3PV0F

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
488
structure length
483
Chain Sequence
SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
total genus 138
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3pv0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3pv0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3pv0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3pv0F02
3RLFG 4YMVC 2R6GF 2R6GG 4XTCM 3PV0F 3D31C 3DHWA 3PV0G 4KI0F 4KI0G 3TUZA 3TUJA 3RLFF 4XIGM 3TUIA 4XIGN 4YMSC 3PUVF 4TQUM 3PUWF 3PUVG 4TQUN 4YMUC 3PUWG 4YMWC 3PUYF 4YMTB 3PUXF 3PUYG 4KHZF 3PUXG 2ONKC 4KHZG 4JBWF 3PUZF 4JBWG 4XTCN 3PUZG
chains in the Genus database with same CATH superfamily
3CMLA 4HWIB 3JCFA 4JEUB 4YHJA 4JV5T 2M67A 3VR8A 2XQ7A 2OLTA 3T1YT 4AIUA 4UIGA 4UR9A 4PFPA 2MYSA 2YEVC 5J2TE 4ZI2C 4COFA 3AEGA 4UELA 3I0OA 4YY3T 2XM1A 4NIQA 3AE8A 5LHHB 5LCYA 2E8IA 2CRBA 5LGUB 3B13A 4PK6A 3DP7A 4UF0B 4WZXA 2JIWA 2FJBA 4K0UA 3AAAB 2R6GF 2V6XA 3B5MA 1W9RA 2QGSA 5LMUT 4TQUN 2H7OA 3DJBA 1UK5A 3KBUA 2BG9B 2BKPA 5HWYA 4CQIA 2WQYA 5HXRA 3ZJ2A 2W63A 3N2OA 2CBIA 2G0UA 5HEUA 4CXYA 4DO0A 4CI1B 3C98B 4QX8B 1SE7A 5A1LA 3C4WA 2V6YB 4OK0A 4I43B 4HGAA 5HCJA 3F57A 4H9PC 5AQJB 5AQTB 2M6BA 4YJ3E 5L3FB 3RYHE 1U5PA 3PUZG 4EV6A 5JR9C 4P0BA 2K9AA 4CZZB 1Z8UA 2J1DG 2L3LA 3SWHA 3OJAA 4YMSC 1G73A 4TQUM 4IE6A 4DV5T 5FNVE 3AA7B 4QXBB 1KEYA 2NTYA 4IDZA 4JYAT 3B57A 2CMRA 4AKGA 2ODUA 3E0ZA 2DWGA 5JDGA 3O9XA 2YN6A 1XNQT 1CUNA 5CJ5A 4P09A 4CN1A 4X5TA 3UUXB 4DR6T 2PFVA 2CXDA 4B6XA 5JDLA 2D9DA 3UQ4A 1S35A 2LSKA 4JUYA 4EXTA 4YMVC 4HFDA 4JI2T 3QC9A 4ZI2D 2CLYB 2WSSV 2DNXA 3M3ZB 4ILAA 3ONLC 2FJAA 4KX6A 3UUBA 5L3BB 4DMVA 4HFCA 5FYMA 3HR0A 3PUSA 4GK0E 4A56A 1T98A 2V7KA 4DR1T 3P4SA 3H3AA 3HL6A 2L8KA 1W09A 2LJLA 4DNDA 1NWMX 5EZYE 2JMKA 5AQRB 3ZCIA 3O1HA 4KUMB 2QYWA 4IE5A 3N9MA 4H9NC 3AAEB 4A5XA 2X9HA 3EUHA 4HE8A 3GA8A 5M4YA 3PUZF 4ZS3A 4JI1T 1AJ3A 5LB7B 