3PV0F

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
488
structure length
483
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 138
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3pv0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3pv0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3pv0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3pv0F02
3PUYF 4XIGN 4XIGM 3PV0G 3PUWG 2R6GG 3TUIA 3PUXF 3RLFG 2ONKC 4KI0F 4YMWC 4KHZF 4JBWF 3PUVG 4YMTB 4YMVC 3PUYG 3D31C 3TUJA 3PUZF 3PUXG 3PUWF 2R6GF 3PV0F 3RLFF 4KI0G 3DHWA 4XTCN 4KHZG 4XTCM 4JBWG 3TUZA 4TQUN 4YMSC 3PUVF 4TQUM 4YMUC 3PUZG
chains in the Genus database with same CATH superfamily
4JEHB 3JAFA 3P4SA 2YOEA 3ZN0B 4EEDA 5AFUL 2YDSA 5LCYA 2Q9QB 4L0RA 4KHPT 2LOSA 5AQUB 4O4IE 3RQWA 5FXWA 4LF9T 4DR3T 3P4RA 3MKDA 5JDFA 4YMVC 5EK2A 2IUBA 5J2UE 1HNZT 1XMOT 3B57A 5FY7A 4YLHA 3Q2MA 3PUVF 3EVYA 2I6HA 2W67A 5KX5E 5AQHB 2YK0A 3P4PA 3JCFA 3ZT5A 3LK3B 1WLXA 2EHOA 1IAPA 5L3BB 1HTJF 4IREA 3AA7B 1ZKEA 3JC6C 3NZPA 4U2ZA 4UV8B 4DR6T 2WZHA 2XM2A 5LGNB 2VL8A 2XQ4A 1VRBA 5FMNA 1W9RA 1SE7A 2FJBA 5L3EB 2H7VC 4AQFA 3QNUA 1CUNA 4UVAB 3RYIE 2VK9A 1UUSA 3EHZA 2WP9A 3PU8A 3FXDB 3PUZF 3Q5EA 2H3RA 4TV8E 2XJ7A 4HTEA 5C3JA 2CWOA 4AI6A 3N2KE 4KX6A 1WYCA 1N34T 4HWHA 5AQMB 4DV3T 1Y01A 2XQ9A 2CE7A 3KV6A 5HCMA 3PU3A 5JRCB 2IIUA 1QLBA 2PTFA 4HFVA 4KHZG 4QXHB 3ZMVB 4YY3T 5FYMA 3QC9A 4YJ3E 4LF6T 1SUMB 4X66T 3TLUA 4JUYA 4NUVA 3UU3A 4EOZB 2N9DA 5HXEA 2CHNA 2WMNA 2AE9A 2Y48B 3KVBA 2K48A 3DHWA 4DR4T 4E7SA 2XQ8A 4U2YA 4YMUC 5LMNT 4DV6T 1J1JA 2WZIA 5DQVA 1MIVA 1I6ZA 4IGUA 4AISA 4PFOA 5JR9A 2QYWA 4JI8T 2W62A 2IDOB 2LHNA 2W0GA 4QWNB 1OEDA 2JQ9A 2V7LA 3EI0A 3UU4A 4DR2T 4PJJA 4UR9A 2AXDS 1XNRT 2WY2A 3TUIA 2VKHA 5E0OA 3CQXC 1MMNA 3IEEA 4PJMA 4LMLA 1SA0E 2YDQA 2I59A 3L8RA 2E9XA 2UUCT 2CBIA 1FMWA 4HWDA 4O8SA 4JV5T 2E2AA 3ZJ2A 2DWGA 2YEVC 5IHYA 3C51A 2LJLA 4PJLA 2EHOC 4N78D 4CXXA 3RYCE 3OTOT 3N9PA 3P7IA 5HEHA 3PTRB 4HFBA 4H9OC 2IAKA 4HGAA 2HPJA 2X67A 1FJGT 2V6XA 2NTXA 1BR0A 3C98B 2XZEA 2CA5A 4YFSA 2KWIB 3L39A 1HCIA 5LGUB 3HKBE 5FVKA 4UELA 5FXXA 3FZKB 4GKJT 3PUGA 4NPPA 1E2AA 2NW7A 1FEWA 1WCRA 4HWFA 1WR6A 3RKOA 4JEUB 3ZYLA 2BVLA 4MALA 3DJBA 3LDQB 3MA9A 3H3MA 2V26A 3VRBA 1E1HB 1XMQT 1YXRA 1NWMX 1JNRA 3NRXA 4PW8A 3C4ZA 4O4JE 3QB5K 2W66A 4JI3T 2BKOA 2CCQA 2A72A 4EGWA 5IYZE 5AQIB 1IJ5A 3PUVG 4V1Av 3EABA 1LVFA 2ZM2A 3HR0A 3VRAA 2J47A 3AE3A 2KMFA 1BR4A 4TX5A 2VURA 3ZLIA 5M4YA 2WDQA 5ABFB 4YMWC 4IDQA 4A97A 4HEAA 1YQ3A 3HA4A 3D31C 4I0UA 4B3RT 1W09A 3AE6A 3GN5B 2MYSA 3AE4A 3N9LA 2JQHA 2Q9QA 2KLQA 4IE4A 1HR0T 4PK4A 2LM9A 5FVLA 1OEDC 3RLFG 1LRZA 2IC6A 3RIUA 2WMOA 5KXJA 5LA6E 1MNDA 3PJAJ 3CKDA 4QXBB 3WAJA 1W0BA 3FZHB 4X1YE 3KV9A 3N5LA 5KMGP 3PUZG 1Z0PA 4XAXB 2VVNA 4ILAA 1OEDB 3AE9A 5ETWA 4OYKA 2CRBA 5BR8T 4DV1T 5FY0A 2WB5A 3PV0F 4TWHA 4YTNA 4O2BE 4A56A 5L4HA 4Z91A 3U3IA 2LSKA 5DABA 