  2NP9 A;  4M1P A;  3UU4 A;  3P4S A;  4B3S T;  2YU2 A;  4L5G A;  1JNR A;  4UF0 A;  2LM9 A;  4QXB B;  3NWI A;  4X5T A;  5AQT B;  5FKY A;  3ZC0 A;  3PUV F;  4KI0 F;  2WZI A;  4EB6 E;  5J2U E;  4QH5 A;  4YJ3 E;  5J1G A;  3ZYM A;  2KLQ A;  2SPC A;  4B3R T;  3LBX A;  3RRW A;  3KFW X;  5LB7 B;  3RYC E;  4TUY E;  2KT9 A;  4AKH A;  3CX7 B;  5JR9 C;  1ZHC A;  2K3W A;  4YT0 A;  1ZEE A;  3IBP A;  2E5V A;  2WSS V;  2WS3 A;  2L3L A;  4DBR A;  2D5U A;  2LKG A;  2X0L B;  4IDP A;  3V5U A;  3FXE B;  1FIO A;  2JRK A;  3CIR A;  5CB4 E;  3JAE A;  2NTY A;  3AE1 A;  2YOE A;  4IE6 A;  4H9S E;  4TWF A;  4O2A E;  1UGO A;  5L3D B;  2WBL A;  4GOU A;  2CXL A;  2BS3 A;  1DU2 A;  2YDS A;  3R6N A;  2V1D B;  3UU3 A;  1T72 A;  5EK4 A;  1MIW A;  4U3C A;  2BVL A;  5C3J A;  2E5L T;  4LF7 T;  2A72 A;  4AQG A;  3VKH A;  1WCR A;  2XTL A;  4EZH A;  4YMW C;  2KZ7 B;  2H7O A;  4X1I E;  3TUJ A;  2E9X C;  3B57 A;  2PG8 A;  2LEH A;  2QYW A;  5AQI B;  1MND A;  5HEO A;  5LMU T;  2ZMA A;  2Q9Q A;  2XAS B;  3HI2 A;  3I0Q A;  4CN6 A;  3DJB A;  3H37 A;  4CN1 A;  3BK9 A;  1T8B A;  5HXE A;  1G8X A;  5LOV E;  4HFE A;  1G73 A;  2MAW A;  1HTJ F;  2V7J A;  3N2K E;  2WWV A;  2XAJ B;  4JEH B;  3I1A A;  2K24 A;  3KBT A;  1QUU A;  4IDN A;  4EYY R;  5L4E A;  5LJM A;  3RYH E;  3P50 A;  5AQR B;  2UXN B;  4HFC A;  3IEE A;  2V6Y A;  3RX6 A;  5LBQ B;  5HEG A;  3QOF A;  4I55 E;  5A1L A;  3ZC1 A;  1SUM B;  5ABE A;  3UQ4 A;  2VQE T;  2Z6E A;  2I59 A;  3PUX F;  1VCT A;  2FJD A;  4IDZ A;  4NXN T;  4QH1 A;  3U78 A;  3N9P A;  4IT4 A;  4AIU A;  4E7Z A;  3BQK A;  3RI5 A;  2JMH A;  1Z0P A;  5LYJ E;  5ABF B;  3ZYK A;  2XAF B;  1EZ3 A;  2QGS A;  1HS7 A;  4XAX B;  2BVM A;  1MMN A;  1XMQ T;  2BBH A;  2BG9 B;  5JDN A;  2FBW A;  2VL8 A;  3Q5D A;  3QK6 A;  3AVR A;  3PU3 A;  1IBK T;  5JH7 E;  3N2O A;  4DR3 T;  2IML A;  2C0S A;  3F31 A;  1N33 T;  4QXC B;  4X62 T;  1IBL T;  2QRX A;  4TV8 E;  1D1A A;  2MOZ A;  3IF8 B;  4Z91 A;  2X9X A;  4EGW A;  3QUJ A;  4ANJ A;  5HWY A;  2WY2 A;  2E2A A;  3P4R A;  3ETU A;  5FYM A;  4DR5 T;  3PUA A;  4UVA B;  2KWI B;  3ZEF B;  2N2N A;  3LJC