4MALA 4BA9A 1ZP0A 3TUZA 1YKHB 2LHRA 5CFBA 3AE7A 1VOMA 4PAGA 3ZSTA 4DR3T 4ERRA 2MTQA 1IZNB 3HA4A 3UU3A 2QVAA 5LG3A 4AI6A 3ZYKA 5JDMA 1IBMT 4AKRB 4JI6T 2VKJA 5F8PA 2JQ9A 3C50A 4X1YE 3JADA 3QB5A 5IHYA 4B3TT 4YT0A 5KXJA 2XQAA 2H89A 3EI0A 3D0TA 4YMTB 4L5GA 3ZYMA 4YTPA 3CIRA 4DV3T 3SRZA 3PUGA 2CXFA 5EK3A 2NW9A 1J5ET 4DR4T 3UFEA 3JAFA 3RRCA 1IBKT 5JR9B 3N5LA 3RI5A 3DTOA 2K3WA 5AQGB 5ABFB 2Y48B 4FI5A 5LBMA 1YKEB 4UVCB 5AQKB 4HFHA 4AKIA 2W66A 2HH7A 4XIGN 1LVFA 5ABGA 1D1BA 2V26A 3ZC1A 2V7MA 5BR8T 2LSGA 3S4UA 2IHR1 1Y64B 3ZMSB 2WM9A 1D0YA 1NAFA 1NENA 1MNEA 3AEDA 1LRZA 1YXRA 3N9LA 2XQ6A 3LBXB 5JRCB 5DQWA 2VL0A 1DU2A 2V7IA 3EDVA 4XIGM 4ZI3C 2XM2A 3CK6A 4YXDA 3SFEA 4IT4A 3CVRA 2WB5A 1XDOA 5DQVA 2FJEA 5TAOA 1SHZC 2ZM8A 3R6NA 2W00A 2WWVA 4EZHA 3D31C 3DHWA 4NXNT 4CN4A 3ONJA 4IE7A 2H7VC 5AQHB 4LFAT 4LF5T 4TZ4C 3IA3A 2VKDA 5L4HA 1ZEEA 3SFDA 1EZ3A 2MAWA 4U72A 4GKKT 1ZHCA 3I0QA 2XHEB 3ZN1B 2CBJA 1D0XA 4TUYE 1BR0A 4H9OC 3I1AA 4YJ2E 2V7LA 2ZM0A 2OV9A 2XASB 3PDYA 3LDQB 4EEBA 4LMJA 2ES0A 3C51A 2EHOD 4HFEA 1T8BA 3CPZA 2YDSA 4Z8XA 4JI7T 2WWUA 4XZCA 1ZKEA 4Z91A 3CQGB 3PUVG 1Y01A 4GIWA 2DCFA 3VRAA 2IUBA 5L3GB 3L09A 1VRBA 3FZFB 2I6HA 2KINB 5H6QB 4KHZG 2C0SA 3ABVA 4AXPA 2BG9C 3PUQA 4AKLA 4HEAA 3O1JA 3VKHA 2X0LB 5LXTE 4O8SA 1MIYA 4L0RA 4HFVA 3CWZB 2EHOB 3TKLB 4YSYA 2LKHA 2LM9A 2K24A 5IYZE 2CPTA 1IJ6A 3IEEA 3KVBA 2IW5B 3N9PA 3RC3A 1HS7A 2FBWA 1KNZA 3KINB 4DV6T 3ZMZB 4Q25A 3ZPOA 4ZI3D 2SPCA 2F4VT 4U3CA 2UXNB 1I6ZA 3K3QC 4MBQA 5L3CB 3NRYA 3V5SA 2BBHA 3PU3A 1I94T 5DABA 4QXHB 1KFYA 3U3IA 4AQYT 1QUUA 4HFIA 3Q5EA 1UCUA 3OVUA 3E22E 4EIWA 4IHJE 4IDPA 3GN5B 3HKDE 4NPPA 2YU2A 4WBNE 4JI3T 5HYAA 1N36T 2W2UA 2GK9A 3PUVF 2QA7A 2YOEA 5L4EA 2A3DA 4CN6A 4KHZF 2D2SA 4ZI7E 1IAPA 2WDQA 3LG7A 5HEGA 5J1GA 4IGUA 2M6IA 4WNKA 1HR0T 1E2AA 2V1DB 2D0TA 1MNDA 1N34T 3L39A 2W62A 4UV9B 2CM0A 2LSYA 3K1SA 1HNWT 1E7PA 4PW8A 4NXMT 4O4IE 3UUMA 3LK3B 4GOUA 3HKCE 1UUSA 3QB5K 4A97A 