4DBRA 2N1GA 3N2GE 2LHRA 2QVAA 2VKJA 3N2OA 1D0ZA 4PFPA 3KFWX 3UUMA 2VQET 3O1JA 5IUXA 2W4XA 2B76A 2UXDT 2DI4A 3QOFA 3MACA 1M62A 3V5SA 2MTQA 1YD8G 4X64T 3SRZA 4ILCA 1XDPA 4EIWA 2PG8A 3ZN1B 4A5XA 2MAWA 1NEKA 2K3WA 2HH7A 3ZMZB 1D0YA 4TNWA 4X62T 3RYFE 2XQ6A 4BA9A 2D9DA 3AEEA 3AEDA 3GMIA 2DL1A 3RC3A 3KBUA 3N9MA 2V7MA 5LGTB 2WBLA 4U33A 3OPCA 4KMCA 4GIWA 4HWIB 3K8PC 2CLYB 5FKYA 3J9X1 5JRCA 3UU8A 2A9UA 5FL1A 1IBLT 4IDNA 5LNKA 4FJOA 2XY8B 2IC9A 5L47A 3PUWF 1ZP0A 4XTCN 2BZBA 3RI5A 1XNQT 2P9BA 2XAFB 2CWYA 1U5PA 1UK5A 2XQ7A 3TLSA 3OVUA 2BS4A 4UIGA 3PJAA 2WDRA 4B3ST 3RIUC 5LXTE 5EZYE 4AQGA 5HXSA 4HE8A 3UUBA 4U72A 3VR8A 5HCJA 4K0UA 4G63A 1MMAA 5CGMA 3PURA 4EZ4A 3OYXA 2ACZA 4HFCA 4LMJA 2E5LT 2D2SA 5AQKB 4ZI3D 2R6GG 3NVOA 5CB4E 4H9SE 3PUAA 4ZI2D 2WAUA 5LJNA 4EB6E 4TQUN 1HG2A 4DV2T 4XIGN 2CHOA 2YDRA 3GA8A 2JIWA 2KSRA 4P09A 4EV6A 4YTMA 4LFAT 4CI2B 4FI5A 5LYJE 2X51A 2IHR1 1T7SA 4AKRB 1S35A 3SFDA 5HAXA 5L3GB 3FXEB 3UUXB 3BK9A 3CX6B 3AE2A 2KINB 4WNKA 4L9IA 5LHHB 2CEAA 1WYBA 3L3PA 3RGLA 5L3FB 1AJ3A 4WZXA 2VKOA 3AE1A 2JMKA 3ZT6A 3E0ZA 3TUJA 3R6NA 4YJ2E 1UGOA 1HX8A 3ZKRA 2OV9A 4EAHA 3J7Yq 3PV0G 2XPKA 1WR0A 4KP3C 2NR4A 1MNEA 1EZ3A 2Z6EA 5J0ZA 4HN9A 4C90A 1IJ6A 5HEJA 2DLRA 3KV4A 5ABFA 5LG3A 2NP9A 4ZXLA 3GN5A 4ZI7E 4KI0F 5F8PA 2LT3A 5AQSB 2BBHA 3RHWA 2V7IA 2X9XA 3N9QA 3KBTA 2YN6A 3TLWA 2MOZA 3EDVA 2LSGA 4LFBT 2X0HA 5EK4A 2SPCA 4IDPA 4U31A 2J4GA 2FBWA 5JTGA 1ZEEA 5JH7E 2UXBT 4ILUA 2BG9B 1OXZA 2M67A 4TN7B 4COFA 4AKHA 2WSSV 3VR9A 3AA1B 2CM0A 3CQCB 3M65A 4X65T 5LMUT 3UTKA 2V5CA 3IA3A 2MPKA 5AQPB 4JI6T 2NTYA 2XQ5A 3EUHA 4JI2T 3PUYF 1HFAA 3Q5DA 2A2FX 2RPAA 5DJQC 2ODVA 3I1AA 2ZM0A 2UXCT 2LM2A 4KBMB 3KV5A 3T8OA 4X20E 3UQ7A 3I9YA 2KXPB 5LG4A 1B7TA 3HI2A 2J62A 3HKDE 3PUQA 2V6YB 3ZJ1A 5IWAT 1IBMT 3FHNA 1MMDA 4UEMA 4QH1A 4H9RC 2ES0A 1J5ET 2LKGA 4C91A 1VCSA 2W61A 3T1YT 2LKHA 4JBWF 3UU6A 4PK6A 4IE7A 2XAQB 2ODUA 4YT0A 4AKIA 1XZYA 4U7IA 5LOVE 2NOXA 4OHFA 2DCFA 5BMVE 2GK9A 2C5KT 3JAEA 3PUXF 4H9QC 4CN6A 3RIFA 2WDVA 4Z90A 5AQRB 1G8XA 1KNZA 3W15B 1S94A 2V7JA 2JMHA 5DQWA 4I55E 2JRKA 4TUYE 3P4WA 5HWXA 4I43B 2J1DG 1Z8UA 4ISTA 3LK2B 1R8IA 3NZQA 5H6RB 3JC6D 5ABGA 2I0MA 3UUNA 1MIWA 3QK6A 2KNDA 2XHEB 4XTCM 4IE0A 4H63H 3MJXA 5LP6E 2UXXB 5AQNB 3A7MA 4BJNA 2K9AA 1NENA 4CN4A 4DBQA 3G06A 3LSVA 3UT5E 1LKXA 3LBXB 2WM9A 3K3NA 3HKEE 2CXDA 5FXVA 3UQ4A 3PDYA 2BVMA 3CMLA 3B13A 1KNPA 1KF6A 2NW8A 2WWUA 4NXNT 2G0UA 4KUMB 4JYAT 4DMWA 4JI7T 1ZOYA 3IBPA 2UUBT 4DV0T 4P1NA 3CX8B 2CXFA 1D1CA 2ACXA 2WQYA 3TLTA 2PJQA 3K3OA 3JADA 2WS3A 4YSXA 2M6IA 2L9QA 4HFIA 4TQUM 3VU7H 3Q5WA 3UFGA 4XIGM 3FB2A 3P8CD 4E7ZA 5AQTB 2BDEA 4KHZF 4UVBB 2F4VT 5JDMA 5FL0A 2XM1A 4X5TA 2ZM8A 2DHRA 5LB7B 1XDOA 2C0SA 4YHJA 2M6BA 2CLYC 2DNXA 4NXMT 2X68A 1KFYA 2JPFA 4IHJE 4IL9A 3L09A 2HN2A 4OX9T 3CIRA 3FBZA 2XAGB 3RPUA 4UF0B 3SS1A 3DTOA 1BR1A 3AAEB 5F5WA 4ZOLE 3ZCIA 5CA1E 2FUPA 1X9BA 2QA7A 3SFEA 4TWFA 