A;  2W63 A;  2XQ4 A;  3ANW B;  3RQW A;  3NZQ A;  2DLR A;  5JTG A;  2M67 A;  5LGT B;  4ZI3 D;  2WQY A;  2BDE A;  2H3R A;  4DV5 T;  1N36 T;  1S35 A;  5L3C B;  1FMV A;  5HEH A;  3AEF A;  5KXJ A;  4UIG A;  4COF A;  1J5W A;  3UFG A;  2WAU A;  2W62 A;  4EED A;  2N9D A;  2JPF A;  3ETV A;  4H63 H;  3HKC E;  3AAI A;  3VR9 A;  3ZSS A;  5JR9 A;  4U2Y A;  4LF5 T;  4UEL A;  3C4X A;  5F8P A;  4HFB A;  2B76 A;  3CQC B;  4I43 B;  2ACZ A;  1IZN B;  3JC6 D;  3TLW A;  3AED A;  4PNI A;  3NRY A;  2LE8 A;  3OTO T;  3GN5 B;  5AQL B;  3A8Y C;  4JI2 T;  3C64 A;  5L3G B;  1KNZ A;  2X9W A;  3JAD A;  4IGU A;  2BKO A;  3K3O A;  3N5L A;  2J62 A;  2WDV A;  3EHZ A;  3OYX A;  2X0Y A;  3Q9D A;  4DR1 T;  3M3Z B;  5EK2 A;  2FJB A;  1D1B A;  3OKQ A;  3LSV A;  2E9X D;  2E9X A;  4EZ4 A;  2WU2 A;  1M62 A;  3C4W A;  2XQY A;  3I9Y A;  2VK9 A;  2YN6 A;  3PV0 G;  3D31 C;  5IYZ E;  5AQK B;  4V1A v;  2XHE B;  2XQ7 A;  3VKG A;  2EHO C;  1JNZ A;  2XQ9 A;  3VRB A;  4WNK A;  2M6I A;  2CPT A;  2JMK A;  1E2A A;  3RPU A;  1UUS A;  2XAG B;  2ODV A;  2KMF A;  3PUR A;  3ZMU B;  2Q9Q B;  3HKE E;  4DV7 T;  3CX8 B;  5KMG P;  2WB5 A;  2BBJ A;  4IIJ E;  2VL0 A;  4P1N A;  3CQX C;  2X67 A;  3P7I A;  3MK7 C;  2A2F X;  3GWH A;  3P4Q A;  2CHO A;  2PBI A;  1T98 A;  3RIF A;  4JUY A;  1OED C;  1KF6 A;  2BS4 A;  1KFY A;  3S4U A;  2LSY A;  4DUY T;  4LMJ A;  2ODU A;  2IC9 A;  3FZM B;  2WU5 A;  4DV4 T;  3ZT6 A;  3EAB A;  1HCI A;  3O1I A;  4YHJ A;  4CXX A;  3RQU A;  4ZOL E;  1GQE A;  5FXV A;  1XWM A;  2V7M A;  3PUV G;  2M6B A;  4KI0 G;  3SS1 A;  1B7T A;  2P9B A;  3B13 A;  4WBN E;  3TLU A;  3CKD A;  2CRB A;  2KXP B;  1D0X A;  4DV6 T;  2NW7 A;  4LF8 T;  3FXD B;  1D0Y A;  4JI5 T;  3ZLI A;  2DCF A;  4HFV A;  2OA5 A;  3TKL B;  1N32 T;  4PAG A;  3EI0 A;  3CML A;  3T1H T;  5ABG A;  5LXT E;  1MMA A;  3AAA B;  2VKD A;  2VVN A;  5EZY E;  4JI7 T;  5M4Y A;  4HWF A;  4ZI3 C;  4YSX A;  2H89 A;  5HXS A;  4XIG M;  4AKL A;  3Q5E A;  4LFB T;  5DQV A;  2V5C A;  3ZT7 A;  4K0U A;  2DWK A;  1YKE B;  2PFV A;  2IIU A;  1MIY A;  2ZM2 A;  4QKN A;  4WBO A;  4EYU A;  4IST A;  4IHJ E;  1X79 