3PV0F

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
488
structure length
483
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 138
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3pv0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3pv0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3pv0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3pv0F02
4KI0G 4XIGN 4TQUM 4JBWG 3PUWG 4KHZF 3D31C 3TUJA 3PUZG 4XIGM 4KHZG 3PUZF 3PUVG 3PUXF 4XTCN 3TUZA 4TQUN 4YMUC 4KI0F 3PV0F 4YMSC 2R6GG 3PV0G 4JBWF 3PUWF 2R6GF 3DHWA 4YMVC 3PUXG 3PUYF 3RLFG 3PUVF 4YMWC 3PUYG 3RLFF 2ONKC 3TUIA 4YMTB 4XTCM
chains in the Genus database with same CATH superfamily
2IUBA 3NRYA 4KX6A 3QUJA 4IT4A 3C4WA 4O8SA 4DV2T 1SA0E 3QOFA 3FB2A 4X62T 1ZKEA 2WZHA 2K24A 2PTFA 2FBWA 4JUYA 2JQ9A 4UV8B 3RX6A 2XQ8A 3BK9A 3VU7H 1T98A 2BZBA 3ZCJA 4DV3T 4DV5T 4GK0E 4U7IA 2K48A 4H9RC 3IF8B 3RIFA 2XSBA 3VRAA 4H63V 2CM0A 3DP7A 2YDRA 2FJDA 4HFBA 3O1IA 3B57A 3KBUA 3VRBA 2D0TA 2E8IA 3GA8A 4NIQA 2NR4A 1WFDA 4TWHA 3EHZA 3UU6A 2KLQA 1HR0T 3L09A 1VCTA 2Q9QA 4H9NC 5LB7B 4DR5T 5FY1A 4X66T 3ESLA 1FMWA 4DUZT 4LF6T 4B3MT 2LM2A 3DTOA 3ZMZB 1U5PA 1ZOYA 3P8CD 4HGAA 4AKIA 4AQFC 3FXEB 3VKHA 2CLYB 2DI4A 4U31A 5FY7A 3P4RA 2LM9A 5FNVE 4HFHA 5LA6E 2A72A 4CI2B 4YMTB 2C5JA 2ZM2A 1MMNA 4TX5A 2WY2A 3N9OA 3RIUA 3ZSTA 1N34T 4XIGN 1OEDB 3AXJA 4YTPA 3UUBA 4DV6T 1E2AA 3QK6A 3RYFE 5LNKA 4DR3T 3F31A 3PDYA 3TLUA 3EUHA 3I0QA 4P09A 4IIJE 4LMKA 5FY0A 2JMKA 2LHNA 3PUZF 2PJQA 4PJNA 2Q9QB 3AE4A 4UVCB 3TUZA 3VKGA 5CA1E 1O3XA 2KSRA 2XQAA 3PUAA 2PFVA 5HEUA 5HEHA 3H3MA 4YMSC 4HEAA 4G2AA 4DR2T 4EIWA 2I0MA 3T1HT 3P7IA 5TAOA 2WS3A 4PW8A 1HNXT 2WMNA 4DO0A 3AA0B 4AKHA 3AAIA 3ZC1A 4HWDA 4JI8T 4DR7T 1WR6A 1OEDC 1DU2A 4U74A 2Z6EA 2NW9A 3UUNA 2FJAA 3DJBA 5L3BB 5AQRB 4WZXA 5F8PA 3SFDA 2JQKA 4OFZA 3CX6B 1BR0A 4TNWA 3Q2MA 2XPKA 5FXVA 4P0AA 1D0ZA 2BVMA 2ES0A 4X20E 5AQMB 3RYIE 3U3IA 4TUYE 4B3TT 2W2UA 5JRCB 2MYSA 3AECA 2SPCA 2XQ5A 5CB4E 4CZZB 4TV8E 2KZ7B 5AQOB 3M3ZB 3AE6A 2BS2A 1X79A 4HE8A 1N32T 2ACXA 3FBZA 5ABFB 2LOPA 2QYWA 2CRBA 3CVRA 2W00A 3S4UA 4ISTA 2FJEA 2WZIA 3AEEA 4ZI3C 3R84B 2V26A 2V7IA 2IHR1 2WDQA 1SHZC 4HFDA 4IE4A 3UT5E 5HEJA 3LBXB 4EZ4A 1MIVA 4A56A 3LK3B 5LHGB 1HFAA 5L3CB 3KBTA 4JI7T 2KINB 2XQ7A 5BR8T 3PUXG 2Y8DA 4JI1T 3CX7B 3PUYG 1YXRA 2X0HA 2DLRA 3I0OA 3O9XA 2BG9C 4CXYA 4U7YA 1M7KA 4GKKT 1KNRA 4PAGA 1BR1A 4KI0G 2IDOB 4O2BE 5HCJA 4TQUM 1Z8UA 4JI3T 2HPLA 2H89A 4IE6A 1W09A 2W63A 3PUWG 4BAYB 5ABFA 4X64T 3D31C 1J1JA 3TUJA 2MPKA 4YHJA 1UURA 3UFEA 4EGWA 3CMLA 1HTJF 1YKEB 2BS3A 4DVDA 4IREA 3AE8A 2LSKA 5DQWA 5E0OA 4AIUA 3NZQA 5FXZA 5EK4A 4BJNA 5J1GA 5LHIB 4DR4T 5ABGA 3LSVA 5GONE 2WQYA 4L9IA 3CWZB 5AQTB 3TLVA 1MIWA 3KINB 4OK0A 4YSZA 1KNZA 4IDPA 4QXCB 4CN4A 4HFIA 5LP6E 4JYAT 2WSSV 2XZEA 3I9YA 3KVBA 3AEBA 2EHOD 1D1CA 1MMAA 4JEHB 4UF0A 2W62A 3VHLA 1IAPA 3ZYMA 5CA0E 4AI6A 4HTEA 