4YSYA 2W00A 3KINB 3UULA 3O9XA 3C64A 1QUUA 5JVDE 3ETVA 2EHOD 4IDZA 4IIJE 1KEYA 3BQIA 1HG5A 2V8SV 4PAGA 4IDOA 2D0TA 2VWAA 2C5IT 4BJMA 3SWHA 2L8KA 3E08A 3EDUA 4ZZCA 2FJAA 3CX7B 1OEDE 3IF8B 1N33T 4ZS3A 3RYHE 5ADXL 4Z8XA 3ZSSA 2VVSA 3NKZA 4WYVA 2BG9A 5HEGA 4MLKA 5AQLB 3ONLC 3AE5A 4M1PA 2FJEA 5FNVE 2D5UA 4OFZA 2PFVA 5AQQB 3HL6A 3F57A 3AXJB 5HYAA 3CVRA 5AQOB 3RH3A 4EEBA 1H7CA 4AKLA 5JQGE 1JNZA 3AVRA 5F3JA 4DV4T 4NIQA 5KDMC 4JI5T 3PUXG 5EK3A 3OJAA 4WBNE 3AEAA 2RA1A 1T72A 2LRKA 3CPZA 3AAIA 3M3ZB 4F6RC 4IL4A 4YMTB 2WU5A 4B6XA 2UU9T 4GK5E 4CXWA 4ZEYA 2LSIA 4CZZB 4LF8T 5C8YE 2V6YA 5LHIB 3ONXA 1FMVA 2C5JA 3F31A 2HPLA 3AECA 5HWYA 3RC8A 4DR5T 3MZKB 1X79A 3TLVA 3UFEA 4NUUA 2KWHA 3AAAB 2RP4A 1M7KA 3CK6A 3P50A 1XWMA 4F8HA 1UURA 5L4EA 3KVAA 4HFDA 4TNVA 4K0KT 5H6QB 5C2TA 5JDGA 4ZZBA 4TWDA 3RRWA 1NAFA 3WI3A 1U4QA 4U74A 3O1HA 4P0AA 4MFRA 3RLFF 5LBMA 2E9XD 3RIAA 2KZ7B 5ABEA 4QKNA 4ILBA 2IW5B 1SHZC 3ZYMA 2WCAA 1E7PA 5L2LA 2HN1A 4LMKA 4Q25A 3A8YC 3R84B 1W0AA 2VASA 4DIDB 4YTPA 3LJCA 5LJMA 1QSDA 3ANWB 2LSJA 4DV7T 2JJ9A 2Y8DA 2IMLA 3VKGA 2BG9C 3OYZA 2D0UA 1Y64B 5HXCA 3AEBA 1BR2A 3WAKA 3AB3B 4I4TE 3LBXA 5TAOA 3VHLA 2VQFT 1CHUA 3SOLA 2E8IA 2QRXA 5FP3A 3AA6B 2H88A 5HXHA 1OWAA 3AE8A 3ZYKA 2BS2A 2X9HA 2BS3A 2A3DA 1LVKA 4CN1A 4YXDA 4DNDA 1O3XA 3CQGB 1YW0A 1G73A 5L3DB 2LRLA 4UXNB 4DO0A 4HWCA 2CBJA 1GQEA 1L0VA 4O4LE 1YQ4A 2YU2A 3Q9DA 4QX8B 2YINA 4XZCA 5LBQB 2LOPA 2CMRA 3TUZA 3NWIA 3TKLB 2XQ3A 3ESLA 3PUWG 3MK7C 4GKKT 4DUZT 2OA5A 4QX7B 2VL0A 2UUAT 1T8BA 3CWZB 2K24A 4CI1B 5GONE 1UCUA 4U3CA 2Q9QD 1MIYA 2XASB 2XSBA 3N9OA 1HF8A 3QUJA 4DMVA 2JQQA 4GYRA 3AEGA 4YHHT 3H3AA 3U78A 5HEUA 2VB6A 4UF0A 3ZMSB 3A5XA 4I50E 4HKAA 2PBIA 4AQFC 1I94T 5AQJB 2EHOB 5CA0E 2XQYA 2FJDA 2LSYA 2MBGA 1YKHB 4U7YA 3D0TA 4JI1T 2H89A 4CI3B 2E5VA 4GYSA 4IE5A 3AE7A 4A98A 1KK7A 3ZMTB 4DR7T 5J2TE 4GOUA 4CQIA 2KT9A 3IHRA 2X66A 2XSAA 2NWBA 4YSZA 1YKEB 3ZMUB 3P4QA 4ZI3C 2R6GF 3RF1A 4GK0E 4AIUA 3FZFB 4MHCA 1VCTA 4QH4A 4ANJA 4ZI2C 4H9NC 4G2AA 4H9PC 2Y6XA 2BKPA 1VOMA 2ZM6T 5AQGB 2VKDA 5JDNA 4L5GA 3F2EA 2BG9E 1ZV4X 4WBOA 3RRCA 4OK0A 3C50A 2OLTA 3Q5XA 4EXTA 1N32T 2K5BB 1HX1B 4JI0T 4UV9B 3N9NA 2WU2A 5L3CB 3ETUA 4AXPA 3I0OA 3AXJA 3UU5A 2X0LB 2LLYA 3LK42 4X1KE 4O4HE 3NBXX 3MXZA 2CPTA 4B3MT 5JR9C 3PE0A 3AVSA 4LF4T 2XAJB 3O4XE 4B3TT 1IBKT 5LHGB 2QGSA 3FZLB 3GWHA 3S4UA 4OYJA 4PJNA 4HFHA 2W63A 5JDQA 2UXNB 2X0YA 4TV9E 2V1DB 3RX6A 3ZPOA 3E22E 1UX4A 4ADZA 5A1LA 2V7KA 5JR9B 4X1IE 3K3QC 3BQKA 2H7OA 2E9XC 3VKHA 5ABHA 4PK5A 4EZHA 2N2NA 4IT4A 4ISSA 3HKCE 3K1SA 3ZCJA 1KNRA 4DUYT 3I9WA 3I0QA 4KI0G 4WW0A 1J5WA 4BAYB 1V9DA 5CJ5A 2JQKA 3LFMA 3ZC1A 2E9XB 5FY1A 1HS7A 2X9YA 2LE8A 2YU1A 5J1GA 2L3LA 5JDHA 1DU2A 2ZLYA 4IE6A 4LFCT 2HHHT 2XTLA 4ZS2A 4O2AE 4HFEA 2BBJA 3FZMB 1HNXT 3B5MA 3AEFA 4XBFB 4AQYT 3ZEFB 4QHOA 1N36T 1WFDA 4JI4T 3ZSTA 2LEHA 4CXYA 2XQAA 5JREA 4DR1T 3NRYA 3OBVE 2DWKA 4AKGA 2YKSA 