3PUYF

Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
total genus 142
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3puyF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3puyF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3puyF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3puyF02
4YMWC 3PUZF 4KI0G 3RLFG 4JBWG 4KHZG 3TUIA 3PUXG 3PUVG 3PUWG 3D31C 3PV0G 3PUYF 4YMVC 4TQUN 3TUJA 2R6GG 4YMTB 4TQUM 3TUZA 4XIGN 2ONKC 4JBWF 4KI0F 3RLFF 3PUXF 4YMSC 3PUZG 3PUVF 4KHZF 4XIGM 4XTCN 3PUWF 4YMUC 3PV0F 4XTCM 2R6GF 3DHWA 3PUYG
chains in the Genus database with same CATH superfamily
4PJNA 3PUZF 2DNXA 4EOZB 3ZC1A 4TV9E 2WAUA 4EB6E 1XNQT 2XASB 1XDPA 4DMWA 1NWMX 4ZI7E 5A1LA 4QKNA 5DABA 4N78D 2ZM6T 4CI2B 4UVCB 1KNRA 1WR6A 3HI2A 2NOXA 3SOLA 4PJLA 1XZYA 2IMLA 4A56A 3TUJA 4ILCA 1EZ3A 2V8SV 2CLYC 1S94A 4TZ4C 4JLEA 5EZYE 2WB5A 3FZKB 5CFBA 2MTQA 2XAJB 1MMNA 4PK6A 2WCAA 4LF7T 1LRZA 4AKIA 3MXZA 4QXHB 5L4EA 4F6RC 4YY3T 4KI0F 1T98A 4Z90A 2VQFT 4H9OC 3RKOA 4DMVA 5ABFA 4TV8E 4IDNA 2L3LA 4OYJA 2LSYA 1M62A 3F2EA 2XSBA 2HPJA 3TLVA 4QH5A 4JV5T 3N9QA 4U2ZA 4XIGM 3ZMZB 1LVKA 4X5TA 1G8XA 3P50A 3PUXG 3O1HA 1LVFA 3ZYMA 2VQET 3N9NA 1T8BA 1CHUA 4AKGA 5AQRB 3T8OA 2X9WA 4G63A 3L3PA 2LSKA 4NUVA 4JI3T 4L9IA 3ZMUB 2UU9T 4OYKA 4IE6A 4ZI2D 3UU3A 3TUIA 3NZPA 1N33T 5KMGP 4IDQA 3LFMA 2EHOD 3RRCA 1WRDA 2UXCT 2A9UA 3Q2MA 1HX8A 4JI1T 5AQNB 4ZS3A 4COFA 3EABA 4Z8XA 4ZS2A 2V6YB 4LF4T 4IDOA 3RLFG 3A8YC 4YJ3E 2A3DA 2P9BA 4KUMB 1WYCA 5CGMA 2QGSA 4LF9T 1W0BA 3KVAA 2K5BB 2CPTA 4XTCN 2DLRA 5HWXA 2VASA 2IC6A 2X0HA 1YD8G 3O1JA 2LJLA 3P4WA 1YQ3A 2N1GA 2WZHA 4IGUA 4I50E 4IE5A 3CIRA 2XAFB 4HFBA 3KV5A 5H6QB 2WZIA 4TNVA 5JDHA 3FHNA 3ZC0A 5FY1A 3JADA 4IT4A 4L0RA 2JQKA 5GONE 5HEHA 1L0VA 3UFEA 4JI0T 1BR4A 2KWHA 4KX6A 2H3RA 3GWHA 4DO0A 4EAHA 3FXDB 4X1KE 2ACZA 4EYYR 4GKJT 3Q5XA 4ZHQE 4FI5A 4PAGA 4NPPA 4JBWF 4HWFA 2WU2A 4KHZF 4JI5T 4YJ2E 1U4QA 3PV0F 2Y8DA 5M4YA 2VVSA 2RPAA 3EUHA 3ETUA 4P0BA 3AE3A 2J4GA 1D1CA 4K0KT 3TLSA 2WP9A 3RC3A 1UGOA 2VL8A 3P4PA 4EZHA 2LOPA 3MJXA 3LSVA 2Q9QC 2QA7A 1Z8UA 4TQUN 5IHYA 5HCJA 1HCIA 3Q5DA 2XPKA 3RF1A 4AKHA 2MBGA 4GKKT 2JMKA 2X51A 2VKOA 2SPCA 3ONJA 1WFDA 2LKGA 5AQFB 3PU3A 3UT5E 5LCYA 2X0YA 2J1DG 4LMLA 5HEUA 1UX4A 3U78A 3DP7A 2FJDA 4U2YA 3VKGA 3V5UA 2JRKA 5JDNA 4GIWA 3N9PA 2Y48B 2W00A 3ZT5A 3RRWA 5CA0E 3PE0A 3ETVA 3CQGB 3WAKA 2BKNA 1D0XA 2YN6A 1AJ3A 3QNUA 3FB2A 2B76A 4UF0B 3UU4A 1HNWT 4DBQA 2W2UA 2KNDA 3CX7B 4EEBA 2NW7A 2BDEA 5EK2A 3PUGA 4DV5T 4A5XA 1J5WA 4KBMB 1ZEEA 2PBIA 2XQ6A 3JAEA 3O9XA 3FBZA 5FXWA 3AAEB 3AEDA 2LLYA 3AE8A 3AE9A 2XY8B 5CA1E 3ZCJA 5BR8T 3M65A 4O2BE 4KHPT 3KV9A 2ZLYA 5JR9B 2A2FX 5KXJA 1T7SA 3I1AA 1IBLT 2X0LB 2YDRA 2KZ7B 2XAHB 4GK0E 3VKHA 4DV0T 4DR1T 4HFDA 3CQXC 3B57A 4WNKA 3P4QA 4GYSA 4JI8T 2R6GG 3UUXB 2BVLA 3VHLA 4YMUC 3UQ7A 2YU2A 2H7VC 5LOVE 4HWDA 2V1DB 2VVNA 3ZMVB 1CUNA 3PUAA 2FJAA 