3PV0F

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
488
structure length
483
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 138
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3pv0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3pv0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3pv0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3pv0F02
4YMUC 3PV0F 4YMTB 4TQUM 2R6GG 3PUXG 3PUXF 3DHWA 4TQUN 4YMSC 4KHZG 4KHZF 3PUWF 3TUJA 3PUWG 2ONKC 4XIGN 4JBWF 3D31C 4XIGM 3TUIA 3PV0G 3TUZA 4YMVC 3PUZG 2R6GF 3PUZF 3PUYF 3PUYG 4XTCN 4YMWC 3PUVF 3RLFG 3PUVG 3RLFF 4XTCM 4KI0G 4JBWG 4KI0F
chains in the Genus database with same CATH superfamily
2YU1A 4WYVA 3VKHA 3PURA 2X9HA 5JDNA 2LRLA 2VVSA 3I1AA 2H89A 5JVDE 4AKIA 5AQRB 5EZYE 5LB7B 2XM2A 2YDSA 2Q9QA 3L3PA 4LFCT 1VOMA 4ASKA 1W9RA 2J4GA 4IDZA 3A7MA 4O4IE 4OX9T 3H37A 1XWMA 2KWIB 3FHNA 4XIGN 4IDNA 5LBMA 1D0ZA 4JI5T 1BR1A 4GKJT 3L09A 2WQYA 2YKSA 4WZXA 2XASB 2X67A 3ZJ1A 3PUSA 2IW5B 3U3IA 5JR9C 5L3DB 4DR6T 4CXYA 1D0YA 4H9PC 3S4UA 2DWKA 4HE8A 3UFGA 4EYYR 4DV2T 5DJQC 3PUVG 3RLFF 4GOUA 2NW9A 2E9XC 4DNDA 2YDRA 4KBMB 4UVCB 1L0VA 5LNKA 5LG4A 2WWVA 2NP9A 2C5IT 2HH7A 2SPCA 2XQ7A 2HN1A 4TV9E 3CX7B 5FMNA 4DV6T 1MMDA 3KDSE 3CX6B 2FBWA 2DCFA 4HN9A 2VURA 3C98B 1Y64B 2ZLYA 4HFIA 4Z8XA 5J2UE 1N36T 2CCQA 3UQ7A 5FL0A 4UELA 1KFYA 5CGMA 2XAGB 4GYRA 2XY8B 5CB4E 2XJ7A 3VRAA 5KMGP 3LFMA 3O1JA 2XHEB 3NZQA 4UEMA 3HKDE 3OPCA 4AISA 4DR7T 2JQHA 2KSRA 3TUIA 3Q2MA 3AEEA 5EK4A 3AE7A 3ZYMA 2E5LT 1N33T 5LGUB 2YDQA 3EI0A 2UXDT 2E9XD 2PTFA 2N1GA 2BG9C 2NW7A 3N9QA 3T8OA 2GK9A 4DVDA 5JRCB 3PUVF 3RLFG 2XZEA 3CX8B 3K1SA 4CQIA 2XAFB 4ZZCA 4DV0T 3PUGA 4XAXB 2BKPA 1O3XA 3CMLA 3RX6A 4DUYT 4IDQA 2JIWA 3PUQA 4U31A 4YMUC 3ZN1B 3KFWX 4PK4A 3R84B 4JI1T 1BR4A 3AVSA 1FIOA 3RC3A 2WS3A 1UGOA 2V26A 2WP9A 3C4WA 4AIUA 4ZEYA 2V7MA 2VKOA 2NTYA 3LK3B 3IEEA 4I55E 4ZS3A 4F8HA 5LHIB 4JI6T 4JI0T 3LBXB 3FBLA 4CI3B 1HX8A 5JR9B 3RIFA 2ONKC 2D9DA 2E9XA 2DL1A 4LF7T 4LFAT 4HWHA 3D31C 4EYUA 1AJ3A 2K9AA 2YK0A 3L8RA 1WCRA 1ZHCA 4PJJA 2UU9T 5DQWA 2BBHA 1V9DA 5LMNT 5AQJB 4YMWC 3QC9A 5ABGA 4CN1A 5LYJE 3GMIA 2M6IA 2C0SA 3DTOA 3ANWB 2WDQA 3KVBA 3MKDA 5H6RB 2MBGA 2KNDA 2BS4A 2FJBA 2OLTA 3VR8A 4AKGA 2W4XA 1UURA 2I59A 4KX6A 1N32T 1IZNB 4UV8B 3ZPOA 1T98A 1JNZA 2NTXA 4UF0B 5LOVE 5L3EB 1OEDE 4HFCA 4TNWA 4GKKT 2VKDA 2R6GG 3PUXG 2LJLA 3KV5A 3P50A 3CKDA 4V1Av 4QXCB 4YTNA 3ZT6A 2IUBA 1XDOA 4HGAA 4HFVA 4XZCA 3TLWA 4NUUA 3SRZA 4UR9A 4PJMA 2QVAA 4G2AA 2I0MA 1US7B 2X68A 3H3MA 4MFRA 5AQKB 4H9NC 4TZ4C 3UQ4A 2CRBA 2WB5A 3KBUA 3PU3A 4QWNB 1WR6A 4NXNT 4IE4A 5AQFB 2UXNB 2WSSV 4U33A 5EK3A 5HXEA 3ZT5A 2W0GA 3PUYG 4DR4T 3WI3A 4Q25A 4U7IA 2D0UA 1MIVA 3U78A 3HKCE 2ZM0A 1WLXA 3F31A 1W09A 2EHOD 1YD8G 2X51A 3TUJA 1MIYA 2YOEA 1HF8A 2BS2A 2OA5A 3D0TA 2XPKA 5HXHA 3PV0F 3PUAA 1KK7A 3K3QC 5GONE 3P4RA 4YHHT 5L47A 3E22E 3JCFA 2XQ6A 5JDMA 