4YMSC 2CXLA 1T98A 2X9WA 4P0BA 3V5UA 3T1HT 3QB5A 1UX5A 3KDSE 5AQFB 4JLEA 4TZ4C 1D1BA 3RKGA 3PUYG 1FIOA 3LG7A 2NW9A 1IZNB 5JDLA 1ZHCA 2WWVA 3RQUA 3ANWA 5HXRA 3DP7A 3O1IA 4J2CA 3ZT7A 4PNIA 4MBQA 4QH5A 4EYYR 3ONJA 4QXCB 4ASKA 2W2UA 3AA0B 3C4XA 4LF7T 3OKQA 3H37A 2ZMAA 3X1DA 3EAMA 3PUSA 1D0XA 2XAHB 3FBLA 2B1EA 4ERRA 4H63V 3ZC0A 5FXZA 2XUEA 4ZHQE 4EYUA 1MMGA 5CFBA 1D1AA 2ONKC 4UVCB 2Q9QC 5AQVB 1HNWT 2V5DA 4LF5T 1WRDA 4DV5T 5HEOA 2BKNA 4JBWG 3BQLA 1US7B 3ABVA 4DVDA 3C4WA
chains in the Genus database with same CATH topology
3PUYF 4XIGN 4XIGM 3PV0G 3PUWG 2R6GG 3TUIA 3PUXF 3RLFG 2ONKC 4KI0F 4YMWC 4KHZF 4JBWF 3PUVG 4YMTB 4YMVC 3PUYG 3D31C 3TUJA 3PUZF 3PUXG 3PUWF 2R6GF 3PV0F 3RLFF 4KI0G 3DHWA 4XTCN 4KHZG 4XTCM 4JBWG 3TUZA 4TQUN 4YMSC 3PUVF 4TQUM 4YMUC 3PUZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY F;  4XIG N;  4XIG M;  3PV0 G;  3PUW G;  2R6G G;  3TUI A;  3PUX F;  3RLF G;  2ONK C;  4KI0 F;  4YMW C;  4KHZ F;  4JBW F;  3PUV G;  4YMT B;  4YMV C;  3PUY G;  3D31 C;  3TUJ A;  3PUZ F;  3PUX G;  3PUW F;  2R6G F;  3PV0 F;  3RLF F;  4KI0 G;  3DHW A;  4XTC N;  4KHZ G;  4XTC M;  4JBW G;  3TUZ A;  4TQU N;  4YMS C;  3PUV F;  4TQU M;  4YMU C;  3PUZ G; 
#chains in the Genus database with same CATH topology
 4JEH B;  3JAF A;  3P4S A;  2YOE A;  3ZN0 B;  4EED A;  5AFU L;  2YDS A;  5LCY A;  2Q9Q B;  4L0R A;  4KHP T;  2LOS A;  5AQU B;  4O4I E;  3RQW A;  5FXW A;  4LF9 T;  4DR3 T;  3P4R A;  3MKD A;  5JDF A;  4YMV C;  5EK2 A;  2IUB A;  5J2U E;  1HNZ T;  1XMO T;  3B57 A;  5FY7 A;  4YLH A;  3Q2M A;  3PUV F;  3EVY A;  2I6H A;  2W67 A;  5KX5 E;  5AQH B;  2YK0 A;  3P4P A;  3JCF A;  3ZT5 A;  3LK3 B;  1WLX A;  2EHO A;  1IAP A;  5L3B B;  1HTJ F;  4IRE A;  3AA7 B;  1ZKE A;  3JC6 C;  3NZP A;  4U2Z A;  4UV8 B;  4DR6 T;  2WZH A;  2XM2 A;  5LGN B;  2VL8 A;  2XQ4 A;  1VRB A;  5FMN A;  1W9R A;  1SE7 A;  2FJB A;  5L3E B;  2H7V C;  4AQF A;  3QNU A;  1CUN A;  4UVA B;  3RYI E;  2VK9 A;  1UUS A;  3EHZ A;  2WP9 A;  3PU8 A;  3FXD B;  3PUZ F;  3Q5E A;  2H3R A;  4TV8 E;  2XJ7 A;  4HTE A;  5C3J A;  2CWO A;  4AI6 A;  3N2K E;  4KX6 A;  1WYC A;  1N34 T;  4HWH A;  5AQM B;  4DV3 T;  1Y01 A;  2XQ9 A;  2CE7 A;  3KV6 A;  5HCM A;  3PU3 A;  5JRC B;  2IIU A;  1QLB A;  2PTF A;  4HFV A;  4KHZ G;  4QXH B;  3ZMV B;  4YY3 T;  5FYM A;  3QC9 A;  4YJ3 E;  4LF6 T;  1SUM B;  4X66 T;  3TLU A;  4JUY A;  4NUV A;  3UU3 A;  4EOZ B;  2N9D A;  5HXE A;  2CHN A;  2WMN A;  2AE9 A;  2Y48 B;  3KVB A;  2K48 A;  3DHW A;  4DR4 T;  4E7S A;  2XQ8 A;  4U2Y A;  4YMU C;  5LMN T;  4DV6 T;  1J1J A;  2WZI A;  5DQV A;  1MIV A;  1I6Z A;  4IGU A;  4AIS A;  4PFO A;  5JR9 A;  2QYW A;  4JI8 T;  2W62 A;  2IDO B;  2LHN A;  2W0G A;  4QWN B;  1OED A;  2JQ9 A;  2V7L A;  3EI0 A;  3UU4 A;  4DR2 T;  4PJJ A;  4UR9 A;  2AXD S;  1XNR T;  2WY2 A;  3TUI A;  2VKH A;  5E0O A;  3CQX C;  1MMN A;  3IEE A;  