2UXNB 5LJNA 2BS4A 2JMHA 2ZM8A 3RIAA 1I6ZA 3RGLA 4DV0T 4ASKA 2DWKA 1YQ4A 2DWGA 3ZMTB 3ZSSA 2XAFB 1ZV4X 2VL8A 5LG4A 5J2UE 4UVBB 1IBMT 1HNZT 4LF5T 5BMVE 2WM9A 3E0ZA 1UK5A 3ANWB 3EAMA 4MLKA 5L3EB 2Y48B 4O4JE 5C2TA 2RA1A 3M65A 2G0UA 3JC6D 2WBLA 4IDNA 4LMLA 4O2AE 3NZPA 4L5GA 4ZXLA 3ZMSB 4CN1A 1KF6A 5LGUB 2UUBT 4E7ZA 1VRBA 3UU5A 3U78A 2B1EA 1YW0A 2RP4A 5FYMA 4COFA 2C5KT 4JBWF 2E5LT 3PUWF 4EV6A 5C3JA 2VKJA 4HWCA 3FZMB 4B3ST 3C50A 1SUMB 5HAXA 5HXEA 1OEDE 4H9SE 1IJ5A 5H6QB 3VR8A 2X68A 4YFSA 1WRDA 2HHHT 3GMIA 5L3DB 4QWNB 2ACZA 3LJCA 4K0UA 4MALA 1R8IA 4PJLA 2ODVA 5L2LA 1XNQT 2W0GA 2W67A 3EVYA 4JI4T 3MA9A 1IZNB 4QXHB 3SWHA 2IMLA 5L4HA 3ZT5A 1KFYA 2CBJA 5LYJE 5IWAT 2Q9QD 4DNDA 3RQWA 2W66A 3P4SA 3C4ZA 4EZHA 5L4EA 3AB3B 2QA7A 3ABVA 4YXDA 4HFEA 3AA1B 2NOXA 4LF9T 3LDQB 3RC3A 1WLXA 1W0BA 1UGOA 2V7MA 4C90A 5JDQA 2CEAA 3UFGA 4NUVA 5JDGA 3PV0G 1U4QA 4LFAT 1HG5A 4IDOA 3KV4A 4AKRB 5FL1A 1CHUA 1YD8G 4LF4T 3ZKRA 4ADZA 2FJBA 4NUUA 4IE0A 3EI0A 4E7SA 4BJMA 4IL4A 3K3OA 4DIDB 3O4XE 2V7JA 3JAFA 2ZM6T 1D1BA 3P50A 2LKGA 1N36T 2XQ4A 3ZT6A 2X9XA 4OYKA 4UR9A 5HXCA 3ZYLA 1HCIA 5AQJB 3ZMUB 5JR9C 4XIGM 4QHOA 4A98A 5J0ZA 5FP3A 2IIUA 2H7OA 2JPFA 5HEOA 3HKBE 3KV9A 4GYRA 4J2CA 3NBXX 4NXNT 2EHOB 5IYZE 2MOZA 1XDPA 1VCSA 3EABA 4L0RA 4H9PC 1WCRA 1FIOA 3CKDA 4HKAA 4U72A 4UV9B 2E9XB 1J5ET 1FEWA 2XASB 3PJAJ 3LG7A 5LGTB 5IHYA 2V5DA 4ILBA 1LVKA 2N2NA 4QH4A 4PNIA 4HN9A 4F6RC 2VWAA 3RQUA 3UUXB 4JI2T 4O4LE 2CBIA 2XUEA 4YTNA 1YQ3A 3NKZA 4U3CA 3GWHA 5LHHB 2ZM0A 1S94A 4QXBB 3ZLIA 3W15B 4I55E 5FXXA 3G06A 2LHRA 3N9MA 3RYCE 3ZN0B 2VVNA 3B13A 2P9BA 2CXLA 2V7KA 2LT3A 3A8YC 3FHNA 2D0UA 3N9QA 2BBHA 3Q5WA 4UXNB 2YK0A 2RPAA 2E9XD 3Q5EA 5HCMA 5LBMA 2WU2A 4U33A 4AQFA 4AQYT 5FVLA 2LRLA 3UU8A 3O1JA 3PU8A 2VQET 3LBXA 5L3FB 4DR6T 1IBLT 1KEYA 5LMUT 2PBIA 3N2GE 2NW8A 1V9DA 2BKOA 3IBPA 4DR1T 3LFMA 3N2KE 3OKQA 4KBMB 4DMVA 3E22E 2QVAA 4YHHT 5J2TE 2AXDS 4AKLA 3CIRA 4IE5A 3ZC0A 3ZJ1A 3ZN1B 2X0YA 3PJAA 4X65T 1NAFA 2H3RA 4NXMT 3RPUA 1HX8A 2IAKA 5HWXA 3TLSA 3PURA 2X0LB 5AQQB 2Y6XA 2A3DA 2CWOA 2LSJA 2V1DB 2VASA 2X9YA 3KV6A 5F5WA 1NENA 1W0AA 1Y01A 2BKPA 2K9AA 3AXJB 2J62A 3FZFB 3SS1A 4DBQA 2UUAT 4AKGA 2NTYA 3RH3A 1BR4A 5ABHA 3KV5A 4LMJA 4OX9T 3PUXF 2YU1A 3HA4A 1M62A 3NVOA 3AA7B 4UIGA 2CCQA 2CA5A 2IC6A 2JQQA 2X51A 3MACA 1KNPA 3EDUA 3OJAA 3OYXA 5EK2A 3LK42 3Q5DA 1QUUA 4QH5A 2FUPA 4XAXB 5AQIB 1T72A 1XNRT 3HKEE 5JDNA 1E7PA 3ONJA 1MIYA 2VKOA 1WYCA 3C64A 1MMGA 3DHWA 3N5LA 2BG9A 4EOZB 2F4VT 2YDQA 2UXBT 1UUSA 2XTLA 3K1SA 2JIWA 1X9BA 4YMWC 1J5WA 4DV4T 1N33T 1WYBA 3AA6B 4TNVA 4U2YA 5JDHA 4UVAB 4AXPA 4XZCA 1WR0A 3L8RA 2CXDA 2B76A 2YDSA 4UF0B 3HI2A 4JBWG 2LRKA 5FXWA 1D0XA 4UEMA 4MFRA 5LGNB 5AQNB 2C0SA 3MK7C 2M67A 2YN6A 4PFPA 4JEUB 4ZOLE 5FMNA 2QRXA 3MXZA 3WAKA 2X67A 2UXCT 5ADXL 1KK7A 2K3WA 2LJLA 3HR0A 3QC9A 3IHRA 3UTKA 1XMQT 2NP9A 3TLWA 2OLTA 1D0YA 5JR9A 3PTRB 2CMRA 5AQPB 1I94T 3C4XA 3N9LA 