A;  3KDS E;  4ZZB A;  3SWH A;  2CXF A;  2JJ9 A;  3UU6 A;  4HFI A;  2DHR A;  4LMK A;  3M65 A;  4YY3 T;  4KHZ F;  4BAY B;  2I0M A;  1YQ4 A;  3OBV E;  1KNR A;  4P0B A;  1WFD A;  2XSB A;  4XTC M;  2N1G A;  3UT5 E;  2HH7 A;  3UU8 A;  2W61 A;  2J4G A;  3AXJ A;  3A7M A;  3K3Q C;  4BJM A;  2Y8D A;  3EDV A;  3B5M A;  4YMS C;  4CXW A;  2HPL A;  3CVR A;  3JC6 C;  2JQH A;  4ADZ A;  3KIN B;  1VCS A;  1MNE A;  5AQF B;  3EUH A;  3PJA A;  4ASK A;  3HL6 A;  5J0Z A;  1NEK A;  3RH3 A;  3PTR B;  2XQ6 A;  5L3F B;  1YQ3 A;  2C5J A;  4ILB A;  3RC3 A;  3AE5 A;  3BQI A;  3RYF E;  2X0H A;  3H3A A;  4GIW A;  3NVO A;  4AQF C;  5JDQ A;  3AEA A;  3LG7 A;  3N2G E;  5L47 A;  3NBX X;  3KVB A;  3SRZ A;  3RKG A;  2VAS A;  4TZ4 C;  1I6Z A;  1YKH B;  5FY7 A;  2CEA A;  4GK5 E;  1S94 A;  1HNW T;  1W9R A;  1OWA A;  5FMN A;  3PUX G;  2DNX A;  2MYS A;  1YD8 G;  5LA6 E;  4KP3 C;  2YIN A;  4ZI7 E;  4DV1 T;  4H9O C;  4IE4 A;  4DV0 T;  1WYC A;  4OYK A;  4IL9 A;  4TQU N;  4PJN A;  2ACX A;  1FJG T;  3AVS A;  5HEJ A;  4G2A A;  2VUR A;  2LOP A;  2C5I T;  2NW9 A;  1XMO T;  3NRX A;  1T7S A;  2HN2 A;  5LG4 A;  2H7V C;  2MTQ A;  1HX1 B;  2DL1 A;  2FJE A;  2EHO D;  2EHO A;  3QB5 K;  3MJX A;  5FXW A;  4EV6 A;  1O3X A;  3H3M A;  5F5W A;  4ZS3 A;  5FVL A;  1KNP A;  4UV9 B;  4YTN A;  4PJL A;  1IAP A;  4EIW A;  2LKH A;  2K9A A;  4JBW F;  5LCY A;  2IHR 1;  2WCA A;  4IDQ A;  4O4J E;  4C90 A;  1ZKE A;  4QX7 B;  3AEC A;  2VKH A;  3P4P A;  4CI3 B;  5HWX A;  2W2U A;  1HF8 A;  4A56 A;  2WMO A;  4IE0 A;  3AE3 A;  5C8Y E;  1OED A;  3RHW A;  1KEY A;  2ZM0 A;  4I0U A;  3K1S A;  5LHI B;  4J2C A;  2BG9 E;  3N9Q A;  1IBM T;  2XQA A;  3Q5W A;  2PTF A;  4ZZC A;  1R8I A;  3G06 A;  3LK2 B;  2CCQ A;  4X1Y E;  4YSY A;  2XY8 B;  2LOS A;  2UXB T;  5FL0 A;  2L8K A;  1WYB A;  4WW0 A;  4XZC A;  1HR0 T;  3UUB A;  2K5B B;  3DTO A;  2QA7 A;  4HN9 A;  5L4H A;  3U3I A;  4P0A A;  5AQG B;  5FNV E;  1UUR A;  2D9D A;  5ABH A;  4P09 A;  4GYS A;  2VQF T;  3ZPO A;  1D1C A;  3LDQ B;  1NEN A;  4XTC N;  2LRK A;  4OK0 A;  3OYZ A;  2V8S V;  3J9X 1;  5GON E;  4MAL A;  3UUN A;  5CFB A;  1L0V