4JI7T 1SA0E 1G73A 2WMOA 4BJMA 1HS7A 3RQWA 3DTOA 3PUZG 3QUJA 4E7SA 4JI2T 5LGTB 2BS4A 2CEAA 4QXCB 2Q9QB 3AE2A 3V5SA 2XQ4A 2X66A 2LSJA 3PUSA 1QSDA 1R8IA 3VR8A 2LKHA 4P1NA 2NWBA 3AEFA 3CX8B 4XZCA 2OA5A 4AISA 1OEDE 2ODVA 2VKDA 2OV9A 3UUNA 4DR4T 4UF0A 1IJ6A 5KDMC 4PK4A 4O4IE 3O4XE 5ABFB 3ZSSA 2JMHA 2LRLA 4DR5T 4QX8B 3L8RA 2RA1A 4O8SA 1X9BA 3BQKA 2VKHA 4IE0A 2BG9E 5FVKA 2KWIB 3VRBA 3FZHB 4MLKA 4KI0G 3RYFE 4ZEYA 1MMAA 2I6HA 5JDLA 2YKSA 2WSSV 1FMVA 3ZN0B 5L3FB 3PUVF 4GK5E 4EV6A 3JCFA 4I4TE 2H7OA 2W63A 5LBMA 5L2LA 2RP4A 4GYRA 4HEAA 2A72A 5AQSB 3LK2B 2H89A 4YTNA 3E08A 3EDVA 4B3TT 5FL0A 2VK9A 2CXLA 4ERRA 3C50A 5LG4A 4M1PA 3MA9A 4IE7A 3DJBA 2XTLA 2NR4A 4B3MT 2WDVA 5LBQB 2MYSA 2N9DA 3UQ4A 1IZNB 2X9YA 4AQFC 5IWAT 5AQJB 1V9DA 3CK6A 4KMCA 3RPUA 2M67A 3RIFA 5HYAA 3PJAJ 3KBTA 1WCRA 3RIUC 3EAMA 5AFUL 3ZT7A 2W61A 5HXHA 2Q9QA 5IYZE 2M6IA 4XBFB 1ZP0A 2CMRA 4UR9A 2HHHT 2JQHA 2X67A 4WYVA 1FIOA 2KMFA 3PUQA 1YW0A 3SFEA 3PJAA 4IE4A 1KEYA 5FP3A 4H9RC 3OTOT 3LJCA 4EYUA 4ILAA 3A5XA 4UEMA 3QOFA 3OKQA 4ZI3C 4TNWA 2WBLA 2KSRA 3NZQA 3PDYA 5AQUB 4UVAB 2LSGA 3F57A 4OK0A 5J2TE 2V7KA 4UV9B 2XM2A 3OPCA 3ZEFB 3L09A 2K3WA 2CM0A 2C5KT 3VR9A 5FY7A 2LEHA 3IA3A 2BKPA 3AA0B 4YMWC 4DV1T 4ZZBA 4KHZG 4HWCA 2IUBA 1VCTA 3PV0G 5LMUT 4TQUM 1KK7A 2YEVC 2W0GA 5DQVA 5AQMB 4DR3T 4LMJA 2JPFA 4PJJA 2NTXA 3AB3B 2XSAA 2DHRA 3FZLB 4Z91A 4NUUA 5HEOA 3KINB 5HAXA 4ILUA 5LNKA 3I0QA 3PTRB 3D0TA 4X1YE 4ZI2C 3HKDE 5DQWA 2B1EA 5ABEA 3MACA 4DV2T 3KV6A 2XQ9A 3ZJ2A 4DIDB 2HN1A 4LF6T 2D9DA 4AKLA 4IDPA 1HNZT 2V7JA 2DI4A 3K3QC 3OBVE 4EXTA 5JVDE 4O4JE 4CI1B 4LF8T 1YKHB 3D31C 4HFHA 1N32T 1O3XA 5L47A 4YMSC 4LF5T 1MIWA 2YINA 4DR6T 1OXZA 4ISTA 2KLQA 3P4SA 3C4ZA 3HL6A 2NP9A 2X68A 4GOUA 4U33A 2DWKA 1E1HB 3AA6B 2D0TA 3ZN1B 4YMVC 2WDQA 3W15B 5AQVB 3AAIA 2CLYB 3RGLA 3N2OA 1D1AA 2UXNB 3AE7A 4YSZA 4WBOA 3MKDA 4DUYT 3G06A 3PUYF 1XMOT 4NXMT 3VRAA 4TN7B 3E22E 4IDZA 2F4VT 2WY2A 3PUXF 5LXTE 3LK42 5LJMA 3KV4A 3LG7A 4B6XA 2Q9QD 3NRYA 5LB7B 4XIGN 3E0ZA 4PW8A 5CB4E 3AE4A 3AEAA 3AAAB 2FUPA 3UUBA 4CXYA 2BZBA 2W4XA 2J62A 4HFEA 3I9YA 3PUWG 1J5ET 1ZKEA 4JUYA 5LJNA 4MALA 5FNVE 2ZM8A 3NBXX 4O4HE 4H9PC 4O4LE 4IL4A 5HEGA 2PFVA 2K9AA 3MZKB 2XAGB 2QVAA 3B13A 4CN1A 4HN9A 3ESLA 2BKOA 4AQFA 2NTYA 5AQKB 4G2AA 1IBKT 4CXWA 1U5PA 4MHCA 1SUMB 2LHNA 4TWFA 2VURA 4DV3T 1IBMT 1E2AA 2ZMAA 1QLBA 4EEDA 4H63H 5L4HA 3HKBE 2DCFA 4NIQA 3N9LA 5L3DB 1WYBA 3Q5EA 3ZT6A 3AA7B 1J1JA 3CMLA 3M3ZB 5F5WA 1HTJF 4TWDA 3K3OA 1KNZA 5E0OA 3AE1A 3C64A 2CA5A 4OHFA 2MOZA 4LMKA 4JEUB 2KINB 3LDQB 2WWUA 2E2AA 4JI6T 4ASKA 5JDMA 3P4RA 2I59A 3CQCB 2UUCT 4DUZT 3BQIA 2C5IT 3JC6D 1N34T 2XQ3A 1MNEA 4CN4A 3GN5B 4U72A 3CPZA 4X62T 4V1Av 4ZZCA 5C2TA 3Q5WA 4DV6T 4IREA 1OEDC 3FZFB 1YXRA 5ABGA 3K3NA 1W9RA 3GMIA 3S4UA 5FYMA 2M6BA 3AEGA 3SFDA 2CXFA 4YSXA 4H9NC 4BA9A 5L3GB 3L39A 1ZHCA 4Q25A 4PK5A 2X9XA 2XQ8A 2BG9C 4ZOLE 5JQGE 4PFOA 1X79A 5L3EB 