3PUQA 1G8XA 3SOLA 4H63H 4JI5T 4CN6A 2DCFA 3N9NA 3PE0A 4O4HE 4X1KE 2A9UA 2YOEA 4LF8T 2NTXA 4C91A 5HXSA 3EDVA 4IGUA 4K0KT 3ZJ2A 2AE9A 1XWMA 2E9XC 3LK2B 1XDOA 4QX7B 5DJQC 3RKOA 2K5BB 3CK6A 5AQGB 4YT0A 5HXHA 3NWIA 1Y64B 3ZCIA 4P0BA 2KWIB 3MZKB 1QSDA 2LSYA 4ZI3D 4GOUA 4YTMA 4DV1T 3SRZA 4KHZG 3FZKB 3WI3A 2OA5A 4M1PA 2J4GA 2CXFA 1LRZA 5HXRA 2BDEA 2XJ7A 2WWVA 2LKHA 2JQHA 3OBVE 4ZHQE 4V1Av 4P1NA 3P4QA 2H88A 2KWHA 1IJ6A 2GK9A 2HH7A 2V5CA 3I1AA 1T7SA 4HWIB 3PV0F 4EB6E 5CGMA 2VVSA 3ZT7A 5AFUL 1G73A 5H6RB 3QB5A 4EEDA 2M6IA 4X1YE 4JI0T 2CHOA 2VB6A 3RIUC 1HF8A 3FBLA 1FJGT 3A7MA 1VOMA 3F57A 3RRWA 3IEEA 4ILUA 4PK6A 2C5IT 3PUYF 4HWHA 5KMGP 3KFWX 3AE2A 3CQCB 1ZP0A 2XQYA 2WP9A 3MJXA 4H9QC 3B5MA 2VKHA 3KVAA 3L3PA 4HFVA 2XHEB 1HNWT 3VR9A 2KT9A 3C51A 2BG9E 4JV5T 2CHNA 3UU4A 5DQVA 5JQGE 2HPJA 4GYSA 2VKDA 1HG2A 4KHZF 2ZLYA 3CQXC 2E2AA 2XAHB 1YKHB 1SE7A 3AE1A 5KX5E 3AE9A 5L3GB 5LXTE 2UU9T 3QB5K 3AE5A 2UXDT 2WAUA 5AQLB 4I4TE 3T8OA 3N9PA 3HL6A 3UULA 4I50E 4ZI2D 3CPZA 4ILCA 3Q9DA 5JREA 5JRCA 5AQFB 1QLBA 3V5UA 1HX1B 4NPPA 3AEFA 4IDQA 2QGSA 3HKCE 4YSXA 2D5UA 1OWAA 4H9OC 5C8YE 3UQ4A 2WMOA 4Q25A 4WW0A 3F2EA 4F8HA 1ZHCA 2NWBA 4IE7A 5ABEA 5LOVE 2YU2A 2V7LA 1MNEA 2XSAA 5FL0A 3RKGA 3TKLB 1HS7A 4I43B 3A5XA 4Z91A 5JTGA 5LMNT 3RYHE 2W61A 2VL0A 3ZPOA 3MKDA 2IW5B 3OPCA 2EHOC 4EEBA 3ZEFB 2HN1A 3H3AA 3AVRA 4ZZBA 2VQFT 1D1AA 3FZLB 3V5SA 4AISA 1L0VA 2UUCT 3AE3A 2MAWA 5M4YA 2E5VA 2WDVA 4JI6T 3D0TA 4TQUN 5IUXA 5JVDE 5DABA 4YY3T 2D9DA 2I6HA 3BQKA 2H7VC 5JH7E 2JJ9A 3JAEA 4ZS2A 1JNZA 5HWYA 2WWUA 4YLHA 2V6YA 2R6GF 5LCYA 2L9QA 4CXXA 2KMFA 4YSYA 1B7TA 4QH1A 4ZI2C 3OYZA 5JR9B 2XY8B 4YMVC 4ZZCA 3AE7A 3AEDA 3PUGA 5JDLA 1FMVA 4I0UA 3ANWA 3AAAB 1UCUA 2ZMAA 3K8PC 4YJ3E 1MNDA 4ZI7E 3N2OA 3JCFA 4U2ZA 3L39A 4UELA 4OYJA 2LEHA 4TZ4C 4HWFA 4MHCA 5LBQB 3AVSA 5AQVB 5F3JA 3AEGA 3RHWA 4LFBT 1OXZA 2J47A 4TWFA 4ZS3A 3SFEA 2LSIA 2UXXB 3K3QC 5HYAA 2XQ9A 3ETVA 4ILAA 2ODUA 3NRXA 1IBKT 4YMUC 4KI0F 2V6YB 3IA3A 2XM2A 4PJJA 2WB5A 3ETUA 4A5XA 4ANJA 2PG8A 2V6XA 3PU3A 3I9WA 2NW7A 1XMOT 2LE8A 2W4XA 1US7B 2WCAA 4KP3C 2XQ6A 3X1DA 5LG3A 1H7CA 4TWDA 3OTOT 2EHOA 3UQ7A 3PUSA 3J9X1 3JADA 1S35A 2BBJA 3J7Yq 4DBRA 4GIWA 3T1YT 2YKSA 4A97A 2KXPB 4X1IE 5EZYE 3RF1A 1OEDA 3TUIA 1UX5A 4EAHA 4ZEYA 3RC8A 4N78D 4XTCM 4FJOA 4WBOA 2CWYA 3RRCA 4XBFB 4CI1B 5HEGA 4G63A 2L3LA 4YJ2E 2BKNA 2N1GA 4Z8XA 4EYUA 5CFBA 4CXWA 2VK9A 4DUYT 4B3RT 5FKYA 3OVUA 3JC6C 4TN7B 2LLYA 3E08A 2XQ3A 4TV9E 4LFCT 3ZMVB 3KDSE 2LSGA 1LKXA 4JLEA 2XAQB 5JDMA 3ONLC 2HN2A 4IHJE 4PK4A 4OHFA 3GN5B 2WDRA 2R6GG 5FVKA 3H37A 2MBGA 3UUMA 4LF7T 4IDZA 5AQSB 5ETWA 1E1HB 1W9RA 2DHRA 4O4IE 4WYVA 5A1LA 4PJMA 1CUNA 4HFCA 4KMCA 4PK5A 3K3NA 4IL9A 3R6NA 5CJ5A 1Z0PA 4KUMB 4GK5E 3RLFG 2L8KA 5EK3A 5JDFA 4EYYR 1AJ3A 5L47A 2X9WA 4WNKA 5AQHB 3RLFF 2CPTA 1EZ3A 1BR2A 2ONKC 1UX4A 2BVLA 4BA9A 2YEVC 1NWMX 4KHPT 3ZYKA 3FXDB 2CE7A 1XZYA 2MTQA 3O1HA 2XAJB 