3W15B 5AQHB 3JAEA 5AFUL 4TV8E 1KF6A 2NW8A 3N9PA 3PDYA 4QXHB 4YFSA 2WU5A 4P1NA 3SS1A 4B6XA 4DR3T 2CMRA 3HA4A 4JI4T 1M7KA 1UUSA 2J62A 3P7IA 4U2ZA 5J2TE 2KINB 3FXEB 2BVMA 5AQLB 3F57A 2WCAA 3CK6A 3FXDB 2W2UA 4P09A 4YMVC 2W62A 2DWGA 4JV5T 1UK5A 2EHOC 3CWZB 3JC6C 3IA3A 3GN5A 4LF5T 5FVLA 3GA8A 1IBKT 2ACXA 2X9YA 4U72A 1YQ4A 3OJAA 3M3ZB 5FXZA 5FKYA 1OEDB 4A56A 4AKRB 3PJAJ 3UUMA 2D5UA 3QUJA 4O2AE 4N78D 1WYBA 3NBXX 1I94T 3NRXA 2WY2A 3UUBA 4C91A 2C5JA 4DR2T 4LF9T 3AE5A 1HS7A 5HXRA 2YEVC 3UUXB 2YINA 4OK0A 2CLYC 2DNXA 3PUWF 1LVKA 2H88A 2Z6EA 3TKLB 1WRDA 2HHHT 3C50A 4CN4A 5LGTB 5ABEA 2LOSA 4X20E 4OHFA 2H7OA 3MZKB 3RQUA 3TUZA 1W0BA 1XDPA 1FMWA 3AA6B 3BQLA 3DP7A 3KVAA 3RHWA 3O1HA 2B1EA 3ZT7A 4EIWA 2XAHB 3FZHB 3FZMB 4Z91A 4QHOA 1XNQT 4CI1B 5LG3A 4O4JE 2KLQA 5AQPB 5DABA 3WAJA 3CVRA 4QH1A 3VU7H 3N2KE 3PU8A 5ETWA 1HR0T 2DHRA 3OVUA 5LHGB 4JLEA 4YTMA 1H7CA 5LXTE 3RC8A 3AEDA 2VL0A 3HI2A 3CQGB 5IHYA 3ZJ2A 2BG9E 1CUNA 3FZFB 3OBVE 1QLBA 3ONXA 2QRXA 4WBOA 5IYZE 5JTGA 2WZIA 2V7JA 3JAFA 1SUMB 2LT3A 3IF8B 4HWCA 4KUMB 4U74A 3KV6A 3B57A 4HFDA 2VQFT 4DV7T 3LSVA 2CWOA 4QX8B 2BKNA 4UF0A 2XTLA 2V5CA 5AQVB 3T1YT 4JYAT 5JREA 4PFPA 3PUZG 5J0ZA 4LF4T 2JQQA 4L0RA 1QSDA 3K8PC 3TLSA 4EZHA 2BS3A 2H3RA 3C51A 3Q5XA 2Q9QC 5JDLA 4ISSA 2EHOB 2CXFA 3Q5EA 4XTCM 3NKZA 4IDOA 4QXBB 1SA0E 5IWAT 2J1DG 2E5VA 3E08A 3UU4A 5L3BB 2K24A 3AE8A 3MA9A 1Y01A 1IJ5A 5ABFB 1HG5A 2LSIA 3RYIE 5L2LA 4HFEA 3N5LA 3AAEB 3NWIA 1D1CA 3AXJB 3L39A 3P4PA 4EGWA 5IUXA 3UT5E 1YKEB 4H63V 1OEDC 2QGSA 2V7IA 4IE7A 3TLVA 1UX5A 4E7ZA 4QX7B 4H63H 3PUWG 4PW8A 3RQWA 4L5GA 4ANJA 3UFEA 4JBWF 1Z0PA 2I6HA 5HAXA 4K0UA 5LHHB 5C2TA 5HCJA 1NWMX 5DQVA 4IREA 5FP3A 5HEOA 4DMVA 3QNUA 4ILAA 1HG2A 2BVLA 4OFZA 1FEWA 5FY1A 1T72A 2NOXA 1GQEA 3HL6A 3RRWA 4C90A 3SFDA 5FXVA 5LP6E 4DMWA 1YKHB 5LGNB 2WWUA 3V5UA 4YLHA 2KT9A 4X64T 4EEDA 1XMOT 4U2YA 1J5WA 3ZCIA 2D2SA 4IL9A 3SFEA 5FY7A 2K48A 3P4SA 2VB6A 3O9XA 4EZ4A 2ZM6T 5HYAA 1FMVA 4DV3T 2BG9B 4GYSA 3EDUA 3GWHA 2LSJA 4NUVA 2RPAA 3RKGA 3ZMSB 3UU5A 3ZYKA 4ZOLE 4NPPA 4JI7T 1ZP0A 2DI4A 2PJQA 2LM2A 3GN5B 3JADA 2V8SV 3I0QA 4PAGA 5FXXA 5JRCA 4KHZF 3PTRB 1J1JA 3MACA 2QA7A 3N9MA 4UXNB 2H7VC 3CIRA 2A9UA 2AE9A 1LKXA 4U3CA 1T7SA 1HFAA 3AEGA 5CJ5A 1OEDA 2AXDS 2KXPB 3O1IA 2LSGA 3AE2A 1WFDA 2LSYA 3C4ZA 4MALA 4XIGM 2W63A 3CQXC 4U7YA 2FUPA 5HWYA 2VQET 2RA1A 5F8PA 3AA1B 5L3GB 2NR4A 3N2GE 3Q5WA 4GIWA 5H6QB 2L3LA 3ZEFB 3N2OA 4B3MT 2A72A 4PJNA 2ODVA 3BQKA 3LDQB 1IJ6A 2KZ7B 3RH3A 4E7SA 2UUCT 4PFOA 1ZKEA 2N2NA 2X9WA 4JBWG 2E9XB 1R8IA 3BK9A 3EAMA 3ESLA 3NZPA 4I4TE 4YSYA 2FJDA 5JQGE 2Y6XA 3ZMZB 3RRCA 3EUHA 2WU2A 5HWXA 4GK0E 2XUEA 1NENA 3NVOA 4AQFC 5HEGA 4YXDA 4LMKA 3AEFA 4TWHA 4YSXA 2KMFA 3K3NA 2XM1A 3ANWA 3I9WA 5LMUT 5F3JA 4EEBA 2X0YA 2A2FX 4EAHA 2IHR1 2RP4A 2V7KA 2BDEA 2XSAA 4ZI7E 3AE9A 4QKNA 2M6BA 2J47A 2F4VT 1X9BA 2X0LB 1D1AA 1S35A 3ZSSA 2P9BA 1M62A 3P4QA 5AQTB 4YY3T 1BR0A 2D0TA 