A;  3AB3 B;  2IAK A;  3UUL A;  4DO0 A;  4YJ2 E;  1D0Z A;  4KMC A;  3IHR A;  1QSD A;  2FJA A;  2LM2 A;  4DV2 T;  1SE7 A;  1IJ6 A;  4G63 A;  5AQS B;  2DWG A;  4DR4 T;  2CM0 A;  1Y64 B;  2E8I A;  5HXC A;  2J47 A;  3AA0 B;  4GK0 E;  3LFM A;  3KVA A;  2CWY A;  2RA1 A;  2LT3 A;  4CXY A;  1VOM A;  1BR1 A;  2XM1 A;  4YFS A;  3UU5 A;  4UV8 B;  5J2T E;  5JRE A;  5CA1 E;  3AEB A;  2V7K A;  5JRC B;  4EXT A;  3EDU A;  4A5X A;  2IW5 B;  4UF0 B;  5ETW A;  3JCF A;  5LP6 E;  1LKX A;  4HFD A;  4NPP A;  3EAM A;  4IL4 A;  3NZP A;  4YHH T;  1XZY A;  1U4Q A;  4UXN B;  2B1E A;  3RLF F;  2XZE A;  3LBX B;  3AA1 B;  3HA4 A;  1Y01 A;  4PFP A;  2LLY A;  3L39 A;  3DP7 A;  3PUY F;  4DMW A;  1XDO A;  3OPC A;  1KK7 A;  4YXD A;  4L0R A;  3DHW A;  4PK5 A;  3N9O A;  2DI4 A;  1WRD A;  3ZKR A;  2WZH A;  4HWH A;  5LHG B;  2D0U A;  5CA0 E;  3FHN A;  2XQ3 A;  3AEE A;  5AQO B;  5BMV E;  3PUW F;  4YTM A;  3RRC A;  3AE9 A;  3ESL A;  4AQF A;  5FXX A;  1J5E T;  4MHC A;  4F6R C;  5LBM A;  1Z8U A;  1YXR A;  4L9I A;  3FB2 A;  4HE8 A;  4X66 T;  1LRZ A;  5FY1 A;  4JV5 T;  1XDP A;  4X20 E;  4CI2 B;  5AQN B;  3AE8 A;  5AQP B;  3MAC A;  3O1J A;  4DUZ T;  2CLY B;  1UX5 A;  3GA8 A;  2WWU A;  1UX4 A;  4Z90 A;  3RF1 A;  4ZI2 D;  2D2S A;  3L3P A;  4U72 A;  4GYR A;  4H9Q C;  2UXC T;  1UCU A;  3ZCJ A;  4B3M T;  2ES0 A;  4F8H A;  4ZEY A;  4H63 V;  3AA6 B;  2Y6X A;  2UXD T;  3ZMS B;  4LF4 T;  4A97 A;  1E7P A;  3FZH B;  5ABF A;  4MBQ A;  4PFO A;  2UUA T;  4Q25 A;  2IUB A;  5AFU L;  3X1D A;  2NR4 A;  2X9Y A;  3AE4 A;  4DR7 T;  3PUS A;  4QXH B;  4UEM A;  3KV6 A;  4NIQ A;  5AQQ B;  5H6R B;  2OV9 A;  4WYV A;  2W0G A;  4LFC T;  4OFZ A;  3AE2 A;  3RGL A;  2LHN A;  2V6Y B;  2V5D A;  3LK4 2;  3NKZ A;  2WP9 A;  5LJN A;  3N9M A;  4JLE A;  4H9R C;  3A5X A;  4UR9 A;  4AXP A;  2UUB T;  5AQV B;  4DID B;  1BR4 A;  2D0T A;  4KHZ G;  4PW8 A;  4KX6 A;  4TWH A;  2CMR A;  5LG3 A;  1HNX T;  3ANW A;  2CHN A;  2R6G F;  5HAX A;  3HR0 A;  3AAE B;  2CBI A;  4TX5 A;  3PUZ F;  4TWD A;  4O4I E;  3TLT A;  5H6Q B;  2LHR A;  1US7 B;  3E0Z A;  5CGM A;  3RIU C;  4ISS A;  1WR0 A;  3UQ7 