2Q9QC 3HKDE 1GQEA 2M6BA 4MBQA 4ERRA 5AQKB 4AQGA 3TLTA 2X9HA 3GN5A 3PUZG 1LVFA 2J1DG 4QKNA 4DMWA 1JNRA 2XM1A 2YINA 3ONXA 2JRKA 4FI5A 3PUVG 4XTCN 2LOSA 4B6XA 5AQUB 3CQGB 3BQLA 3FZHB 2KNDA 4EXTA 4DV7T 3P4PA 4X5TA 2DNXA 3AEAA 2X66A 4CI3B 4WBNE 2I59A 3RI5A 5KDMC 3BQIA 2CLYC 3P4WA 5KXJA 4ISSA 3C98B 5LJMA 2DL1A 2WU5A 2BG9B 2D2SA 3UU3A 2IC9A 4GKJT 3AAEB 3Q5XA 2E9XA 4QX8B 3WAJA 2OV9A 3CX8B 1ZEEA 2A2FX 1NEKA 1T8BA 2N9DA 3PUVF 1MMDA 4CQIA 3QNUA 2XAGB 2VURA 2V8SV 4PFOA 4Z90A
chains in the Genus database with same CATH topology
4KI0G 4XIGN 4TQUM 4JBWG 3PUWG 4KHZF 3D31C 3TUJA 3PUZG 4XIGM 4KHZG 3PUZF 3PUVG 3PUXF 4XTCN 3TUZA 4TQUN 4YMUC 4KI0F 3PV0F 4YMSC 2R6GG 3PV0G 4JBWF 3PUWF 2R6GF 3DHWA 4YMVC 3PUXG 3PUYF 3RLFG 3PUVF 4YMWC 3PUYG 3RLFF 2ONKC 3TUIA 4YMTB 4XTCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI0 G;  4XIG N;  4TQU M;  4JBW G;  3PUW G;  4KHZ F;  3D31 C;  3TUJ A;  3PUZ G;  4XIG M;  4KHZ G;  3PUZ F;  3PUV G;  3PUX F;  4XTC N;  3TUZ A;  4TQU N;  4YMU C;  4KI0 F;  3PV0 F;  4YMS C;  2R6G G;  3PV0 G;  4JBW F;  3PUW F;  2R6G F;  3DHW A;  4YMV C;  3PUX G;  3PUY F;  3RLF G;  3PUV F;  4YMW C;  3PUY G;  3RLF F;  2ONK C;  3TUI A;  4YMT B;  4XTC M; 
#chains in the Genus database with same CATH topology
 2IUB A;  3NRY A;  4KX6 A;  3QUJ A;  4IT4 A;  3C4W A;  4O8S A;  4DV2 T;  1SA0 E;  3QOF A;  3FB2 A;  4X62 T;  1ZKE A;  2WZH A;  2K24 A;  2PTF A;  2FBW A;  4JUY A;  2JQ9 A;  4UV8 B;  3RX6 A;  2XQ8 A;  3BK9 A;  3VU7 H;  1T98 A;  2BZB A;  3ZCJ A;  4DV3 T;  4DV5 T;  4GK0 E;  4U7I A;  2K48 A;  4H9R C;  3IF8 B;  3RIF A;  2XSB A;  3VRA A;  4H63 V;  2CM0 A;  3DP7 A;  2YDR A;  2FJD A;  4HFB A;  3O1I A;  3B57 A;  3KBU A;  3VRB A;  2D0T A;  2E8I A;  3GA8 A;  4NIQ A;  2NR4 A;  1WFD A;  4TWH A;  3EHZ A;  3UU6 A;  2KLQ A;  1HR0 T;  3L09 A;  1VCT A;  2Q9Q A;  4H9N C;  5LB7 B;  4DR5 T;  5FY1 A;  4X66 T;  3ESL A;  1FMW A;  4DUZ T;  4LF6 T;  4B3M T;  2LM2 A;  3DTO A;  3ZMZ B;  1U5P A;  1ZOY A;  3P8C D;  4HGA A;  4AKI A;  4AQF C;  3FXE B;  3VKH A;  2CLY B;  2DI4 A;  4U31 A;  5FY7 A;  3P4R A;  2LM9 A;  5FNV E;  4HFH A;  5LA6 E;  2A72 A;  4CI2 B;  4YMT B;  2C5J A;  2ZM2 A;  1MMN A;  4TX5 A;  2WY2 A;  3N9O A;  3RIU A;  3ZST A;  1N34 T;  4XIG N;  1OED B;  3AXJ A;  4YTP A;  3UUB A;  4DV6 T;  1E2A A;  3QK6 A;  3RYF E;  5LNK A;  4DR3 T;  3F31 A;  3PDY A;  3TLU A;  3EUH A;  3I0Q A;  4P09 A;  4IIJ E;  4LMK A;  5FY0 A;  2JMK A;  2LHN A;  3PUZ F;  2PJQ A;  4PJN A;  2Q9Q B;  3AE4 A;  4UVC B;  3TUZ A;  3VKG A;  5CA1 E;  1O3X A;  2KSR A;  2XQA A;  3PUA A;  2PFV A;  5HEU A;  5HEH A;  3H3M A;  4YMS C;  4HEA A;  4G2A A;  4DR2 T;  4EIW A;  2I0M A;  3T1H T;  3P7I A;  5TAO A;  2WS3 A;  4PW8 A;  1HNX T;  2WMN A;  4DO0 A;  3AA0 B;  4AKH A;  3AAI A;  3ZC1 A;  4HWD A;  4JI8 T;  4DR7 T;  1WR6 A;  1OED C;  1DU2 A;  4U74 A;  2Z6E A;  2NW9 A;  3UUN A;  