5HCMA 3CX6B 3ABVA 2W62A 2YDQA 3RC8A 2YK0A 2QYWA 4ILBA 4QWNB 2PTFA 3H3AA 1HFAA 4X1IE 3C98B 3QC9A 1ZV4X 2XUEA 2E9XC 1IJ5A 2BBJA 2ACXA 4HFIA 4F8HA 2D2SA 1GQEA 3EDUA 5AQIB 1UCUA 3RYHE 4HFCA 4HE8A 2D5UA 3WI3A 5C8YE 2V7MA 4PNIA 5JTGA 3RI5A 4A97A 3TLTA 4JEHB 4HWIB 4MFRA 4MBQA 4HFVA 4YXDA 1YKEB 2L8KA 1WR0A 4PFPA 4QHOA 4I43B 1LKXA 2ODUA 3QB5A 2WMNA 4QH4A 3NWIA 1FMWA 2ZM0A 3R84B 2XQYA 5AQTB 1HG2A 4DBRA 3R6NA 4AI6A 2L9QA 4IIJE 5HXCA 3AEEA 5JDQA 2W66A 3ZPOA 2CBIA 2UXDT 3J7Yq 3GN5A 3HA4A 3AA1B 3IF8B 2R6GF 4U7IA 3EI0A 2JQ9A 3TKLB 5FY0A 2ES0A 2HN2A 2E5LT 5BMVE 4QH1A 3ANWB 3BK9A 3AEBA 2E8IA 4X20E 5JRCB 2VWAA 4H9SE 5TAOA 3EVYA 4XTCM 3DHWA 2D0UA 4WZXA 4U3CA 1B7TA 2Z6EA 4U74A 5FKYA 5FMNA 2XHEB 3ZMTB 3FZMB 2BS3A 1OEDB 2UXBT 1KNPA 4X65T 2CWOA 4QXBB 3P8CD 3RX6A 1MMGA 2V6XA 2UUAT 5LG3A 2AXDS 3HKEE 2WS3A 5JDGA 5LP6E 4LFAT 5AQGB 1KFYA 5J2UE 2XM1A 1NEKA 2BG9B 2LHRA 2LT3A 4H63V 3TLWA 1MIYA 1VCSA 2BVMA 5FXXA 1KF6A 5LHHB 4HTEA 4ZI3D 4DR7T 4LFCT 1IAPA 3IHRA 2CCQA 4TUYE 2V26A 3H37A 3CKDA 4CQIA 4UV8B 3SWHA 3TUZA 5HWYA 3KDSE 4WBNE 1NENA 4E7ZA 2LE8A 3P7IA 2XQAA 5FXVA 2WM9A 2E9XB 4JBWG 5ABHA 5F3JA 4DNDA 3N5LA 5AQOB 4P0AA 2E5VA 1D1BA 4K0UA 2JJ9A 3PUYG 2LSIA 5LGNB 3LK3B 5CJ5A 2CWYA 3AE5A 4I0UA 4XAXB 3UU8A 2PJQA 4YHHT 1W0AA 1SE7A 2XQ7A 3ANWA 3WAJA 4HKAA 2XQ5A 4EIWA 5C3JA 4NXNT 4UVBB 5JRCA 3JAFA 2CHNA 5AQQB 1E7PA 1N36T 5HXSA 4X66T 3LBXB 2X9HA 3RYIE 2EHOC 2WU5A 2MPKA 3RHWA 3UTKA 3A7MA 4DR2T 2VKJA 3B5MA 1JNRA 4DV7T 1OEDA 4UIGA 4A98A 4WW0A 4AKRB 1W09A 3NKZA 3AXJB 3J9X1 4YMTB 3OYZA 4ANJA 3O1IA 3UU5A 3AECA 2BG9A 4P09A 3X1DA 5LHGB 5JR9C 3OJAA 5EK3A 5JREA 2AE9A 2FJBA 2HH7A 4OFZA 4CZZB 3EHZA 3ZSTA 5IUXA 4LFBT 3ZJ1A 4JYAT 2IC9A 2UXXB 3HKCE 3SS1A 3ZYLA 5LMNT 5JDFA 3QB5K 2NW9A 3K8PC 2E9XA 1UX5A 1XDOA 3OVUA 2XJ7A 3N2KE 4YTPA 4AQGA 4JI4T 3RIAA 5EK4A 3F31A 5LA6E 3ONXA 2CE7A 3ZLIA 2WDRA 1Z0PA 2VB6A 4ADZA 1HR0T 4AQYT 5L3BB 1Y01A 2YOEA 4B3ST 2Y6XA 2BBHA 3AVRA 3ONLC 1HG5A 3FBLA 3KFWX 3AE6A 3LBXA 4DVDA 3RLFF 4CN6A 5FL1A 4BAYB 3N2GE 4HGAA 3ZKRA 5LYJE 4ZXLA 4DV4T 4C91A 4PJMA 2IAKA 5ADXL 3PU8A 4TX5A 4BJNA 3U3IA 3RH3A 2V6YA 2IDOB 4UXNB 2DWGA 1YQ4A 3AXJA 3UFGA 2CHOA 3CVRA 3K1SA 3N9OA 3NRXA 3I0OA 3AVSA 4UELA 5FVLA 4C90A 1UUSA 2UUBT 4IL9A 3RYCE 2EHOB 3UU6A 2K24A 2FJEA 1MMDA 3RIUA 2LM9A 4CI3B 2V5CA 1UK5A 1XMQT 1MNDA 2HPLA 2LRKA 3QK6A 1ZOYA 2GK9A 2PG8A 1H7CA 5KX5E 4AXPA 5J0ZA 1I94T 4OX9T 5L3CB 1M7KA 2MAWA 5AQLB 3Q9DA 1SHZC 1HX1B 2CXDA 4U31A 3IEEA 1HF8A 1MIVA 1VRBA 4EZ4A 3PUVG 5AQPB 5LGUB 3N9MA 4KP3C 2C0SA 2QRXA 3JC6C 3CWZB 2XAQB 4U7YA 5J1GA 4CXXA 3GA8A 4YTMA 3OYXA 4EGWA 3PUWF 4I55E 4AIUA 1Y64B 2V5DA 2IW5B 3ZYKA 2CRBA 2BS2A 3NVOA 1VOMA 2V7IA 1HNXT 1QUUA 1FJGT 3IBPA 2YU1A 5F8PA 3C4WA 2N2NA 3C51A 2G0UA 3PURA 5DJQC 3SRZA 3FXEB 3KVBA 1D0YA 3HR0A 4FJOA 4IHJE 2OLTA 2W67A 1DU2A 2V7LA 2WWVA 2I0MA 2E9XD 4YLHA 1BR2A 1XNRT 2NW8A 5LHIB 3ZMSB 2ONKC 1S35A 5HXRA 