4PJM A;  4LML A;  1SA0 E;  2YDQ A;  2I59 A;  3L8R A;  2E9X A;  2UUC T;  2CBI A;  1FMW A;  4HWD A;  4O8S A;  4JV5 T;  2E2A A;  3ZJ2 A;  2DWG A;  2YEV C;  5IHY A;  3C51 A;  2LJL A;  4PJL A;  2EHO C;  4N78 D;  4CXX A;  3RYC E;  3OTO T;  3N9P A;  3P7I A;  5HEH A;  3PTR B;  4HFB A;  4H9O C;  2IAK A;  4HGA A;  2HPJ A;  2X67 A;  1FJG T;  2V6X A;  2NTX A;  1BR0 A;  3C98 B;  2XZE A;  2CA5 A;  4YFS A;  2KWI B;  3L39 A;  1HCI A;  5LGU B;  3HKB E;  5FVK A;  4UEL A;  5FXX A;  3FZK B;  4GKJ T;  3PUG A;  4NPP A;  1E2A A;  2NW7 A;  1FEW A;  1WCR A;  4HWF A;  1WR6 A;  3RKO A;  4JEU B;  3ZYL A;  2BVL A;  4MAL A;  3DJB A;  3LDQ B;  3MA9 A;  3H3M A;  2V26 A;  3VRB A;  1E1H B;  1XMQ T;  1YXR A;  1NWM X;  1JNR A;  3NRX A;  4PW8 A;  3C4Z A;  4O4J E;  3QB5 K;  2W66 A;  4JI3 T;  2BKO A;  2CCQ A;  2A72 A;  4EGW A;  5IYZ E;  5AQI B;  1IJ5 A;  3PUV G;  4V1A v;  3EAB A;  1LVF A;  2ZM2 A;  3HR0 A;  3VRA A;  2J47 A;  3AE3 A;  2KMF A;  1BR4 A;  4TX5 A;  2VUR A;  3ZLI A;  5M4Y A;  2WDQ A;  5ABF B;  4YMW C;  4IDQ A;  4A97 A;  4HEA A;  1YQ3 A;  3HA4 A;  3D31 C;  4I0U A;  4B3R T;  1W09 A;  3AE6 A;  3GN5 B;  2MYS A;  3AE4 A;  3N9L A;  2JQH A;  2Q9Q A;  2KLQ A;  4IE4 A;  1HR0 T;  4PK4 A;  2LM9 A;  5FVL A;  1OED C;  3RLF G;  1LRZ A;  2IC6 A;  3RIU A;  2WMO A;  5KXJ A;  5LA6 E;  1MND A;  3PJA J;  3CKD A;  4QXB B;  3WAJ A;  1W0B A;  3FZH B;  4X1Y E;  3KV9 A;  3N5L A;  5KMG P;  3PUZ G;  1Z0P A;  4XAX B;  2VVN A;  4ILA A;  1OED B;  3AE9 A;  5ETW A;  4OYK A;  2CRB A;  5BR8 T;  4DV1 T;  5FY0 A;  2WB5 A;  3PV0 F;  4TWH A;  4YTN A;  4O2B E;  4A56 A;  5L4H A;  4Z91 A;  3U3I A;  2LSK A;  5DAB A;  4DBR A;  2N1G A;  3N2G E;  2LHR A;  2QVA A;  2VKJ A;  3N2O A;  1D0Z A;  4PFP A;  3KFW X;  3UUM A;  2VQE T;  3O1J A;  5IUX A;  2W4X A;  2B76 A;  2UXD T;  2DI4 A;  3QOF A;  3MAC A;  1M62 A;  3V5S A;  2MTQ A;  1YD8 G;  4X64 T;  3SRZ A;  4ILC A;  1XDP A;  4EIW A;  2PG8 A;  3ZN1 B;  4A5X A;  2MAW A;  1NEK A;  2K3W A;  2HH7 A;  3ZMZ B;  1D0Y A;  4TNW A;  4X62 T;  3RYF E;  2XQ6 A;  4BA9 A;  2D9D A;  3AEE A;  3AED A;  3GMI A;  2DL1 A;  3RC3 A;  3KBU A;  3N9M A;  2V7M A;  5LGT B;  2WBL A;  4U33 A;  3OPC A;  4KMC A;  4GIW A;  4HWI B;  3K8P C;  2CLY B;  5FKY A;  3J9X 1;  5JRC A;  3UU8 A;  2A9U A;  5FL1 A;  1IBL T;  4IDN A;  5LNK A;  4FJO A;  2XY8 B;  2IC9 A;  5L47 A;  3PUW F;  1ZP0 A;  4XTC N;  2BZB A;  3RI5 A;  1XNQ T;  2P9B A;  2XAF B;  2CWY A;  1U5P A;  1UK5 A;  2XQ7 A;  3TLS A;  3OVU A;  2BS4 A;  4UIG A;  3PJA A;  2WDR A;  4B3S T;  3RIU C;  5LXT E;  5EZY E;  4AQG A;  5HXS A;  4HE8 A;  3UUB A;  4U72 A;  3VR8 A;  5HCJ A;  4K0U A;  4G63 A;  1MMA A;  5CGM A;  3PUR A;  4EZ4 A;  3OYX A;  2ACZ A;  4HFC A;  4LMJ A;  2E5L T;  2D2S A;  5AQK B;  4ZI3 D;  2R6G G;  3NVO A;  5CB4 E;  4H9S E;  3PUA A;  4ZI2 D;  2WAU A;  5LJN A;  4EB6 E;  4TQU N;  1HG2 A;  4DV2 T;  