1BR2A 4PJLA 2LHRA 3I9YA 4X1YE 3EABA 3IHRA 5BMVE 2CWYA 3QOFA 4J2CA 4X1IE 2YN6A 2V6YA 3MXZA 1MMNA 2C5KT 2JPFA 1VRBA 3Q5DA 4AI6A 4KP3C 5HEHA 4QH4A 2ZMAA 4YJ3E 4X66T 4ZZBA 3RYCE 3ZC1A 2X0HA 4CN6A 4JI2T 2CBIA 4A5XA 4BAYB 4ZI2C 2NWBA 5AQOB 3ZMVB 3Q9DA 4AKHA 1SE7A 5FNVE 2KWHA 4UV9B 4HEAA 1U4QA 2ODUA 1KNZA 2PBIA 1VCTA 5FXWA 1OWAA 2A3DA 2IC6A 3ZSTA 4A97A 5L4HA 4F6RC 5JH7E 3F2EA 2LOPA 4EB6E 4YT0A 1HNZT 1UX4A 4X62T 2LHNA 3UU8A 3PJAA 4DV1T 2WM9A 3AE6A 3RYHE 5HEUA 3AXJA 1MMGA 2R6GF 4P0BA 2FJAA 4XTCN 4H9OC 5BR8T 2CBJA 4BJMA 5L4EA 3EHZA 3FZKB 4AKLA 4ZI2D 4WW0A 3UU3A 3KV4A 2BBJA 3ONJA 4ZI3C 3P8CD 1U5PA 3B13A 1MNEA 1HTJF 3N9LA 1HCIA 2YU2A 5HCMA 4YJ2E 2CM0A 4H9SE 4TNVA 1LRZA 4JI8T 4YMTB 3TLTA 2XQ3A 3ZKRA 3DJBA 3HR0A 5LA6E 2DLRA 3OYXA 4H9RC 3ZCJA 3O4XE 4HFHA 3ZLIA 4IL4A 3BQIA 4ISTA 5CA0E 3P4WA 4GK5E 4OYKA 4DBRA 2UUAT 4LF6T 1G8XA 2LM9A 4KHZG 2LLYA 2WDRA 3CPZA 4EV6A 4NXMT 3AVRA 5FY0A 3VRBA 2JMKA 2JQ9A 1UCUA 1W0AA 3ZMUB 4A98A 1D0XA 1MIWA 2JQKA 4PK6A 1JNRA 3JC6D 5LJMA 4ZS2A 4LFBT 2W67A 5AQQB 2BG9A 4HKAA 2MYSA 3VKGA 4YSZA 4O4HE 3RIAA 3KINB 1WYCA 1KEYA 1T8BA 3VR9A 5C8YE 4DR1T 4AQYT 4DR5T 2QYWA 4JEHB 4MLKA 3LJCA 3N9OA 3AECA 5LJNA 2K3WA 4B3RT 4IE0A 2FJEA 3C64A 2M67A 2VWAA 3E0ZA 3LG7A 1QUUA 4KI0G 4MHCA 4KI0F 5JR9A 4LMLA 4OYJA 5ADXL 3ZMTB 4I0UA 4IT4A 2Q9QD 4BJNA 3H3AA 3NRYA 4TQUM 1VCSA 4TWDA 1B7TA 5FVKA 4XBFB 1N34T 2VVNA 1E2AA 3DHWA 4X65T 2WDVA 2L8KA 4ILUA 4UVAB 4YMSC 2CE7A 3HKEE 1MMAA 2UXXB 2LEHA 2LKGA 3KBTA 1EZ3A 4ADZA 2VL8A 1HNXT 4KHPT 1KNPA 5EK2A 4M1PA 4PK5A 1E7PA 3C4XA 4CI2B 1YW0A 4CXWA 5M4YA 5TAOA 4TN7B 4PNIA 5JDQA 1FJGT 5FYMA 1ZV4X 2XQ5A 3PUYF 4IDPA 3ETVA 3OTOT 4DO0A 4DV4T 3WAKA 2IIUA 1NAFA 2Q9QB 3UTKA 3EDVA 3UULA 1HX1B 4DV5T 3ONLC 2VASA 4IE5A 5AQSB 4I50E 2W66A 5A1LA 1YXRA 2JJ9A 2VKJA 5E0OA 4MBQA 3AAIA 3QB5K 3B5MA 1CHUA 1KNRA 5J1GA 2IMLA 4CZZB 4YTPA 2LRKA 2CXDA 1YQ3A 3AAAB 4YHJA 3AEAA 4IHJE 4ILCA 4O8SA 4LF8T 2W00A 2CHOA 3M65A 2BZBA 3N9NA 3PUXF 1OXZA 2WMNA 2XAJB 5AQNB 1I6ZA 3HKBE 2LSKA 3RI5A 4AXPA 2XQ9A 2EHOA 4ILBA 2XQ8A 3I0OA 4HTEA 5JDGA 2V6YB 2XQAA 3UUNA 4ZHQE 4HWIB 4KMCA 4FJOA 3RYFE 1ZOYA 2MTQA 5ABFA 4QH5A 5AQUB 3RGLA 3UU6A 2ACZA 4EXTA 4IE6A 2L9QA 2MAWA 2WZHA 3RKOA 4UIGA 2V5DA 3MK7C 3FBZA 2ZM8A 4G63A 2X66A 1Z8UA 3OYZA 2WBLA 4IGUA 3ABVA 4DIDB 1XMQT 2G0UA 2XQ4A 2HPLA 4Z90A 2HN2A 3FB2A 3J7Yq 3SOLA 3A5XA 2VK9A 4BA9A 2ES0A 5JDHA 1D1BA 1S94A 3QB5A 3X1DA 3J9X1 2CLYB 3AE3A 2Y8DA 2UUBT 3TLUA 4B3TT 2CA5A 1IBLT 4CXXA 5ABHA 3IBPA 2BKOA 1SHZC 5JDFA 3ZN0B 3ZYLA 4DBQA 5LBQB 4ZXLA 4EOZB 2ZM2A 5AQGB 5KXJA 3SWHA 3RPUA 4B3ST 5HEJA 5C3JA 1IBMT 4X1KE 3AE4A 2XQYA 2K5BB 1XNRT 3RIUC 2XAQB 2WMOA 3PUZF 4LMJA 2V6XA 2V7LA 2N9DA 4HFBA 1NEKA 2MPKA 4I43B 5LCYA 5L3FB 3AA7B 3T1HT 2E8IA 1MNDA 2JMHA 2XSBA 3LBXA 3AB3B 4H9QC 3RIUA 2PFVA 2JRKA 1IAPA 3OKQA 4AQGA 5CA1E 1HNWT 5FL1A 5KDMC 4WBNE 3AEBA 4HWDA 2V1DB 4K0KT 1G73A 3PE0A 4IIJE 1E1HB 3CQCB 