2EHOA 3RKGA 3H3MA 2CBJA 3T1HT 2WQYA 3MK7C 2KXPB 1BR0A 4QX7B 2IHR1 4YFSA 3TLUA 4L5GA 2JQQA 3I9WA 3RQUA 2FBWA 3ZCIA 4YHJA 4H9QC 1D0ZA 5FXZA 5JH7E 2ZM2A 4HWHA 3UULA 3C4XA 3VU7H 1FEWA 4O2AE 1I6ZA 4B3RT 2XZEA 4X64T 5ETWA 1WLXA 1BR1A 3KBUA 1OWAA 1JNZA 5JR9A 2H88A 2YDSA 5H6RB 4TWHA 2VL0A 1UURA 1US7B 2JIWA 2LM2A 3BQLA 5AQHB 2DL1A 3T1YT 1T72A 1NAFA 2C5JA 5HXEA 4J2CA 2K48A 2J47A 4ISSA 4YT0A 5HEJA 2IIUA 2KT9A 2LOSA 1XWMA 3UUMA 4YSYA
chains in the Genus database with same CATH topology
4YMWC 3PUZF 4KI0G 3RLFG 4JBWG 4KHZG 3TUIA 3PUXG 3PUVG 3PUWG 3D31C 3PV0G 3PUYF 4YMVC 4TQUN 3TUJA 2R6GG 4YMTB 4TQUM 3TUZA 4XIGN 2ONKC 4JBWF 4KI0F 3RLFF 3PUXF 4YMSC 3PUZG 3PUVF 4KHZF 4XIGM 4XTCN 3PUWF 4YMUC 3PV0F 4XTCM 2R6GF 3DHWA 3PUYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMW C;  3PUZ F;  4KI0 G;  3RLF G;  4JBW G;  4KHZ G;  3TUI A;  3PUX G;  3PUV G;  3PUW G;  3D31 C;  3PV0 G;  3PUY F;  4YMV C;  4TQU N;  3TUJ A;  2R6G G;  4YMT B;  4TQU M;  3TUZ A;  4XIG N;  2ONK C;  4JBW F;  4KI0 F;  3RLF F;  3PUX F;  4YMS C;  3PUZ G;  3PUV F;  4KHZ F;  4XIG M;  4XTC N;  3PUW F;  4YMU C;  3PV0 F;  4XTC M;  2R6G F;  3DHW A;  3PUY G; 
#chains in the Genus database with same CATH topology
 4PJN A;  3PUZ F;  2DNX A;  4EOZ B;  3ZC1 A;  4TV9 E;  2WAU A;  4EB6 E;  1XNQ T;  2XAS B;  1XDP A;  4DMW A;  1NWM X;  4ZI7 E;  5A1L A;  4QKN A;  5DAB A;  4N78 D;  2ZM6 T;  4CI2 B;  4UVC B;  1KNR A;  1WR6 A;  3HI2 A;  2NOX A;  3SOL A;  4PJL A;  1XZY A;  2IML A;  4A56 A;  3TUJ A;  4ILC A;  1EZ3 A;  2V8S V;  2CLY C;  1S94 A;  4TZ4 C;  4JLE A;  5EZY E;  2WB5 A;  3FZK B;  5CFB A;  2MTQ A;  2XAJ B;  1MMN A;  4PK6 A;  2WCA A;  4LF7 T;  1LRZ A;  4AKI A;  3MXZ A;  4QXH B;  5L4E A;  4F6R C;  4YY3 T;  4KI0 F;  1T98 A;  4Z90 A;  2VQF T;  4H9O C;  3RKO A;  4DMV A;  5ABF A;  4TV8 E;  4IDN A;  2L3L A;  4OYJ A;  2LSY A;  1M62 A;  3F2E A;  2XSB A;  2HPJ A;  3TLV A;  4QH5 A;  4JV5 T;  3N9Q A;  4U2Z A;  4XIG M;  3ZMZ B;  1LVK A;  4X5T A;  1G8X A;  3P50 A;  3PUX G;  3O1H A;  1LVF A;  3ZYM A;  2VQE T;  3N9N A;  1T8B A;  1CHU A;  4AKG A;  5AQR B;  3T8O A;  2X9W A;  4G63 A;  3L3P A;  2LSK A;  4NUV A;  4JI3 T;  4L9I A;  3ZMU B;  2UU9 T;  4OYK A;  4IE6 A;  4ZI2 D;  3UU3 A;  3TUI A;  3NZP A;  1N33 T;  5KMG P;  4IDQ A;  3LFM A;  2EHO D;  3RRC A;  1WRD A;  2UXC T;  2A9U A;  3Q2M A;  1HX8 A;  4JI1 T;  5AQN B;  4ZS3 A;  4COF A;  3EAB A;  4Z8X A;  4ZS2 A;  2V6Y B;  4LF4 T;  4IDO A;  3RLF G;  3A8Y C;  4YJ3 E;  2A3D A;  2P9B A;  4KUM B;  1WYC A;  5CGM A;  2QGS A;  4LF9 T;  1W0B A;  3KVA A;  2K5B B;  2CPT A;  4XTC N;  2DLR A;  5HWX A;  2VAS A;  2IC6 A;  2X0H A;  1YD8 G;  3O1J A;  2LJL A;  3P4W A;  1YQ3 A;  2N1G A;  2WZH A;  4IGU A;  4I50 E;  4IE5 A;  3CIR A;  2XAF B;  4HFB A;  3KV5 A;  5H6Q B;  2WZI A;  4TNV A;  5JDH A;  3FHN A;  3ZC0 A;  5FY1 A;  3JAD A;  4IT4 A;  4L0R