2FJA A;  3DJB A;  5L3B B;  5AQR B;  4WZX A;  5F8P A;  3SFD A;  2JQK A;  4OFZ A;  3CX6 B;  1BR0 A;  4TNW A;  3Q2M A;  2XPK A;  5FXV A;  4P0A A;  1D0Z A;  2BVM A;  2ES0 A;  4X20 E;  5AQM B;  3RYI E;  3U3I A;  4TUY E;  4B3T T;  2W2U A;  5JRC B;  2MYS A;  3AEC A;  2SPC A;  2XQ5 A;  5CB4 E;  4CZZ B;  4TV8 E;  2KZ7 B;  5AQO B;  3M3Z B;  3AE6 A;  2BS2 A;  1X79 A;  4HE8 A;  1N32 T;  2ACX A;  3FBZ A;  5ABF B;  2LOP A;  2QYW A;  2CRB A;  3CVR A;  2W00 A;  3S4U A;  4IST A;  2FJE A;  2WZI A;  3AEE A;  4ZI3 C;  3R84 B;  2V26 A;  2V7I A;  2IHR 1;  2WDQ A;  1SHZ C;  4HFD A;  4IE4 A;  3UT5 E;  5HEJ A;  3LBX B;  4EZ4 A;  1MIV A;  4A56 A;  3LK3 B;  5LHG B;  1HFA A;  5L3C B;  3KBT A;  4JI7 T;  2KIN B;  2XQ7 A;  5BR8 T;  3PUX G;  2Y8D A;  4JI1 T;  3CX7 B;  3PUY G;  1YXR A;  2X0H A;  2DLR A;  3I0O A;  3O9X A;  2BG9 C;  4CXY A;  4U7Y A;  1M7K A;  4GKK T;  1KNR A;  4PAG A;  1BR1 A;  4KI0 G;  2IDO B;  4O2B E;  5HCJ A;  4TQU M;  1Z8U A;  4JI3 T;  2HPL A;  2H89 A;  4IE6 A;  1W09 A;  2W63 A;  3PUW G;  4BAY B;  5ABF A;  4X64 T;  3D31 C;  1J1J A;  3TUJ A;  2MPK A;  4YHJ A;  1UUR A;  3UFE A;  4EGW A;  3CML A;  1HTJ F;  1YKE B;  2BS3 A;  4DVD A;  4IRE A;  3AE8 A;  2LSK A;  5DQW A;  5E0O A;  4AIU A;  3NZQ A;  5FXZ A;  5EK4 A;  4BJN A;  5J1G A;  5LHI B;  4DR4 T;  5ABG A;  3LSV A;  5GON E;  2WQY A;  4L9I A;  3CWZ B;  5AQT B;  3TLV A;  1MIW A;  3KIN B;  4OK0 A;  4YSZ A;  1KNZ A;  4IDP A;  4QXC B;  4CN4 A;  4HFI A;  5LP6 E;  4JYA T;  2WSS V;  2XZE A;  3I9Y A;  3KVB A;  3AEB A;  2EHO D;  1D1C A;  1MMA A;  4JEH B;  4UF0 A;  2W62 A;  3VHL A;  1IAP A;  3ZYM A;  5CA0 E;  4AI6 A;  4HTE A;  2UXN B;  5LJN A;  2BS4 A;  2JMH A;  2ZM8 A;  3RIA A;  1I6Z A;  3RGL A;  4DV0 T;  4ASK A;  2DWK A;  1YQ4 A;  2DWG A;  3ZMT B;  3ZSS A;  2XAF B;  1ZV4 X;  2VL8 A;  5LG4 A;  5J2U E;  4UVB B;  1IBM T;  1HNZ T;  4LF5 T;  5BMV E;  2WM9 A;  3E0Z A;  1UK5 A;  3ANW B;  3EAM A;  4MLK A;  5L3E B;  2Y48 B;  4O4J E;  5C2T A;  2RA1 A;  3M65 A;  2G0U A;  3JC6 D;  2WBL A;  4IDN A;  4LML A;  4O2A E;  3NZP A;  4L5G A;  4ZXL A;  3ZMS B;  4CN1 A;  1KF6 A;  5LGU B;  2UUB T;  4E7Z A;  1VRB A;  3UU5 A;  3U78 A;  2B1E A;  1YW0 A;  2RP4 A;  5FYM A;  4COF A;  2C5K T;  4JBW F;  2E5L T;  3PUW F;  4EV6 A;  5C3J A;  2VKJ A;  4HWC A;  3FZM B;  4B3S T;  3C50 A;  1SUM B;  5HAX A;  5HXE A;  1OED E;  4H9S E;  1IJ5 A;  5H6Q B;  3VR8 A;  2X68 A;  4YFS A;  1WRD A;  2HHH T;  3GMI A;  5L3D B;  4QWN B;  2ACZ A;  3LJC A;  4K0U A;  4MAL A;  1R8I A;  4PJL A;  2ODV A;  5L2L A;  1XNQ T;  2W0G A;  2W67 A;  3EVY A;  4JI4 T;  3MA9 A;  1IZN B;  4QXH B;  3SWH A;  2IML A;  5L4H A;  3ZT5 A;  1KFY A;  2CBJ A;  5LYJ E;  5IWA T;  2Q9Q D;  4DND A;  3RQW A;  2W66 A;  3P4S A;  3C4Z A;  4EZH A;  5L4E A;  3AB3 B;  2QA7 A;  3ABV A;  4YXD A;  4HFE A;  3AA1 B;  2NOX A;  4LF9 T;  3LDQ B;  3RC3 A;  1WLX A;  