3MJXA 4AQFA 1WR0A 3VHLA 2Y48B 3LK2B 3LK42 2HPJA 4JI3T 3G06A 4ZI3D 3V5SA 4TQUN 3RF1A 5KX5E 2IAKA 2CHNA 3FZLB 1LVFA 2IDOB 3R6NA 3EVYA 3K3OA 4FI5A 5AQIB 4TX5A 5CFBA 4X5TA 4P0AA 1DU2A 4HWFA 4NIQA 4DUZT 4TUYE 2CXLA 2CEAA 3ETUA 2E2AA 2UXCT 3PV0G 2MOZA 4TWFA 2WAUA 5AQMB 3A8YC 1ZEEA 5HXCA 5HXSA 3ZC0A 1XZYA 2W61A 1X79A 2LE8A 2VKHA 5F5WA 2IC9A 4L9IA 5L3CB 4O4LE 3QK6A 4JUYA 4UVBB 4WNKA 3AA0B 2X9XA 2UXBT 4O2BE 3KV9A 4JEUB 2OV9A 2PG8A 2B76A 4COFA 1J5ET 2LKHA 4ERRA 3AE1A 2CPTA
chains in the Genus database with same CATH topology
4YMUC 3PV0F 4YMTB 4TQUM 2R6GG 3PUXG 3PUXF 3DHWA 4TQUN 4YMSC 4KHZG 4KHZF 3PUWF 3TUJA 3PUWG 2ONKC 4XIGN 4JBWF 3D31C 4XIGM 3TUIA 3PV0G 3TUZA 4YMVC 3PUZG 2R6GF 3PUZF 3PUYF 3PUYG 4XTCN 4YMWC 3PUVF 3RLFG 3PUVG 3RLFF 4XTCM 4KI0G 4JBWG 4KI0F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMU C;  3PV0 F;  4YMT B;  4TQU M;  2R6G G;  3PUX G;  3PUX F;  3DHW A;  4TQU N;  4YMS C;  4KHZ G;  4KHZ F;  3PUW F;  3TUJ A;  3PUW G;  2ONK C;  4XIG N;  4JBW F;  3D31 C;  4XIG M;  3TUI A;  3PV0 G;  3TUZ A;  4YMV C;  3PUZ G;  2R6G F;  3PUZ F;  3PUY F;  3PUY G;  4XTC N;  4YMW C;  3PUV F;  3RLF G;  3PUV G;  3RLF F;  4XTC M;  4KI0 G;  4JBW G;  4KI0 F; 
#chains in the Genus database with same CATH topology
 2YU1 A;  4WYV A;  3VKH A;  3PUR A;  2X9H A;  5JDN A;  2LRL A;  2VVS A;  3I1A A;  2H89 A;  5JVD E;  4AKI A;  5AQR B;  5EZY E;  5LB7 B;  2XM2 A;  2YDS A;  2Q9Q A;  3L3P A;  4LFC T;  1VOM A;  4ASK A;  1W9R A;  2J4G A;  4IDZ A;  3A7M A;  4O4I E;  4OX9 T;  3H37 A;  1XWM A;  2KWI B;  3FHN A;  4XIG N;  4IDN A;  5LBM A;  1D0Z A;  4JI5 T;  1BR1 A;  4GKJ T;  3L09 A;  2WQY A;  2YKS A;  4WZX A;  2XAS B;  2X67 A;  3ZJ1 A;  3PUS A;  2IW5 B;  3U3I A;  5JR9 C;  5L3D B;  4DR6 T;  4CXY A;  1D0Y A;  4H9P C;  3S4U A;  2DWK A;  4HE8 A;  3UFG A;  4EYY R;  4DV2 T;  5DJQ C;  3PUV G;  3RLF F;  4GOU A;  2NW9 A;  2E9X C;  4DND A;  2YDR A;  4KBM B;  4UVC B;  1L0V A;  5LNK A;  5LG4 A;  2WWV A;  2NP9 A;  2C5I T;  2HH7 A;  2SPC A;  2XQ7 A;  2HN1 A;  4TV9 E;  3CX7 B;  5FMN A;  4DV6 T;  1MMD A;  3KDS E;  3CX6 B;  2FBW A;  2DCF A;  4HN9 A;  2VUR A;  3C98 B;  1Y64 B;  2ZLY A;  4HFI A;  4Z8X A;  5J2U E;  1N36 T;  2CCQ A;  3UQ7 A;  5FL0 A;  4UEL A;  1KFY A;  5CGM A;  2XAG B;  4GYR A;  2XY8 B;  5CB4 E;  2XJ7 A;  3VRA A;  5KMG P;  3LFM A;  3O1J A;  2XHE B;  3NZQ A;  4UEM A;  3HKD E;  3OPC A;  4AIS A;  4DR7 T;  2JQH A;  2KSR A;  3TUI A;  3Q2M A;  3AEE A;  5EK4 A;  3AE7 A;  3ZYM A;  2E5L T;  1N33 T;  5LGU B;  2YDQ A;  3EI0 A;  2UXD T;  2E9X D;  2PTF A;  2N1G A;  2BG9 C;  2NW7 A;  3N9Q A;  3T8O A;  2GK9 A;  4DVD A;  5JRC B;  3PUV F;  3RLF G;  2XZE A;  3CX8 B;  3K1S A;  4CQI A;  2XAF B;  4ZZC A;  4DV0 T;  3PUG A;  4XAX B;  2BKP A;  1O3X A;  3CML A;  3RX6 A;  4DUY T;  4IDQ A;  2JIW A;  3PUQ A;  4U31 A;  4YMU C;  3ZN1 B;  3KFW X;  4PK4 A;  3R84 B;  