A;  2JQK A;  5GON E;  5HEH A;  1L0V A;  3UFE A;  4JI0 T;  1BR4 A;  2KWH A;  4KX6 A;  2H3R A;  3GWH A;  4DO0 A;  4EAH A;  3FXD B;  4X1K E;  2ACZ A;  4EYY R;  4GKJ T;  3Q5X A;  4ZHQ E;  4FI5 A;  4PAG A;  4NPP A;  4JBW F;  4HWF A;  2WU2 A;  4KHZ F;  4JI5 T;  4YJ2 E;  1U4Q A;  3PV0 F;  2Y8D A;  5M4Y A;  2VVS A;  2RPA A;  3EUH A;  3ETU A;  4P0B A;  3AE3 A;  2J4G A;  1D1C A;  4K0K T;  3TLS A;  2WP9 A;  3RC3 A;  1UGO A;  2VL8 A;  3P4P A;  4EZH A;  2LOP A;  3MJX A;  3LSV A;  2Q9Q C;  2QA7 A;  1Z8U A;  4TQU N;  5IHY A;  5HCJ A;  1HCI A;  3Q5D A;  2XPK A;  3RF1 A;  4AKH A;  2MBG A;  4GKK T;  2JMK A;  2X51 A;  2VKO A;  2SPC A;  3ONJ A;  1WFD A;  2LKG A;  5AQF B;  3PU3 A;  3UT5 E;  5LCY A;  2X0Y A;  2J1D G;  4LML A;  5HEU A;  1UX4 A;  3U78 A;  3DP7 A;  2FJD A;  4U2Y A;  3VKG A;  3V5U A;  2JRK A;  5JDN A;  4GIW A;  3N9P A;  2Y48 B;  2W00 A;  3ZT5 A;  3RRW A;  5CA0 E;  3PE0 A;  3ETV A;  3CQG B;  3WAK A;  2BKN A;  1D0X A;  2YN6 A;  1AJ3 A;  3QNU A;  3FB2 A;  2B76 A;  4UF0 B;  3UU4 A;  1HNW T;  4DBQ A;  2W2U A;  2KND A;  3CX7 B;  4EEB A;  2NW7 A;  2BDE A;  5EK2 A;  3PUG A;  4DV5 T;  4A5X A;  1J5W A;  4KBM B;  1ZEE A;  2PBI A;  2XQ6 A;  3JAE A;  3O9X A;  3FBZ A;  5FXW A;  3AAE B;  3AED A;  2LLY A;  3AE8 A;  3AE9 A;  2XY8 B;  5CA1 E;  3ZCJ A;  5BR8 T;  3M65 A;  4O2B E;  4KHP T;  3KV9 A;  2ZLY A;  5JR9 B;  2A2F X;  5KXJ A;  1T7S A;  3I1A A;  1IBL T;  2X0L B;  2YDR A;  2KZ7 B;  2XAH B;  4GK0 E;  3VKH A;  4DV0 T;  4DR1 T;  4HFD A;  3CQX C;  3B57 A;  4WNK A;  3P4Q A;  4GYS A;  4JI8 T;  2R6G G;  3UUX B;  2BVL A;  3VHL A;  4YMU C;  3UQ7 A;  2YU2 A;  2H7V C;  5LOV E;  4HWD A;  2V1D B;  2VVN A;  3ZMV B;  1CUN A;  3PUA A;  2FJA A;  4JI7 T;  1SA0 E;  1G73 A;  2WMO A;  4BJM A;  1HS7 A;  3RQW A;  3DTO A;  3PUZ G;  3QUJ A;  4E7S A;  4JI2 T;  5LGT B;  2BS4 A;  2CEA A;  4QXC B;  2Q9Q B;  3AE2 A;  3V5S A;  2XQ4 A;  2X66 A;  2LSJ A;  3PUS A;  1QSD A;  1R8I A;  3VR8 A;  2LKH A;  4P1N A;  2NWB A;  3AEF A;  3CX8 B;  4XZC A;  2OA5 A;  4AIS A;  1OED E;  2ODV A;  2VKD A;  2OV9 A;  3UUN A;  4DR4 T;  4UF0 A;  1IJ6 A;  5KDM C;  4PK4 A;  4O4I E;  3O4X E;  5ABF B;  3ZSS A;  2JMH A;  2LRL A;  4DR5 T;  4QX8 B;  3L8R A;  2RA1 A;  4O8S A;  1X9B A;  3BQK A;  2VKH A;  4IE0 A;  2BG9 E;  5FVK A;  2KWI B;  3VRB A;  3FZH B;  4MLK A;  4KI0 G;  3RYF E;  4ZEY A;  1MMA A;  2I6H A;  5JDL A;  2YKS A;  2WSS V;  1FMV A;  3ZN0 B;  5L3F B;  3PUV F;  4GK5 E;  4EV6 A;  3JCF A;  4I4T E;  2H7O A;  2W63 A;  5LBM A;  5L2L A;  2RP4 A;  4GYR A;  4HEA A;  2A72 A;  5AQS B;  3LK2 B;  2H89 A;  4YTN A;  3E08 A;  3EDV A;  4B3T T;  5FL0 A;  2VK9 A;  2CXL A;  4ERR A;  3C50 A;  5LG4 A;  4M1P A;  3MA9 A;  4IE7 A;  3DJB A;  2XTL A;  2NR4 A;  4B3M T;  2WDV A;  5LBQ B;  2MYS A;  2N9D A;  3UQ4 A;  1IZN B;  2X9Y A;  4AQF C;  5IWA T;  5AQJ B;  1V9D A;  3CK6 A;  4KMC