A;  5DAB A;  5DQW A;  4Z8X A;  2AXD S;  3I0O A;  2VB6 A;  2QVA A;  1BR2 A;  4JI1 T;  5FXZ A;  2LSJ A;  1UK5 A;  4EEB A;  4JI8 T;  4JYA T;  5ADX L;  5LGU B;  2HN1 A;  4IDO A;  2W00 A;  5L2L A;  3T8O A;  4KHP T;  4U74 A;  4MFR A;  1W09 A;  1XNR T;  3GN5 A;  3GMI A;  3OJA A;  3ONJ A;  4X65 T;  3HKB E;  3WAK A;  3KV9 A;  2XPK A;  3P4W A;  2K48 A;  4YSZ A;  3ZN1 B;  1CUN A;  3PE0 A;  3PUG A;  3C51 A;  2VWA A;  1XNQ T;  3AE7 A;  4YMU C;  2CE7 A;  2CWO A;  4E7S A;  4CZZ B;  4JI0 T;  5JDM A;  2XAH B;  2V6X A;  4OHF A;  4ILU A;  4O4L E;  3E22 E;  3Q2M A;  5EK3 A;  4JI6 T;  1SHZ C;  2UU9 T;  2XSA A;  3MA9 A;  4TV9 E;  4UVC B;  2VKO A;  1FMW A;  5JR9 B;  3AA7 B;  2Y48 B;  1OXZ A;  1MMD A;  5LGN B;  4A98 A;  4KBM B;  5C2T A;  2W67 A;  4JBW G;  4JI4 T;  4OX9 T;  2MPK A;  1W0A A;  4ZI2 C;  2YDR A;  4IE7 A;  2JIW A;  4DVD A;  3CX6 B;  1ZOY A;  3O4X E;  5JDG A;  2Q9Q D;  5AQH B;  1QLB A;  2LSI A;  2RPA A;  4AI6 A;  4HWI B;  3C98 B;  4O2B E;  4U7Y A;  4B6X A;  5JVD E;  4BA9 A;  4HGA A;  3UFE A;  3I9W A;  3CWZ B;  3QB5 A;  2ZM6 T;  1VRB A;  3QC9 A;  4NXM T;  2IDO B;  2AE9 A;  3K8P C;  4U31 A;  3ZN0 B;  2MBG A;  4LF9 T;  1WLX A;  2E9X B;  2BG9 C;  3MZK B;  4PK6 A;  4H9N C;  4JI3 T;  4OYJ A;  3CPZ A;  5IHY A;  2X66 A;  2YEV C;  2KIN B;  2NW8 A;  3D0T A;  5LNK A;  2KND A;  2WDQ A;  3N9L A;  3R84 B;  4U7I A;  4HWC A;  2LJL A;  3OVU A;  2YU1 A;  1AJ3 A;  4WZX A;  5TAO A;  3KBU A;  4I4T E;  2V7L A;  2V7I A;  3RKO A;  5HCJ A;  3ZT5 A;  4NUU A;  4TNV A;  4YTP A;  5HXR A;  4XIG N;  3UTK A;  4QWN B;  2ZLY A;  4O4H E;  2FUP A;  2HHH T;  2CXD A;  2J1D G;  2VVS A;  1HX8 A;  1H7C A;  2WMN A;  3TLV A;  5JDL A;  2ONK C;  2VKJ A;  5HEU A;  4DND A;  2OLT A;  2I6H A;  1V9D A;  3CK6 A;  2GK9 A;  1J1J A;  5FVK A;  3BQL A;  1MIV A;  5F3J A;  5FL1 A;  4AIS A;  4NUV A;  5JDH A;  1BR0 A;  5IWA T;  4FI5 A;  4HFH A;  4GKJ T;  4ILC A;  3RLF G;  2KSR A;  3SOL A;  4YMV C;  4I50 E;  1ZV4 X;  4ILA A;  4IRE A;  2KWH A;  4CI1 B;  3PUY G;  4PJM A;  3P8C D;  1MMG A;  4HEA A;  1HG5 A;  2C5K T;  3PJA J;  3ONL C;  3MXZ A;  1NAF A;  5AQM B;  4KUM