4JI1 T;  1BR4 A;  3AVS A;  1FIO A;  3RC3 A;  2WS3 A;  1UGO A;  2V26 A;  2WP9 A;  3C4W A;  4AIU A;  4ZEY A;  2V7M A;  2VKO A;  2NTY A;  3LK3 B;  3IEE A;  4I55 E;  4ZS3 A;  4F8H A;  5LHI B;  4JI6 T;  4JI0 T;  3LBX B;  3FBL A;  4CI3 B;  1HX8 A;  5JR9 B;  3RIF A;  2ONK C;  2D9D A;  2E9X A;  2DL1 A;  4LF7 T;  4LFA T;  4HWH A;  3D31 C;  4EYU A;  1AJ3 A;  2K9A A;  2YK0 A;  3L8R A;  1WCR A;  1ZHC A;  4PJJ A;  2UU9 T;  5DQW A;  2BBH A;  1V9D A;  5LMN T;  5AQJ B;  4YMW C;  3QC9 A;  5ABG A;  4CN1 A;  5LYJ E;  3GMI A;  2M6I A;  2C0S A;  3DTO A;  3ANW B;  2WDQ A;  3KVB A;  3MKD A;  5H6R B;  2MBG A;  2KND A;  2BS4 A;  2FJB A;  2OLT A;  3VR8 A;  4AKG A;  2W4X A;  1UUR A;  2I59 A;  4KX6 A;  1N32 T;  1IZN B;  4UV8 B;  3ZPO A;  1T98 A;  1JNZ A;  2NTX A;  4UF0 B;  5LOV E;  5L3E B;  1OED E;  4HFC A;  4TNW A;  4GKK T;  2VKD A;  2R6G G;  3PUX G;  2LJL A;  3KV5 A;  3P50 A;  3CKD A;  4V1A v;  4QXC B;  4YTN A;  3ZT6 A;  2IUB A;  1XDO A;  4HGA A;  4HFV A;  4XZC A;  3TLW A;  4NUU A;  3SRZ A;  4UR9 A;  4PJM A;  2QVA A;  4G2A A;  2I0M A;  1US7 B;  2X68 A;  3H3M A;  4MFR A;  5AQK B;  4H9N C;  4TZ4 C;  3UQ4 A;  2CRB A;  2WB5 A;  3KBU A;  3PU3 A;  4QWN B;  1WR6 A;  4NXN T;  4IE4 A;  5AQF B;  2UXN B;  2WSS V;  4U33 A;  5EK3 A;  5HXE A;  3ZT5 A;  2W0G A;  3PUY G;  4DR4 T;  3WI3 A;  4Q25 A;  4U7I A;  2D0U A;  1MIV A;  3U78 A;  3HKC E;  2ZM0 A;  1WLX A;  3F31 A;  1W09 A;  2EHO D;  1YD8 G;  2X51 A;  3TUJ A;  1MIY A;  2YOE A;  1HF8 A;  2BS2 A;  2OA5 A;  3D0T A;  2XPK A;  5HXH A;  3PV0 F;  3PUA A;  1KK7 A;  3K3Q C;  5GON E;  3P4R A;  4YHH T;  5L47 A;  3E22 E;  3JCF A;  2XQ6 A;  5JDM A;  3W15 B;  5AQH B;  3JAE A;  5AFU L;  4TV8 E;  1KF6 A;  2NW8 A;  3N9P A;  3PDY A;  4QXH B;  4YFS A;  2WU5 A;  4P1N A;  3SS1 A;  4B6X A;  4DR3 T;  2CMR A;  3HA4 A;  4JI4 T;  1M7K A;  1UUS A;  2J62 A;  3P7I A;  4U2Z A;  5J2T E;  2KIN B;  3FXE B;  2BVM A;  5AQL B;  3F57 A;  2WCA A;  3CK6 A;  3FXD B;  2W2U A;  4P09 A;  4YMV C;  2W62 A;  2DWG A;  4JV5 T;  1UK5 A;  2EHO C;  3CWZ B;  3JC6 C;  3IA3 A;  3GN5 A;  4LF5 T;  5FVL A;  3GA8 A;  1IBK T;  2ACX A;  2X9Y A;  4U72 A;  1YQ4 A;  3OJA A;  3M3Z B;  5FXZ A;  5FKY A;  1OED B;  4A56 A;  4AKR B;  3PJA J;  3UUM A;  2D5U A;  3QUJ A;  4O2A E;  4N78 D;  1WYB A;  3NBX X;  1I94 T;  3NRX A;  2WY2 A;  3UUB A;  4C91 A;  2C5J A;  4DR2 T;  4LF9 T;  3AE5 A;  1HS7 A;  5HXR A;  2YEV C;  3UUX B;  2YIN A;  4OK0 A;  2CLY C;  2DNX A;  3PUW F;  1LVK A;  2H88 A;  2Z6E A;  3TKL B;  1WRD A;  2HHH T;  3C50 A;  4CN4 A;  5LGT B;  5ABE A;  2LOS A;  4X20 E;  4OHF A;  2H7O A;  3MZK B;  3RQU A;  3TUZ A;  1W0B A;  1XDP A;  1FMW A;  3AA6 B;  3BQL A;  3DP7 A;  3KVA A;  3RHW A;  3O1H A;  2B1E A;  3ZT7 A;  4EIW A;  2XAH B;  3FZH B;  3FZM B;  4Z91 A;  4QHO A;  1XNQ T;  4CI1 B;  5LG3 A;  4O4J E;  2KLQ A;  5AQP B;  5DAB A;  3WAJ A;  3CVR A;  