A;  3RPU A;  2M67 A;  3RIF A;  5HYA A;  3PJA J;  3KBT A;  1WCR A;  3RIU C;  3EAM A;  5AFU L;  3ZT7 A;  2W61 A;  5HXH A;  2Q9Q A;  5IYZ E;  2M6I A;  4XBF B;  1ZP0 A;  2CMR A;  4UR9 A;  2HHH T;  2JQH A;  2X67 A;  4WYV A;  1FIO A;  2KMF A;  3PUQ A;  1YW0 A;  3SFE A;  3PJA A;  4IE4 A;  1KEY A;  5FP3 A;  4H9R C;  3OTO T;  3LJC A;  4EYU A;  4ILA A;  3A5X A;  4UEM A;  3QOF A;  3OKQ A;  4ZI3 C;  4TNW A;  2WBL A;  2KSR A;  3NZQ A;  3PDY A;  5AQU B;  4UVA B;  2LSG A;  3F57 A;  4OK0 A;  5J2T E;  2V7K A;  4UV9 B;  2XM2 A;  3OPC A;  3ZEF B;  3L09 A;  2K3W A;  2CM0 A;  2C5K T;  3VR9 A;  5FY7 A;  2LEH A;  3IA3 A;  2BKP A;  3AA0 B;  4YMW C;  4DV1 T;  4ZZB A;  4KHZ G;  4HWC A;  2IUB A;  1VCT A;  3PV0 G;  5LMU T;  4TQU M;  1KK7 A;  2YEV C;  2W0G A;  5DQV A;  5AQM B;  4DR3 T;  4LMJ A;  2JPF A;  4PJJ A;  2NTX A;  3AB3 B;  2XSA A;  2DHR A;  3FZL B;  4Z91 A;  4NUU A;  5HEO A;  3KIN B;  5HAX A;  4ILU A;  5LNK A;  3I0Q A;  3PTR B;  3D0T A;  4X1Y E;  4ZI2 C;  3HKD E;  5DQW A;  2B1E A;  5ABE A;  3MAC A;  4DV2 T;  3KV6 A;  2XQ9 A;  3ZJ2 A;  4DID B;  2HN1 A;  4LF6 T;  2D9D A;  4AKL A;  4IDP A;  1HNZ T;  2V7J A;  2DI4 A;  3K3Q C;  3OBV E;  4EXT A;  5JVD E;  4O4J E;  4CI1 B;  4LF8 T;  1YKH B;  3D31 C;  4HFH A;  1N32 T;  1O3X A;  5L47 A;  4YMS C;  4LF5 T;  1MIW A;  2YIN A;  4DR6 T;  1OXZ A;  4IST A;  2KLQ A;  3P4S A;  3C4Z A;  3HL6 A;  2NP9 A;  2X68 A;  4GOU A;  4U33 A;  2DWK A;  1E1H B;  3AA6 B;  2D0T A;  3ZN1 B;  4YMV C;  2WDQ A;  3W15 B;  5AQV B;  3AAI A;  2CLY B;  3RGL A;  3N2O A;  1D1A A;  2UXN B;  3AE7 A;  4YSZ A;  4WBO A;  3MKD A;  4DUY T;  3G06 A;  3PUY F;  1XMO T;  4NXM T;  3VRA A;  4TN7 B;  3E22 E;  4IDZ A;  2F4V T;  2WY2 A;  3PUX F;  5LXT E;  3LK4 2;  5LJM A;  3KV4 A;  3LG7 A;  4B6X A;  2Q9Q D;  3NRY A;  5LB7 B;  4XIG N;  3E0Z A;  4PW8 A;  5CB4 E;  3AE4 A;  3AEA A;  3AAA B;  2FUP A;  3UUB A;  4CXY A;  2BZB A;  2W4X A;  2J62 A;  4HFE A;  3I9Y A;  3PUW G;  1J5E T;  1ZKE A;  4JUY A;  5LJN A;  4MAL A;  5FNV E;  2ZM8 A;  3NBX X;  4O4H E;  4H9P C;  4O4L E;  4IL4 A;  5HEG A;  2PFV A;  2K9A A;  3MZK B;  2XAG B;  2QVA A;  3B13 A;  4CN1 A;  4HN9 A;  3ESL A;  2BKO A;  4AQF A;  2NTY A;  5AQK B;  4G2A A;  1IBK T;  4CXW A;  1U5P A;  4MHC A;  1SUM B;  2LHN A;  4TWF A;  2VUR A;  4DV3 T;  1IBM T;  1E2A A;  2ZMA A;  1QLB A;  4EED A;  4H63 H;  5L4H A;  3HKB E;  2DCF A;  4NIQ A;  3N9L A;  5L3D B;  1WYB A;  3Q5E A;  3ZT6 A;  3AA7 B;  1J1J A;  3CML A;  3M3Z B;  5F5W A;  1HTJ F;  4TWD A;  3K3O A;  1KNZ A;  5E0O A;  3AE1 A;  3C64 A;  2CA5 A;  4OHF A;  2MOZ A;  4LMK A;  4JEU B;  2KIN B;  3LDQ B;  2WWU A;  2E2A A;  4JI6 T;  4ASK A;  5JDM A;  3P4R A;  2I59 A;  3CQC B;  2UUC T;  4DUZ T;  3BQI A;  2C5I T;  3JC6 D;  1N34 T;  2XQ3 A;  1MNE A;  4CN4 A;  3GN5 B;  4U72 A;  3CPZ A;  4X62 T;  4V1A v;  4ZZC A;  5C2T A;  3Q5W A;  4DV6 T;  