4XIG N;  2CHO A;  2YDR A;  3GA8 A;  2JIW A;  2KSR A;  4P09 A;  4EV6 A;  4YTM A;  4LFA T;  4CI2 B;  4FI5 A;  5LYJ E;  2X51 A;  2IHR 1;  1T7S A;  4AKR B;  1S35 A;  3SFD A;  5HAX A;  5L3G B;  3FXE B;  3UUX B;  3BK9 A;  3CX6 B;  3AE2 A;  2KIN B;  4WNK A;  4L9I A;  5LHH B;  2CEA A;  1WYB A;  3L3P A;  3RGL A;  5L3F B;  1AJ3 A;  4WZX A;  2VKO A;  3AE1 A;  2JMK A;  3ZT6 A;  3E0Z A;  3TUJ A;  3R6N A;  4YJ2 E;  1UGO A;  1HX8 A;  3ZKR A;  2OV9 A;  4EAH A;  3J7Y q;  3PV0 G;  2XPK A;  1WR0 A;  4KP3 C;  2NR4 A;  1MNE A;  1EZ3 A;  2Z6E A;  5J0Z A;  4HN9 A;  4C90 A;  1IJ6 A;  5HEJ A;  2DLR A;  3KV4 A;  5ABF A;  5LG3 A;  2NP9 A;  4ZXL A;  3GN5 A;  4ZI7 E;  4KI0 F;  5F8P A;  2LT3 A;  5AQS B;  2BBH A;  3RHW A;  2V7I A;  2X9X A;  3N9Q A;  3KBT A;  2YN6 A;  3TLW A;  2MOZ A;  3EDV A;  2LSG A;  4LFB T;  2X0H A;  5EK4 A;  2SPC A;  4IDP A;  4U31 A;  2J4G A;  2FBW A;  5JTG A;  1ZEE A;  5JH7 E;  2UXB T;  4ILU A;  2BG9 B;  1OXZ A;  2M67 A;  4TN7 B;  4COF A;  4AKH A;  2WSS V;  3VR9 A;  3AA1 B;  2CM0 A;  3CQC B;  3M65 A;  4X65 T;  5LMU T;  3UTK A;  2V5C A;  3IA3 A;  2MPK A;  5AQP B;  4JI6 T;  2NTY A;  2XQ5 A;  3EUH A;  4JI2 T;  3PUY F;  1HFA A;  3Q5D A;  2A2F X;  2RPA A;  5DJQ C;  2ODV A;  3I1A A;  2ZM0 A;  2UXC T;  2LM2 A;  4KBM B;  3KV5 A;  3T8O A;  4X20 E;  3UQ7 A;  3I9Y A;  2KXP B;  5LG4 A;  1B7T A;  3HI2 A;  2J62 A;  3HKD E;  3PUQ A;  2V6Y B;  3ZJ1 A;  5IWA T;  1IBM T;  3FHN A;  1MMD A;  4UEM A;  4QH1 A;  4H9R C;  2ES0 A;  1J5E T;  2LKG A;  4C91 A;  1VCS A;  2W61 A;  3T1Y T;  2LKH A;  4JBW F;  3UU6 A;  4PK6 A;  4IE7 A;  2XAQ B;  2ODU A;  4YT0 A;  4AKI A;  1XZY A;  4U7I A;  5LOV E;  2NOX A;  4OHF A;  2DCF A;  5BMV E;  2GK9 A;  2C5K T;  3JAE A;  3PUX F;  4H9Q C;  4CN6 A;  3RIF A;  2WDV A;  4Z90 A;  5AQR B;  1G8X A;  1KNZ A;  3W15 B;  1S94 A;  2V7J A;  2JMH A;  5DQW A;  4I55 E;  2JRK A;  4TUY E;  3P4W A;  5HWX A;  4I43 B;  2J1D G;  1Z8U A;  4IST A;  3LK2 B;  1R8I A;  3NZQ A;  5H6R B;  3JC6 D;  5ABG A;  2I0M A;  3UUN A;  1MIW A;  3QK6 A;  2KND A;  2XHE B;  4XTC M;  4IE0 A;  4H63 H;  3MJX A;  5LP6 E;  2UXX B;  5AQN B;  3A7M A;  4BJN A;  2K9A A;  1NEN A;  4CN4 A;  4DBQ A;  3G06 A;  3LSV A;  3UT5 E;  1LKX A;  3LBX B;  2WM9 A;  3K3N A;  3HKE E;  2CXD A;  5FXV A;  3UQ4 A;  3PDY A;  2BVM A;  3CML A;  3B13 A;  1KNP A;  1KF6 A;  2NW8 A;  2WWU A;  4NXN T;  2G0U A;  4KUM B;  4JYA T;  4DMW A;  4JI7 T;  1ZOY A;  3IBP A;  2UUB T;  4DV0 T;  4P1N A;  3CX8 B;  2CXF A;  1D1C A;  2ACX A;  2WQY A;  3TLT A;  2PJQ A;  3K3O A;  3JAD A;  2WS3 A;  4YSX A;  2M6I A;  2L9Q A;  4HFI A;  4TQU M;  3VU7 H;  3Q5W A;  3UFG A;  4XIG M;  3FB2 A;  3P8C D;  4E7Z A;  5AQT B;  2BDE A;  4KHZ F;  4UVB B;  2F4V T;  5JDM A;  5FL0 A;  2XM1 A;  4X5T A;  2ZM8 A;  2DHR A;  5LB7 B;  1XDO A;  2C0S A;  4YHJ A;  2M6B A;  2CLY C;  2DNX A;  4NXM T;  2X68 A;  1KFY A;  2JPF A;  4IHJ E;  4IL9 A;  3L09 A;  2HN2 A;  4OX9 T;  3CIR A;  3FBZ A;  2XAG B;  3RPU A;  4UF0 B;  3SS1 A;  3DTO A;  1BR1 A;  3AAE B;  5F5W A;  4ZOL E;  3ZCI A;  5CA1 E;  2FUP A;  1X9B A;  2QA7 A;  3SFE A;  4TWF A;  4YSY A;  2W00 A;  3KIN B;  3UUL A;  3O9X A;  3C64 A;  1QUU A;  5JVD E;  3ETV A;  2EHO D;  4IDZ A;  4IIJ E;  1KEY A;  3BQI A;  1HG5 A;  2V8S V;  4PAG A;  4IDO A;  2D0T A;  2VWA A;  2C5I T;  4BJM A;  3SWH A;  2L8K A;  3E08 A;  3EDU A;  4ZZC A;  2FJA A;  3CX7 B;  1OED E;  3IF8 B;  1N33 T;  4ZS3 A;  3RYH E;  5ADX L;  4Z8X A;  3ZSS A;  2VVS A;  3NKZ A;  4WYV A;  2BG9 A;  5HEG A;  4MLK A;  5AQL B;  3ONL C;  3AE5 A;  4M1P A;  2FJE A;  5FNV E;  2D5U A;  4OFZ A;  2PFV A;  5AQQ B;  3HL6 A;  3F57 A;  3AXJ B;  5HYA A;  3CVR A;  5AQO B;  3RH3 A;  4EEB A;  1H7C A;  4AKL A;  5JQG E;  1JNZ A;  3AVR A;  5F3J A;  4DV4 T;  4NIQ A;  5KDM C;  4JI5 T;  3PUX G;  5EK3 A;  3OJA A;  4WBN E;  3AEA A;  2RA1 A;  1T72 A;  2LRK A;  3CPZ A;  3AAI A;  3M3Z B;  4F6R C;  4IL4 A;  4YMT B;  2WU5 A;  4B6X A;  2UU9 T;  4GK5 E;  4CXW A;  4ZEY A;  2LSI A;  4CZZ B;  4LF8 T;  5C8Y E;  2V6Y A;  5LHI B;  3ONX A;  1FMV A;  2C5J A;  3F31 A;  2HPL A;  3AEC A;  5HWY A;  3RC8 A;  4DR5 T;  3MZK B;  1X79 A;  3TLV A;  3UFE A;  4NUU A;  2KWH A;  3AAA B;  2RP4 A;  1M7K A;  3CK6 A;  3P50 A;  1XWM A;  4F8H A;  1UUR A;  5L4E A;  3KVA A;  4HFD A;  4TNV A;  4K0K T;  5H6Q B;  5C2T A;  5JDG A;  4ZZB A;  4TWD A;  3RRW A;  1NAF A;  3WI3 A;  1U4Q A;  4U74 A;  3O1H A;  4P0A A;  4MFR A;  3RLF F;  5LBM A;  2E9X D;  3RIA A;  2KZ7 B;  5ABE A;  4QKN A;  4ILB A;  2IW5 B;  1SHZ C;  3ZYM A;  2WCA A;  1E7P A;  5L2L A;  2HN1 A;  4LMK A;  4Q25 A;  3A8Y C;  3R84 B;  1W0A A;  2VAS A;  4DID B;  4YTP A;  3LJC A;  5LJM A;  1QSD A;  3ANW B;  2LSJ A;  4DV7 T;  2JJ9 A;  2Y8D A;  2IML A;  3VKG A;  2BG9 C;  3OYZ A;  2D0U A;  1Y64 B;  5HXC A;  3AEB A;  1BR2 A;  3WAK A;  3AB3 B;  4I4T E;  3LBX A;  5TAO A;  3VHL A;  2VQF T;  1CHU A;  3SOL A;  2E8I A;  2QRX A;  5FP3 A;  3AA6 B;  2H88 A;  5HXH A;  1OWA A;  3AE8 A;  3ZYK A;  2BS2 A;  2X9H A;  2BS3 A;  2A3D A;  1LVK A;  4CN1 A;  4YXD A;  4DND A;  1O3X A;  3CQG B;  1YW0 A;  1G73 A;  5L3D B;  2LRL A;  4UXN B;  4DO0 A;  4HWC A;  2CBJ A;  1GQE A;  1L0V A;  4O4L E;  1YQ4 A;  2YU2 A;  3Q9D A;  4QX8 B;  2YIN A;  4XZC A;  5LBQ B;  2LOP A;  2CMR A;  3TUZ A;  3NWI A;  3TKL B;  2XQ3 A;  3ESL A;  3PUW G;  3MK7 C;  4GKK T;  4DUZ T;  2OA5 A;  4QX7 B;  2VL0 A;  2UUA T;  1T8B A;  3CWZ B;  2K24 A;  4CI1 B;  5GON E;  1UCU A;  4U3C A;  2Q9Q D;  1MIY A;  2XAS B;  2XSB A;  3N9O A;  1HF8 A;  3QUJ A;  4DMV A;  2JQQ A;  4GYR A;  3AEG A;  4YHH T;  3H3A A;  3U78 A;  5HEU A;  2VB6 A;  4UF0 A;  3ZMS B;  3A5X A;  4I50 E;  4HKA A;  2PBI A;  4AQF C;  1I94 T;  5AQJ B;  2EHO B;  5CA0 E;  2XQY A;  2FJD A;  2LSY A;  2MBG A;  1YKH B;  4U7Y A;  3D0T A;  4JI1 