4QH1 A;  3VU7 H;  3N2K E;  3PU8 A;  5ETW A;  1HR0 T;  2DHR A;  3OVU A;  5LHG B;  4JLE A;  4YTM A;  1H7C A;  5LXT E;  3RC8 A;  3AED A;  2VL0 A;  3HI2 A;  3CQG B;  5IHY A;  3ZJ2 A;  2BG9 E;  1CUN A;  3FZF B;  3OBV E;  1QLB A;  3ONX A;  2QRX A;  4WBO A;  5IYZ E;  5JTG A;  2WZI A;  2V7J A;  3JAF A;  1SUM B;  2LT3 A;  3IF8 B;  4HWC A;  4KUM B;  4U74 A;  3KV6 A;  3B57 A;  4HFD A;  2VQF T;  4DV7 T;  3LSV A;  2CWO A;  4QX8 B;  2BKN A;  4UF0 A;  2XTL A;  2V5C A;  5AQV B;  3T1Y T;  4JYA T;  5JRE A;  4PFP A;  3PUZ G;  5J0Z A;  4LF4 T;  2JQQ A;  4L0R A;  1QSD A;  3K8P C;  3TLS A;  4EZH A;  2BS3 A;  2H3R A;  3C51 A;  3Q5X A;  2Q9Q C;  5JDL A;  4ISS A;  2EHO B;  2CXF A;  3Q5E A;  4XTC M;  3NKZ A;  4IDO A;  4QXB B;  1SA0 E;  5IWA T;  2J1D G;  2E5V A;  3E08 A;  3UU4 A;  5L3B B;  2K24 A;  3AE8 A;  3MA9 A;  1Y01 A;  1IJ5 A;  5ABF B;  1HG5 A;  2LSI A;  3RYI E;  5L2L A;  4HFE A;  3N5L A;  3AAE B;  3NWI A;  1D1C A;  3AXJ B;  3L39 A;  3P4P A;  4EGW A;  5IUX A;  3UT5 E;  1YKE B;  4H63 V;  1OED C;  2QGS A;  2V7I A;  4IE7 A;  3TLV A;  1UX5 A;  4E7Z A;  4QX7 B;  4H63 H;  3PUW G;  4PW8 A;  3RQW A;  4L5G A;  4ANJ A;  3UFE A;  4JBW F;  1Z0P A;  2I6H A;  5HAX A;  4K0U A;  5LHH B;  5C2T A;  5HCJ A;  1NWM X;  5DQV A;  4IRE A;  5FP3 A;  5HEO A;  4DMV A;  3QNU A;  4ILA A;  1HG2 A;  2BVL A;  4OFZ A;  1FEW A;  5FY1 A;  1T72 A;  2NOX A;  1GQE A;  3HL6 A;  3RRW A;  4C90 A;  3SFD A;  5FXV A;  5LP6 E;  4DMW A;  1YKH B;  5LGN B;  2WWU A;  3V5U A;  4YLH A;  2KT9 A;  4X64 T;  4EED A;  1XMO T;  4U2Y A;  1J5W A;  3ZCI A;  2D2S A;  4IL9 A;  3SFE A;  5FY7 A;  2K48 A;  3P4S A;  2VB6 A;  3O9X A;  4EZ4 A;  2ZM6 T;  5HYA A;  1FMV A;  4DV3 T;  2BG9 B;  4GYS A;  3EDU A;  3GWH A;  2LSJ A;  4NUV A;  2RPA A;  3RKG A;  3ZMS B;  3UU5 A;  3ZYK A;  4ZOL E;  4NPP A;  4JI7 T;  1ZP0 A;  2DI4 A;  2PJQ A;  2LM2 A;  3GN5 B;  3JAD A;  2V8S V;  3I0Q A;  4PAG A;  5FXX A;  5JRC A;  4KHZ F;  3PTR B;  1J1J A;  3MAC A;  2QA7 A;  3N9M A;  4UXN B;  2H7V C;  3CIR A;  2A9U A;  2AE9 A;  1LKX A;  4U3C A;  1T7S A;  1HFA A;  3AEG A;  5CJ5 A;  1OED A;  2AXD S;  2KXP B;  3O1I A;  2LSG A;  3AE2 A;  1WFD A;  2LSY A;  3C4Z A;  4MAL A;  4XIG M;  2W63 A;  3CQX C;  4U7Y A;  2FUP A;  5HWY A;  2VQE T;  2RA1 A;  5F8P A;  3AA1 B;  5L3G B;  2NR4 A;  3N2G E;  3Q5W A;  4GIW A;  5H6Q B;  2L3L A;  3ZEF B;  3N2O A;  4B3M T;  2A72 A;  4PJN A;  2ODV A;  3BQK A;  3LDQ B;  1IJ6 A;  2KZ7 B;  3RH3 A;  4E7S A;  2UUC T;  4PFO A;  1ZKE A;  2N2N A;  2X9W A;  4JBW G;  2E9X B;  1R8I A;  3BK9 A;  3EAM A;  3ESL A;  3NZP A;  4I4T E;  4YSY A;  2FJD A;  5JQG E;  2Y6X A;  3ZMZ B;  3RRC A;  3EUH A;  2WU2 A;  5HWX A;  4GK0 E;  2XUE A;  1NEN A;  3NVO A;  4AQF C;  5HEG A;  4YXD A;  4LMK A;  3AEF A;  4TWH A;  4YSX A;  2KMF A;  3K3N A;  2XM1 A;  3ANW A;  3I9W A;  5LMU T;  5F3J A;  4EEB A;  2X0Y A;  2A2F X;  4EAH A;  2IHR 1;  2RP4 A;  2V7K A;  2BDE A;  2XSA A;  4ZI7 E;  3AE9 A;  4QKN A;  2M6B A;  2J47 A;  2F4V T;  1X9B A;  2X0L B;  1D1A A;  1S35 A;  3ZSS A;  2P9B A;  1M62 A;  3P4Q A;  5AQT B;  4YY3 T;  1BR0 A;  2D0T A;  1BR2 A;  4PJL A;  2LHR A;  3I9Y A;  4X1Y E;  3EAB A;  3IHR A;  5BMV E;  2CWY A;  3QOF A;  4J2C A;  4X1I E;  2YN6 A;  2V6Y A;  3MXZ A;  1MMN A;  2C5K T;  2JPF A;  1VRB A;  3Q5D A;  4AI6 A;  4KP3 C;  5HEH A;  4QH4 A;  2ZMA A;  4YJ3 E;  4X66 T;  4ZZB A;  3RYC E;  3ZC1 A;  2X0H A;  4CN6 A;  4JI2 T;  2CBI A;  4A5X A;  4BAY B;  4ZI2 C;  2NWB A;  5AQO B;  3ZMV B;  3Q9D A;  4AKH A;  1SE7 A;  5FNV E;  2KWH A;  4UV9 B;  4HEA A;  1U4Q A;  2ODU A;  1KNZ A;  2PBI A;  1VCT A;  5FXW A;  1OWA A;  2A3D A;  2IC6 A;  3ZST A;  4A97 A;  5L4H A;  4F6R C;  5JH7 E;  3F2E A;  2LOP A;  4EB6 E;  4YT0 A;  1HNZ T;  1UX4 A;  4X62 T;  2LHN A;  3UU8 A;  3PJA A;  4DV1 T;  2WM9 A;  3AE6 A;  3RYH E;  5HEU A;  3AXJ A;  1MMG A;  2R6G F;  4P0B A;  2FJA A;  4XTC N;  4H9O C;  5BR8 T;  2CBJ A;  4BJM A;  5L4E A;  3EHZ A;  3FZK B;  4AKL A;  4ZI2 D;  4WW0 A;  3UU3 A;  3KV4 A;  2BBJ A;  3ONJ A;  4ZI3 C;  3P8C D;  1U5P A;  3B13 A;  1MNE A;  1HTJ F;  3N9L A;  1HCI A;  2YU2 A;  5HCM A;  4YJ2 E;  2CM0 A;  4H9S E;  4TNV A;  1LRZ A;  4JI8 T;  4YMT B;  3TLT A;  2XQ3 A;  3ZKR A;  3DJB A;  3HR0 A;  5LA6 E;  2DLR A;  3OYX A;  4H9R C;  3ZCJ A;  3O4X E;  4HFH A;  3ZLI A;  4IL4 A;  3BQI A;  4IST A;  5CA0 E;  3P4W A;  4GK5 E;  4OYK A;  4DBR A;  2UUA T;  4LF6 T;  1G8X A;  2LM9 A;  4KHZ G;  2LLY A;  2WDR A;  3CPZ A;  4EV6 A;  4NXM T;  3AVR A;  5FY0 A;  3VRB A;  2JMK A;  2JQ9 A;  1UCU A;  1W0A A;  3ZMU B;  4A98 A;  1D0X A;  1MIW A;  2JQK A;  4PK6 A;  1JNR A;  3JC6 D;  5LJM A;  4ZS2 A;  4LFB T;  2W67 A;  5AQQ B;  2BG9 A;  4HKA A;  2MYS A;  3VKG A;  4YSZ A;  4O4H E;  3RIA A;  3KIN B;  1WYC A;  1KEY A;  1T8B A;  3VR9 A;  5C8Y E;  4DR1 T;  4AQY T;  4DR5 T;  2QYW A;  4JEH B;  4MLK A;  3LJC A;  3N9O A;  3AEC A;  5LJN A;  2K3W A;  4B3R T;  4IE0 A;  2FJE A;  3C64 A;  2M67 A;  2VWA A;  3E0Z A;  3LG7 A;  1QUU A;  4KI0 G;  4MHC A;  4KI0 F;  5JR9 A;  4LML A;  4OYJ A;  5ADX L;  3ZMT B;  4I0U A;  4IT4 A;  2Q9Q D;  4BJN A;  3H3A A;  3NRY A;  4TQU M;  1VCS A;  4TWD A;  1B7T A;  5FVK A;  4XBF B;  1N34 T;  2VVN A;  1E2A A;  3DHW A;  4X65 T;  2WDV A;  2L8K A;  4ILU A;  4UVA B;  4YMS C;  2CE7 A;  3HKE E;  1MMA A;  2UXX B;  2LEH A;  2LKG A;  3KBT A;  1EZ3 A;  4ADZ A;  2VL8 A;  1HNX T;  4KHP T;  1KNP A;  5EK2 A;  4M1P A;  4PK5 A;  1E7P A;  3C4X A;  4CI2 B;  1YW0 A;  4CXW A;  5M4Y A;  5TAO A;  4TN7 B;  4PNI A;  5JDQ A;  1FJG T;  5FYM A;  1ZV4 X;  2XQ5 A;  3PUY F;  4IDP A;  3ETV A;  3OTO T;  4DO0 A;  4DV4 T;  3WAK A;  2IIU A;  1NAF A;  2Q9Q B;  3UTK A;  3EDV A;  3UUL A;  1HX1 B;  4DV5 T;  3ONL C;  2VAS A;  4IE5 A;  5AQS B;  4I50 E;  2W66 A;  5A1L A;  1YXR A;  2JJ9 