4IRE A;  1OED C;  3FZF B;  1YXR A;  5ABG A;  3K3N A;  1W9R A;  3GMI A;  3S4U A;  5FYM A;  2M6B A;  3AEG A;  3SFD A;  2CXF A;  4YSX A;  4H9N C;  4BA9 A;  5L3G B;  3L39 A;  1ZHC A;  4Q25 A;  4PK5 A;  2X9X A;  2XQ8 A;  2BG9 C;  4ZOL E;  5JQG E;  4PFO A;  1X79 A;  5L3E B;  5HCM A;  3CX6 B;  3ABV A;  2W62 A;  2YDQ A;  3RC8 A;  2YK0 A;  2QYW A;  4ILB A;  4QWN B;  2PTF A;  3H3A A;  1HFA A;  4X1I E;  3C98 B;  3QC9 A;  1ZV4 X;  2XUE A;  2E9X C;  1IJ5 A;  2BBJ A;  2ACX A;  4HFI A;  4F8H A;  2D2S A;  1GQE A;  3EDU A;  5AQI B;  1UCU A;  3RYH E;  4HFC A;  4HE8 A;  2D5U A;  3WI3 A;  5C8Y E;  2V7M A;  4PNI A;  5JTG A;  3RI5 A;  4A97 A;  3TLT A;  4JEH B;  4HWI B;  4MFR A;  4MBQ A;  4HFV A;  4YXD A;  1YKE B;  2L8K A;  1WR0 A;  4PFP A;  4QHO A;  4I43 B;  1LKX A;  2ODU A;  3QB5 A;  2WMN A;  4QH4 A;  3NWI A;  1FMW A;  2ZM0 A;  3R84 B;  2XQY A;  5AQT B;  1HG2 A;  4DBR A;  3R6N A;  4AI6 A;  2L9Q A;  4IIJ E;  5HXC A;  3AEE A;  5JDQ A;  2W66 A;  3ZPO A;  2CBI A;  2UXD T;  3J7Y q;  3GN5 A;  3HA4 A;  3AA1 B;  3IF8 B;  2R6G F;  4U7I A;  3EI0 A;  2JQ9 A;  3TKL B;  5FY0 A;  2ES0 A;  2HN2 A;  2E5L T;  5BMV E;  4QH1 A;  3ANW B;  3BK9 A;  3AEB A;  2E8I A;  4X20 E;  5JRC B;  2VWA A;  4H9S E;  5TAO A;  3EVY A;  4XTC M;  3DHW A;  2D0U A;  4WZX A;  4U3C A;  1B7T A;  2Z6E A;  4U74 A;  5FKY A;  5FMN A;  2XHE B;  3ZMT B;  3FZM B;  2BS3 A;  1OED B;  2UXB T;  1KNP A;  4X65 T;  2CWO A;  4QXB B;  3P8C D;  3RX6 A;  1MMG A;  2V6X A;  2UUA T;  5LG3 A;  2AXD S;  3HKE E;  2WS3 A;  5JDG A;  5LP6 E;  4LFA T;  5AQG B;  1KFY A;  5J2U E;  2XM1 A;  1NEK A;  2BG9 B;  2LHR A;  2LT3 A;  4H63 V;  3TLW A;  1MIY A;  1VCS A;  2BVM A;  5FXX A;  1KF6 A;  5LHH B;  4HTE A;  4ZI3 D;  4DR7 T;  4LFC T;  1IAP A;  3IHR A;  2CCQ A;  4TUY E;  2V26 A;  3H37 A;  3CKD A;  4CQI A;  4UV8 B;  3SWH A;  3TUZ A;  5HWY A;  3KDS E;  4WBN E;  1NEN A;  4E7Z A;  2LE8 A;  3P7I A;  2XQA A;  5FXV A;  2WM9 A;  2E9X B;  4JBW G;  5ABH A;  5F3J A;  4DND A;  3N5L A;  5AQO B;  4P0A A;  2E5V A;  1D1B A;  4K0U A;  2JJ9 A;  3PUY G;  2LSI A;  5LGN B;  3LK3 B;  5CJ5 A;  2CWY A;  3AE5 A;  4I0U A;  4XAX B;  3UU8 A;  2PJQ A;  4YHH T;  1W0A A;  1SE7 A;  2XQ7 A;  3ANW A;  3WAJ A;  4HKA A;  2XQ5 A;  4EIW A;  5C3J A;  4NXN T;  4UVB B;  5JRC A;  3JAF A;  2CHN A;  5AQQ B;  1E7P A;  1N36 T;  5HXS A;  4X66 T;  3LBX B;  2X9H A;  3RYI E;  2EHO C;  2WU5 A;  2MPK A;  3RHW A;  3UTK A;  3A7M A;  4DR2 T;  2VKJ A;  3B5M A;  1JNR A;  4DV7 T;  1OED A;  4UIG A;  4A98 A;  4WW0 A;  4AKR B;  1W09 A;  3NKZ A;  3AXJ B;  3J9X 1;  4YMT B;  3OYZ A;  4ANJ A;  3O1I A;  3UU5 A;  3AEC A;  2BG9 A;  4P09 A;  3X1D A;  5LHG B;  5JR9 C;  3OJA A;  5EK3 A;  5JRE A;  2AE9 A;  2FJB A;  2HH7 A;  4OFZ A;  4CZZ B;  3EHZ A;  3ZST A;  5IUX A;  4LFB T;  3ZJ1 A;  4JYA T;  2IC9 A;  2UXX B;  3HKC E;  3SS1 A;  3ZYL A;  5LMN T;  5JDF