1W0B A;  1UGO A;  2V7M A;  4C90 A;  5JDQ A;  2CEA A;  3UFG A;  4NUV A;  5JDG A;  3PV0 G;  1U4Q A;  4LFA T;  1HG5 A;  4IDO A;  3KV4 A;  4AKR B;  5FL1 A;  1CHU A;  1YD8 G;  4LF4 T;  3ZKR A;  4ADZ A;  2FJB A;  4NUU A;  4IE0 A;  3EI0 A;  4E7S A;  4BJM A;  4IL4 A;  3K3O A;  4DID B;  3O4X E;  2V7J A;  3JAF A;  2ZM6 T;  1D1B A;  3P50 A;  2LKG A;  1N36 T;  2XQ4 A;  3ZT6 A;  2X9X A;  4OYK A;  4UR9 A;  5HXC A;  3ZYL A;  1HCI A;  5AQJ B;  3ZMU B;  5JR9 C;  4XIG M;  4QHO A;  4A98 A;  5J0Z A;  5FP3 A;  2IIU A;  2H7O A;  2JPF A;  5HEO A;  3HKB E;  3KV9 A;  4GYR A;  4J2C A;  3NBX X;  4NXN T;  2EHO B;  5IYZ E;  2MOZ A;  1XDP A;  1VCS A;  3EAB A;  4L0R A;  4H9P C;  1WCR A;  1FIO A;  3CKD A;  4HKA A;  4U72 A;  4UV9 B;  2E9X B;  1J5E T;  1FEW A;  2XAS B;  3PJA J;  3LG7 A;  5LGT B;  5IHY A;  2V5D A;  4ILB A;  1LVK A;  2N2N A;  4QH4 A;  4PNI A;  4HN9 A;  4F6R C;  2VWA A;  3RQU A;  3UUX B;  4JI2 T;  4O4L E;  2CBI A;  2XUE A;  4YTN A;  1YQ3 A;  3NKZ A;  4U3C A;  3GWH A;  5LHH B;  2ZM0 A;  1S94 A;  4QXB B;  3ZLI A;  3W15 B;  4I55 E;  5FXX A;  3G06 A;  2LHR A;  3N9M A;  3RYC E;  3ZN0 B;  2VVN A;  3B13 A;  2P9B A;  2CXL A;  2V7K A;  2LT3 A;  3A8Y C;  3FHN A;  2D0U A;  3N9Q A;  2BBH A;  3Q5W A;  4UXN B;  2YK0 A;  2RPA A;  2E9X D;  3Q5E A;  5HCM A;  5LBM A;  2WU2 A;  4U33 A;  4AQF A;  4AQY T;  5FVL A;  2LRL A;  3UU8 A;  3O1J A;  3PU8 A;  2VQE T;  3LBX A;  5L3F B;  4DR6 T;  1IBL T;  1KEY A;  5LMU T;  2PBI A;  3N2G E;  2NW8 A;  1V9D A;  2BKO A;  3IBP A;  4DR1 T;  3LFM A;  3N2K E;  3OKQ A;  4KBM B;  4DMV A;  3E22 E;  2QVA A;  4YHH T;  5J2T E;  2AXD S;  4AKL A;  3CIR A;  4IE5 A;  3ZC0 A;  3ZJ1 A;  3ZN1 B;  2X0Y A;  3PJA A;  4X65 T;  1NAF A;  2H3R A;  4NXM T;  3RPU A;  1HX8 A;  2IAK A;  5HWX A;  3TLS A;  3PUR A;  2X0L B;  5AQQ B;  2Y6X A;  2A3D A;  2CWO A;  2LSJ A;  2V1D B;  2VAS A;  2X9Y A;  3KV6 A;  5F5W A;  1NEN A;  1W0A A;  1Y01 A;  2BKP A;  2K9A A;  3AXJ B;  2J62 A;  3FZF B;  3SS1 A;  4DBQ A;  2UUA T;  4AKG A;  2NTY A;  3RH3 A;  1BR4 A;  5ABH A;  3KV5 A;  4LMJ A;  4OX9 T;  3PUX F;  2YU1 A;  3HA4 A;  1M62 A;  3NVO A;  3AA7 B;  4UIG A;  2CCQ A;  2CA5 A;  2IC6 A;  2JQQ A;  2X51 A;  3MAC A;  1KNP A;  3EDU A;  3OJA A;  3OYX A;  5EK2 A;  3LK4 2;  3Q5D A;  1QUU A;  4QH5 A;  2FUP A;  4XAX B;  5AQI B;  1T72 A;  1XNR T;  3HKE E;  5JDN A;  1E7P A;  3ONJ A;  1MIY A;  2VKO A;  1WYC A;  3C64 A;  1MMG A;  3DHW A;  3N5L A;  2BG9 A;  4EOZ B;  2F4V T;  2YDQ A;  2UXB T;  1UUS A;  2XTL A;  3K1S A;  2JIW A;  1X9B A;  4YMW C;  1J5W A;  4DV4 T;  1N33 T;  1WYB A;  3AA6 B;  4TNV A;  4U2Y A;  5JDH A;  4UVA B;  4AXP A;  4XZC A;  1WR0 A;  3L8R A;  2CXD A;  2B76 A;  2YDS A;  4UF0 B;  3HI2 A;  4JBW G;  2LRK A;  5FXW A;  1D0X A;  4UEM A;  4MFR A;  5LGN B;  5AQN B;  2C0S A;  3MK7 C;  2M67 A;  2YN6 A;  4PFP A;  4JEU B;  4ZOL E;  5FMN A;  2QRX A;  3MXZ A;  3WAK A;  2X67 A;  2UXC T;  5ADX L;  1KK7 A;  2K3W A;  2LJL A;  3HR0 A;  3QC9 A;  3IHR A;  3UTK A;  1XMQ T;  2NP9 A;  3TLW A;  2OLT A;  1D0Y A;  5JR9 A;  3PTR B;  2CMR A;  5AQP B;  1I94 T;  3C4X A;  3N9L A;  3PUQ A;  1G8X A;  3SOL A;  4H63 H;  4JI5 T;  4CN6 A;  2DCF A;  3N9N A;  3PE0 A;  4O4H E;  4X1K E;  2A9U A;  2YOE A;  4LF8 T;  2NTX A;  4C91 A;  5HXS A;  3EDV A;  4IGU A;  4K0K T;  3ZJ2 A;  2AE9 A;  1XWM A;  2E9X C;  3LK2 B;  1XDO A;  4QX7 B;  5DJQ C;  3RKO A;  2K5B B;  3CK6 A;  5AQG B;  4YT0 A;  5HXH A;  3NWI A;  1Y64 B;  3ZCI A;  4P0B A;  2KWI B;  3MZK B;  1QSD A;  2LSY A;  4ZI3 D;  4GOU A;  4YTM A;  4DV1 T;  3SRZ A;  4KHZ G;  3FZK B;  3WI3 A;  2OA5 A;  4M1P A;  2J4G A;  2CXF A;  1LRZ A;  5HXR A;  2BDE A;  2XJ7 A;  2WWV A;  2LKH A;  2JQH A;  3OBV E;  4ZHQ E;  4V1A v;  4P1N A;  3P4Q A;  2H88 A;  2KWH A;  1IJ6 A;  2GK9 A;  2HH7 A;  2V5C A;  3I1A A;  1T7S A;  4HWI B;  3PV0 F;  4EB6 E;  5CGM A;  2VVS A;  3ZT7 A;  5AFU L;  1G73 A;  5H6R B;  3QB5 A;  4EED A;  2M6I A;  4X1Y E;  4JI0 T;  2CHO A;  2VB6 A;  3RIU C;  1HF8 A;  3FBL A;  1FJG T;  3A7M A;  1VOM A;  3F57 A;  3RRW A;  3IEE A;  4ILU A;  4PK6 A;  2C5I T;  3PUY F;  4HWH A;  5KMG P;  3KFW X;  3AE2 A;  3CQC B;  1ZP0 A;  2XQY A;  2WP9 A;  3MJX A;  4H9Q C;  3B5M A;  2VKH A;  3KVA A;  3L3P A;  4HFV A;  2XHE B;  1HNW T;  3VR9 A;  2KT9 A;  3C51 A;  2BG9 E;  4JV5 T;  2CHN A;  3UU4 A;  5DQV A;  5JQG E;  2HPJ A;  4GYS A;  2VKD A;  1HG2 A;  4KHZ F;  2ZLY A;  3CQX C;  2E2A A;  2XAH B;  1YKH B;  1SE7 A;  3AE1 A;  5KX5 E;  3AE9 A;  5L3G B;  5LXT E;  2UU9 T;  3QB5 K;  3AE5 A;  2UXD T;  2WAU A;  5AQL B;  4I4T E;  3T8O A;  3N9P A;  3HL6 A;  3UUL A;  4I50 E;  4ZI2 D;  3CPZ A;  4ILC A;  3Q9D A;  5JRE A;  5JRC A;  5AQF B;  1QLB A;  3V5U A;  1HX1 B;  4NPP A;  3AEF A;  4IDQ A;  2QGS A;  3HKC E;  4YSX A;  2D5U A;  1OWA A;  4H9O C;  5C8Y E;  3UQ4 A;  2WMO A;  4Q25 A;  4WW0 A;  3F2E A;  4F8H A;  1ZHC A;  2NWB A;  4IE7 A;  5ABE A;  5LOV E;  2YU2 A;  2V7L A;  1MNE A;  2XSA A;  5FL0 A;  3RKG A;  3TKL B;  1HS7 A;  4I43 B;  3A5X A;  4Z91 A;  5JTG A;  5LMN T;  3RYH E;  2W61 A;  2VL0 A;  3ZPO A;  3MKD A;  2IW5 B;  3OPC A;  2EHO C;  4EEB A;  3ZEF B;  2HN1 A;  3H3A A;  3AVR A;  4ZZB A;  2VQF T;  1D1A A;  3FZL B;  3V5S A;  4AIS A;  1L0V A;  2UUC T;  3AE3 A;  2MAW A;  5M4Y A;  2E5V A;  2WDV A;  4JI6 T;  3D0T A;  4TQU N;  5IUX A;  5JVD E;  5DAB A;  4YY3 T;  2D9D A;  2I6H A;  3BQK A;  2H7V C;  5JH7 E;  2JJ9 A;  3JAE A;  4ZS2 A;  1JNZ A;  5HWY A;  2WWU A;  4YLH A;  2V6Y A;  2R6G F;  5LCY A;  2L9Q A;  4CXX A;  2KMF A;  4YSY A;  1B7T A;  4QH1 A;  4ZI2 C;  3OYZ A;  5JR9 B;  2XY8 B;  4YMV C;  4ZZC A;  3AE7 A;  3AED A;  3PUG A;  5JDL A;  1FMV A;  4I0U A;  3ANW A;  3AAA B;  1UCU A;  2ZMA A;  3K8P C;  4YJ3 E;  1MND A;  4ZI7 E;  3N2O A;  3JCF A;  4U2Z A;  3L39 A;  4UEL A;  4OYJ A;  2LEH A;  4TZ4 C;  4HWF A;  4MHC A;  5LBQ B;  3AVS A;  5AQV B;  5F3J A;  3AEG A;  3RHW A;  4LFB T;  1OXZ A;  2J47 A;  4TWF A;  4ZS3 A;  3SFE A;  2LSI A;  2UXX B;  3K3Q C;  5HYA A;  2XQ9 A;  3ETV A;  4ILA A;  2ODU A;  3NRX A;  1IBK T;  4YMU C;  4KI0 F;  2V6Y B;  3IA3 A;  2XM2 A;  4PJJ A;  2WB5 A;  3ETU A;  4A5X A;  4ANJ A;  2PG8 A;  2V6X A;  3PU3 A;  3I9W A;  2NW7 A;  1XMO T;  2LE8 A;  2W4X A;  1US7 B;  2WCA A;  4KP3 C;  2XQ6 A;  3X1D A;  5LG3 A;  1H7C A;  4TWD A;  3OTO T;  2EHO A;  3UQ7 A;  3PUS A;  3J9X 1;  3JAD A;  1S35 A;  2BBJ A;  3J7Y q;  4DBR A;  4GIW A;  3T1Y T;  2YKS A;  4A97 A;  2KXP B;  4X1I E;  5EZY E;  3RF1 A;  1OED A;  3TUI A;  1UX5 A;  4EAH A;  4ZEY A;  3RC8 A;  4N78 D;  4XTC M;  4FJO A;  4WBO A;  2CWY A;  3RRC A;  4XBF B;  4CI1 B;  5HEG A;  4G63 A;  2L3L A;  4YJ2 E;  2BKN A;  2N1G A;  4Z8X A;  4EYU A;  5CFB A;  4CXW A;  2VK9 A;  4DUY T;  4B3R T;  5FKY A;  3OVU A;  3JC6 C;  4TN7 B;  2LLY A;  3E08 A;  2XQ3 A;  4TV9 E;  4LFC T;  3ZMV B;  3KDS E;  2LSG A;  1LKX A;  4JLE A;  2XAQ B;  5JDM A;  3ONL C;  2HN2 A;  4IHJ E;  4PK4 A;  4OHF A;  3GN5 B;  2WDR A;  2R6G G;  5FVK A;  3H37 A;  2MBG A;  3UUM A;  4LF7 T;  4IDZ A;  5AQS B;  5ETW A;  1E1H B;  1W9R A;  2DHR A;  4O4I E;  4WYV A;  5A1L A;  4PJM A;  1CUN A;  4HFC A;  4KMC A;  4PK5 A;  3K3N A;  4IL9 A;  3R6N A;  5CJ5 A;  1Z0P A;  4KUM B;  4GK5 E;  3RLF G;  2L8K A;  5EK3 A;  5JDF A;  4EYY R;  1AJ3 A;  5L47 A;  2X9W A;  4WNK A;  5AQH B;  3RLF F;  2CPT A;  1EZ3 A;  1BR2 A;  2ONK C;  1UX4 A;  2BVL A;  4BA9 A;  2YEV C;  1NWM X;  4KHP T;  3ZYK A;  3FXD B;  2CE7 A;  1XZY A;  2MTQ A;  3O1H A;  2XAJ B;  2Q9Q C;  3HKD E;  1GQE A;  2M6B A;  4MBQ A;  4ERR A;  5AQK B;  4AQG A;  3TLT A;  2X9H A;  3GN5 A;  3PUZ G;  1LVF A;  2J1D G;  4QKN A;  4DMW A;  1JNR A;  2XM1 A;  2YIN A;  3ONX A;  2JRK A;  4FI5 A;  3PUV G;  4XTC N;  2LOS A;  4B6X A;  5AQU B;  3CQG B;  3BQL A;  3FZH B;  2KND A;  4EXT A;  4DV7 T;  3P4P A;  4X5T A;  2DNX A;  3AEA A;  2X66 A;  4CI3 B;  4WBN E;  2I59 A;  3RI5 A;  5KDM C;  3BQI A;  2CLY C;  3P4W A;  5KXJ A;  4ISS A;  3C98 B;  5LJM A;  2DL1 A;  2WU5 A;  2BG9 B;  2D2S A;  3UU3 A;  2IC9 A;  4GKJ T;  3AAE B;  3Q5X A;  2E9X A;  4QX8 B;  3WAJ A;  2OV9 A;  3CX8 B;  1ZEE A;  2A2F X;  1NEK A;  1T8B A;  2N9D A;  3PUV F;  1MMD A;  4CQI A;  3QNU A;  2XAG B;  2VUR A;  2V8S V;  4PFO A;  4Z90 A; 
#chains in the Genus database with same CATH homology
 4KI0 G;  4XIG N;  4TQU M;  4JBW G;  3PUW G;  4KHZ F;  3D31 C;  3TUJ A;  3PUZ G;  4XIG M;  4KHZ G;  3PUZ F;  3PUV G;  3PUX F;  4XTC N;  3TUZ A;  4TQU N;  4YMU C;  4KI0 F;  3PV0 F;  4YMS C;  2R6G G;  3PV0 G;  4JBW F;  3PUW F;  2R6G F;  3DHW A;  4YMV C;  3PUX G;  3PUY F;  3RLF G;  3PUV F;  4YMW C;  3PUY G;  3RLF F;  2ONK C;  3TUI A;  4YMT B;  4XTC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...