A;  2VKJ A;  5E0O A;  4MBQ A;  3AAI A;  3QB5 K;  3B5M A;  1CHU A;  1KNR A;  5J1G A;  2IML A;  4CZZ B;  4YTP A;  2LRK A;  2CXD A;  1YQ3 A;  3AAA B;  4YHJ A;  3AEA A;  4IHJ E;  4ILC A;  4O8S A;  4LF8 T;  2W00 A;  2CHO A;  3M65 A;  2BZB A;  3N9N A;  3PUX F;  1OXZ A;  2WMN A;  2XAJ B;  5AQN B;  1I6Z A;  3HKB E;  2LSK A;  3RI5 A;  4AXP A;  2XQ9 A;  2EHO A;  4ILB A;  2XQ8 A;  3I0O A;  4HTE A;  5JDG A;  2V6Y B;  2XQA A;  3UUN A;  4ZHQ E;  4HWI B;  4KMC A;  4FJO A;  3RYF E;  1ZOY A;  2MTQ A;  5ABF A;  4QH5 A;  5AQU B;  3RGL A;  3UU6 A;  2ACZ A;  4EXT A;  4IE6 A;  2L9Q A;  2MAW A;  2WZH A;  3RKO A;  4UIG A;  2V5D A;  3MK7 C;  3FBZ A;  2ZM8 A;  4G63 A;  2X66 A;  1Z8U A;  3OYZ A;  2WBL A;  4IGU A;  3ABV A;  4DID B;  1XMQ T;  2G0U A;  2XQ4 A;  2HPL A;  4Z90 A;  2HN2 A;  3FB2 A;  3J7Y q;  3SOL A;  3A5X A;  2VK9 A;  4BA9 A;  2ES0 A;  5JDH A;  1D1B A;  1S94 A;  3QB5 A;  3X1D A;  3J9X 1;  2CLY B;  3AE3 A;  2Y8D A;  2UUB T;  3TLU A;  4B3T T;  2CA5 A;  1IBL T;  4CXX A;  5ABH A;  3IBP A;  2BKO A;  1SHZ C;  5JDF A;  3ZN0 B;  3ZYL A;  4DBQ A;  5LBQ B;  4ZXL A;  4EOZ B;  2ZM2 A;  5AQG B;  5KXJ A;  3SWH A;  3RPU A;  4B3S T;  5HEJ A;  5C3J A;  1IBM T;  4X1K E;  3AE4 A;  2XQY A;  2K5B B;  1XNR T;  3RIU C;  2XAQ B;  2WMO A;  3PUZ F;  4LMJ A;  2V6X A;  2V7L A;  2N9D A;  4HFB A;  1NEK A;  2MPK A;  4I43 B;  5LCY A;  5L3F B;  3AA7 B;  3T1H T;  2E8I A;  1MND A;  2JMH A;  2XSB A;  3LBX A;  3AB3 B;  4H9Q C;  3RIU A;  2PFV A;  2JRK A;  1IAP A;  3OKQ A;  4AQG A;  5CA1 E;  1HNW T;  5FL1 A;  5KDM C;  4WBN E;  3AEB A;  4HWD A;  2V1D B;  4K0K T;  1G73 A;  3PE0 A;  4IIJ E;  1E1H B;  3CQC B;  3MJX A;  4AQF A;  1WR0 A;  3VHL A;  2Y48 B;  3LK2 B;  3LK4 2;  2HPJ A;  4JI3 T;  3G06 A;  4ZI3 D;  3V5S A;  4TQU N;  3RF1 A;  5KX5 E;  2IAK A;  2CHN A;  3FZL B;  1LVF A;  2IDO B;  3R6N A;  3EVY A;  3K3O A;  4FI5 A;  5AQI B;  4TX5 A;  5CFB A;  4X5T A;  4P0A A;  1DU2 A;  4HWF A;  4NIQ A;  4DUZ T;  4TUY E;  2CXL A;  2CEA A;  3ETU A;  2E2A A;  2UXC T;  3PV0 G;  2MOZ A;  4TWF A;  2WAU A;  5AQM B;  3A8Y C;  1ZEE A;  5HXC A;  5HXS A;  3ZC0 A;  1XZY A;  2W61 A;  1X79 A;  2LE8 A;  2VKH A;  5F5W A;  2IC9 A;  4L9I A;  5L3C B;  4O4L E;  3QK6 A;  4JUY A;  4UVB B;  4WNK A;  3AA0 B;  2X9X A;  2UXB T;  4O2B E;  3KV9 A;  4JEU B;  2OV9 A;  2PG8 A;  2B76 A;  4COF A;  1J5E T;  2LKH A;  4ERR A;  3AE1 A;  2CPT A; 
#chains in the Genus database with same CATH homology
 4YMU C;  3PV0 F;  4YMT B;  4TQU M;  2R6G G;  3PUX G;  3PUX F;  3DHW A;  4TQU N;  4YMS C;  4KHZ G;  4KHZ F;  3PUW F;  3TUJ A;  3PUW G;  2ONK C;  4XIG N;  4JBW F;  3D31 C;  4XIG M;  3TUI A;  3PV0 G;  3TUZ A;  4YMV C;  3PUZ G;  2R6G F;  3PUZ F;  3PUY F;  3PUY G;  4XTC N;  4YMW C;  3PUV F;  3RLF G;  3PUV G;  3RLF F;  4XTC M;  4KI0 G;  4JBW G;  4KI0 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...