A;  3QB5 K;  2NW9 A;  3K8P C;  2E9X A;  1UX5 A;  1XDO A;  3OVU A;  2XJ7 A;  3N2K E;  4YTP A;  4AQG A;  4JI4 T;  3RIA A;  5EK4 A;  3F31 A;  5LA6 E;  3ONX A;  2CE7 A;  3ZLI A;  2WDR A;  1Z0P A;  2VB6 A;  4ADZ A;  1HR0 T;  4AQY T;  5L3B B;  1Y01 A;  2YOE A;  4B3S T;  2Y6X A;  2BBH A;  3AVR A;  3ONL C;  1HG5 A;  3FBL A;  3KFW X;  3AE6 A;  3LBX A;  4DVD A;  3RLF F;  4CN6 A;  5FL1 A;  4BAY B;  3N2G E;  4HGA A;  3ZKR A;  5LYJ E;  4ZXL A;  4DV4 T;  4C91 A;  4PJM A;  2IAK A;  5ADX L;  3PU8 A;  4TX5 A;  4BJN A;  3U3I A;  3RH3 A;  2V6Y A;  2IDO B;  4UXN B;  2DWG A;  1YQ4 A;  3AXJ A;  3UFG A;  2CHO A;  3CVR A;  3K1S A;  3N9O A;  3NRX A;  3I0O A;  3AVS A;  4UEL A;  5FVL A;  4C90 A;  1UUS A;  2UUB T;  4IL9 A;  3RYC E;  2EHO B;  3UU6 A;  2K24 A;  2FJE A;  1MMD A;  3RIU A;  2LM9 A;  4CI3 B;  2V5C A;  1UK5 A;  1XMQ T;  1MND A;  2HPL A;  2LRK A;  3QK6 A;  1ZOY A;  2GK9 A;  2PG8 A;  1H7C A;  5KX5 E;  4AXP A;  5J0Z A;  1I94 T;  4OX9 T;  5L3C B;  1M7K A;  2MAW A;  5AQL B;  3Q9D A;  1SHZ C;  1HX1 B;  2CXD A;  4U31 A;  3IEE A;  1HF8 A;  1MIV A;  1VRB A;  4EZ4 A;  3PUV G;  5AQP B;  5LGU B;  3N9M A;  4KP3 C;  2C0S A;  2QRX A;  3JC6 C;  3CWZ B;  2XAQ B;  4U7Y A;  5J1G A;  4CXX A;  3GA8 A;  4YTM A;  3OYX A;  4EGW A;  3PUW F;  4I55 E;  4AIU A;  1Y64 B;  2V5D A;  2IW5 B;  3ZYK A;  2CRB A;  2BS2 A;  3NVO A;  1VOM A;  2V7I A;  1HNX T;  1QUU A;  1FJG T;  3IBP A;  2YU1 A;  5F8P A;  3C4W A;  2N2N A;  3C51 A;  2G0U A;  3PUR A;  5DJQ C;  3SRZ A;  3FXE B;  3KVB A;  1D0Y A;  3HR0 A;  4FJO A;  4IHJ E;  2OLT A;  2W67 A;  1DU2 A;  2V7L A;  2WWV A;  2I0M A;  2E9X D;  4YLH A;  1BR2 A;  1XNR T;  2NW8 A;  5LHI B;  3ZMS B;  2ONK C;  1S35 A;  5HXR A;  2EHO A;  3RKG A;  3H3M A;  2CBJ A;  3T1H T;  2WQY A;  3MK7 C;  2KXP B;  1BR0 A;  4QX7 B;  2IHR 1;  4YFS A;  3TLU A;  4L5G A;  2JQQ A;  3I9W A;  3RQU A;  2FBW A;  3ZCI A;  4YHJ A;  4H9Q C;  1D0Z A;  5FXZ A;  5JH7 E;  2ZM2 A;  4HWH A;  3UUL A;  3C4X A;  3VU7 H;  1FEW A;  4O2A E;  1I6Z A;  4B3R T;  2XZE A;  4X64 T;  5ETW A;  1WLX A;  1BR1 A;  3KBU A;  1OWA A;  1JNZ A;  5JR9 A;  2H88 A;  2YDS A;  5H6R B;  4TWH A;  2VL0 A;  1UUR A;  1US7 B;  2JIW A;  2LM2 A;  3BQL A;  5AQH B;  2DL1 A;  3T1Y T;  1T72 A;  1NAF A;  2C5J A;  5HXE A;  4J2C A;  2K48 A;  2J47 A;  4ISS A;  4YT0 A;  5HEJ A;  2IIU A;  2KT9 A;  2LOS A;  1XWM A;  3UUM A;  4YSY A; 
#chains in the Genus database with same CATH homology
 4YMW C;  3PUZ F;  4KI0 G;  3RLF G;  4JBW G;  4KHZ G;  3TUI A;  3PUX G;  3PUV G;  3PUW G;  3D31 C;  3PV0 G;  3PUY F;  4YMV C;  4TQU N;  3TUJ A;  2R6G G;  4YMT B;  4TQU M;  3TUZ A;  4XIG N;  2ONK C;  4JBW F;  4KI0 F;  3RLF F;  3PUX F;  4YMS C;  3PUZ G;  3PUV F;  4KHZ F;  4XIG M;  4XTC N;  3PUW F;  4YMU C;  3PV0 F;  4XTC M;  2R6G F;  3DHW A;  3PUY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...