B;  4HKA A;  3ZYL A;  3RIU A;  3FZF B;  4ZHQ E;  2X51 A;  5FY0 A;  4YMT B;  1YW0 A;  2UXX B;  5JQG E;  3PUW G;  1HFA A;  5FP3 A;  2L9Q A;  3EVY A;  3ZMV B;  1U5P A;  5CJ5 A;  4UVB B;  1NWM X;  3CQG B;  2W66 A;  1IJ5 A;  4H9P C;  2BZB A;  2RP4 A;  3TUI A;  4AKR B;  4DMV A;  3ZST A;  3C50 A;  3HKD E;  2ZM8 A;  4AQY T;  3FZL B;  2A9U A;  4QH4 A;  4U2Z A;  4EOZ B;  4CN4 A;  4JEU B;  1WR6 A;  2CLY C;  5HYA A;  2F4V T;  4QX8 B;  4TNW A;  3PU8 A;  3AXJ B;  4O8S A;  3SFD A;  2G0U A;  2IC6 A;  4LFA T;  2Q9Q C;  3MKD A;  2V26 A;  2JQQ A;  4BJN A;  3ZJ1 A;  3ZCI A;  2CA5 A;  3C4Z A;  3JAF A;  4EAH A;  3UUX B;  3T1Y T;  3WAJ A;  4QHO A;  4CQI A;  5LMN T;  3FZK B;  3VR8 A;  2BKP A;  3F2E A;  4FJO A;  1FEW A;  3ZMT B;  3L09 A;  3QNU A;  3IA3 A;  5HXH A;  1LVK A;  5JDF A;  5BR8 T;  2HPJ A;  2NTX A;  1E1H B;  3AE6 A;  3RIA A;  2X68 A;  2YK0 A;  4IE5 A;  4N78 D;  3KV4 A;  2A3D A;  3ZJ2 A;  4DR6 T;  3L8R A;  2LSG A;  3K3N A;  1W0B A;  4PJJ A;  2XQ5 A;  2JQ9 A;  4DV3 T;  4B3T T;  4U33 A;  4LF6 T;  3W15 B;  2NWB A;  3ZMZ B;  4X1K E;  3VU7 H;  3KV5 A;  2NOX A;  2XAQ B;  4MLK A;  2W4X A;  3E08 A;  2H88 A;  2LRL A;  2XUE A;  2LSK A;  4AKI A;  2R6G G;  3RC8 A;  2YDQ A;  1M7K A;  4PK4 A;  3PUZ G;  1HG2 A;  3F57 A;  2XM2 A;  1SA0 E;  3FBZ A;  2BG9 A;  3AEG A;  5L3B B;  2UUC T;  2WDR A;  3J7Y q;  5AQJ B;  4HWD A;  5IUX A;  1CHU A;  4ZXL A;  4X64 T;  2JQK A;  2XJ7 A;  4TQU M;  3O9X A;  1X9B A;  3V5S A;  3SFE A;  2EHO B;  5HCM A;  3VHL A;  4AKG A;  5AQU B;  3PV0 F;  4LML A;  1ZP0 A;  4HTE A;  3ABV A;  5KX5 E;  4GKK T;  5E0O A;  1LVF A;  2WM9 A;  4XBF B;  3PDY A;  4K0K T; 
#chains in the Genus database with same CATH homology
 3PUW G;  3PUY G;  4JBW F;  4KHZ F;  4YMS C;  4TQU N;  2R6G F;  4XTC N;  3PV0 G;  3RLF F;  3D31 C;  2ONK C;  3PUX G;  3PUV F;  3PUZ F;  3TUZ A;  4JBW G;  4TQU M;  4XIG N;  4YMU C;  4KI0 F;  4YMW C;  4KHZ G;  3PUW F;  2R6G G;  4XTC M;  3PUY F;  3RLF G;  3TUJ A;  4YMV C;  4YMT B;  3DHW A;  3PUV G;  3PUZ G;  3TUI A;  4XIG M;  3PV0 F;  4KI0 G;  3PUX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...