T;  2H89 A;  4CI3 B;  2E5V A;  4GYS A;  4IE5 A;  3AE7 A;  4A98 A;  1KK7 A;  3ZMT B;  4DR7 T;  5J2T E;  4GOU A;  4CQI A;  2KT9 A;  3IHR A;  2X66 A;  2XSA A;  2NWB A;  4YSZ A;  1YKE B;  3ZMU B;  3P4Q A;  4ZI3 C;  2R6G F;  3RF1 A;  4GK0 E;  4AIU A;  3FZF B;  4MHC A;  1VCT A;  4QH4 A;  4ANJ A;  4ZI2 C;  4H9N C;  4G2A A;  4H9P C;  2Y6X A;  2BKP A;  1VOM A;  2ZM6 T;  5AQG B;  2VKD A;  5JDN A;  4L5G A;  3F2E A;  2BG9 E;  1ZV4 X;  4WBO A;  3RRC A;  4OK0 A;  3C50 A;  2OLT A;  3Q5X A;  4EXT A;  1N32 T;  2K5B B;  1HX1 B;  4JI0 T;  4UV9 B;  3N9N A;  2WU2 A;  5L3C B;  3ETU A;  4AXP A;  3I0O A;  3AXJ A;  3UU5 A;  2X0L B;  2LLY A;  3LK4 2;  4X1K E;  4O4H E;  3NBX X;  3MXZ A;  2CPT A;  4B3M T;  5JR9 C;  3PE0 A;  3AVS A;  4LF4 T;  2XAJ B;  3O4X E;  4B3T T;  1IBK T;  5LHG B;  2QGS A;  3FZL B;  3GWH A;  3S4U A;  4OYJ A;  4PJN A;  4HFH A;  2W63 A;  5JDQ A;  2UXN B;  2X0Y A;  4TV9 E;  2V1D B;  3RX6 A;  3ZPO A;  3E22 E;  1UX4 A;  4ADZ A;  5A1L A;  2V7K A;  5JR9 B;  4X1I E;  3K3Q C;  3BQK A;  2H7O A;  2E9X C;  3VKH A;  5ABH A;  4PK5 A;  4EZH A;  2N2N A;  4IT4 A;  4ISS A;  3HKC E;  3K1S A;  3ZCJ A;  1KNR A;  4DUY T;  3I9W A;  3I0Q A;  4KI0 G;  4WW0 A;  1J5W A;  4BAY B;  1V9D A;  5CJ5 A;  2JQK A;  3LFM A;  3ZC1 A;  2E9X B;  5FY1 A;  1HS7 A;  2X9Y A;  2LE8 A;  2YU1 A;  5J1G A;  2L3L A;  5JDH A;  1DU2 A;  2ZLY A;  4IE6 A;  4LFC T;  2HHH T;  2XTL A;  4ZS2 A;  4O2A E;  4HFE A;  2BBJ A;  3FZM B;  1HNX T;  3B5M A;  3AEF A;  4XBF B;  4AQY T;  3ZEF B;  4QHO A;  1N36 T;  1WFD A;  4JI4 T;  3ZST A;  2LEH A;  4CXY A;  2XQA A;  5JRE A;  4DR1 T;  3NRY A;  3OBV E;  2DWK A;  4AKG A;  2YKS A;  4YMS C;  2CXL A;  1T98 A;  2X9W A;  4P0B A;  3V5U A;  3T1H T;  3QB5 A;  1UX5 A;  3KDS E;  5AQF B;  4JLE A;  4TZ4 C;  1D1B A;  3RKG A;  3PUY G;  1FIO A;  3LG7 A;  2NW9 A;  1IZN B;  5JDL A;  1ZHC A;  2WWV A;  3RQU A;  3ANW A;  5HXR A;  3DP7 A;  3O1I A;  4J2C A;  3ZT7 A;  4PNI A;  4MBQ A;  4QH5 A;  4EYY R;  3ONJ A;  4QXC B;  4ASK A;  2W2U A;  3AA0 B;  3C4X A;  4LF7 T;  3OKQ A;  3H37 A;  2ZMA A;  3X1D A;  3EAM A;  3PUS A;  1D0X A;  2XAH B;  3FBL A;  2B1E A;  4ERR A;  4H63 V;  3ZC0 A;  5FXZ A;  2XUE A;  4ZHQ E;  4EYU A;  1MMG A;  5CFB A;  1D1A A;  2ONK C;  4UVC B;  2Q9Q C;  5AQV B;  1HNW T;  2V5D A;  4LF5 T;  1WRD A;  4DV5 T;  5HEO A;  2BKN A;  4JBW G;  3BQL A;  1US7 B;  3ABV A;  4DVD A;  3C4W A; 
#chains in the Genus database with same CATH homology
 3PUY F;  4XIG N;  4XIG M;  3PV0 G;  3PUW G;  2R6G G;  3TUI A;  3PUX F;  3RLF G;  2ONK C;  4KI0 F;  4YMW C;  4KHZ F;  4JBW F;  3PUV G;  4YMT B;  4YMV C;  3PUY G;  3D31 C;  3TUJ A;  3PUZ F;  3PUX G;  3PUW F;  2R6G F;  3PV0 F;  3RLF F;  4KI0 G;  3DHW A;  4XTC N;  4KHZ G;  4XTC M;  4JBW G;  3TUZ A;  4TQU N;  4YMS C;  3PUV F;  4TQU M;  4YMU C;  3PUZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...