1MMAA 3QK6A 2VQET 2WU2A 3U78A 4LF7T 5H6RB 3LSVA 1MMGA 4TNWA 2XAHB 2ONKC 4U2ZA 2BKOA 1WR0A 2LOSA 3OYXA 2IC9A 3TLUA 1JNZA 4DV0T 1LVKA 5LHGB 4U7YA 3SOLA 5FMNA 5KMGP 4ZHQE 2RPAA 1XWMA 2IAKA 2PTFA 3PUAA 2MBGA 3MJXA 1KNRA 2VL8A 2JQKA 2NOXA 2ACXA 2YDRA 3RIUA 5HXSA 4C91A 2RP4A 2XY8B 2MOZA 2JQHA 2CHOA 5JDHA 1QSDA 5AQSB 4JLEA 4JI8T 2UXXB 3O1IA 4CI2B 5LBQB 1IJ5A 2N2NA 2CHNA 2XQ9A 3L8RA 3NKZA 3GWHA 4I0UA 2VQFT 1OEDC 3FZLB 3ZCJA 4E7SA 2HN1A 2XSAA 4X1KE 2V6YA 5FY0A 5BMVE 3Q5DA 3AVSA 2AE9A 2CEAA 2X0YA 3N9NA 5HEHA 2YK0A 2HPJA 3QUJA 2WZHA 5LNKA 2DI4A 1ZV4X 2BS3A 4ZZBA 1HNZT 4KI0G 4IREA 5L2LA 4I55E 4LF9T 4TWHA 3AXJA 4QH5A 3UUNA 5LJMA 4QX7B 5EK4A 5HWXA 3KV6A 4QKNA 3P7IA 2LRKA 2XQ5A 4GYRA 3P50A 4U2YA 2DHRA 4YSXA 1YD8G 4PJNA 3WAKA 3UU5A 5HXCA 3NVOA 2LT3A 4U7IA 3C4XA 1NEKA 2OA5A 1QLBA 1UGOA 4XAXB 4HN9A 2E9XA 2ZM2A 2KZ7B 2XAFB 2X51A 1SA0E 4AQGA 4GKJT 2MPKA 4IDOA 2HN2A 2LKGA 3MXZA 1E1HB 2WMNA 3AE6A 4F8HA 3IF8B 4DR5T 4X65T 1X79A 2D5UA 3AE4A 2DL1A 3AAIA 3UU6A 3E08A 3CX8B 2CXLA 3AEAA 3AE9A 4DBQA 5C8YE 4NUVA 2XAJB 4O4JE 4KI0F 4U31A 1FJGT 4AQFA 2H88A 2I59A 4OYJA 2UUAT 1MIVA 4A98A 1BR1A 2VKHA 1FIOA 3A7MA 4JBWG 3ETVA 1U4QA 2IDOB 3AE5A 2EHOC 2CWOA 1MMNA 5FY7A 2K48A 1OEDB 2LSJA 1M62A 2VK9A 2W4XA 3ZSSA 3X1DA 4DV1T 3CKDA 5L47A 3BQLA 5LA6E 4IL4A 4Z90A 2VKOA 4TWFA 4TV8E 5FXZA 2N1GA 3AVRA 3RF1A 2VWAA 1UX5A 4M1PA 3PJAA 3VR9A 4ZEYA 2BBJA 3O4XE 2CE7A 3EDUA 5ABFA 3TLTA 5F3JA 2WAUA 4IDQA 5FXWA 2WY2A 4BAYB 5FL0A 2QRXA 3MK7C 5LJNA 4ZS2A 5FVKA 1OWAA 1N33T 4EZ4A 3KV5A 4YTMA 4GK5E 3HKEE 3AB3B 4X66T 5AQOB 3ZT6A 5AQQB 4AKHA 3I9YA 2VVNA 2LE8A 1HFAA 3F2EA 3HI2A 2LHNA 5L3EB 3TLVA 3FHNA 5FXVA 4CI3B 4DIDB 3GMIA 2ZLYA 3Q5XA 1MMDA 4JBWF 2KXPB 1SUMB 1HNXT 3JC6C 4TX5A 3Q9DA 3ZT7A 1ZOYA 2K5BB 2L9QA 3QOFA 4LF8T 3PE0A 3KV9A 4B3ST 2BDEA 3VHLA 3RRWA 4H9QC 3PTRB 4IL9A 1FMVA 3PUXG 4QH4A 5CA1E 4ISSA 2BKNA 2JMHA 4EOZB 1D1AA 3IHRA 2C5IT 1IBLT 2UXCT 2E5LT 3RGLA 1WYBA 4YTNA 2WS3A 2BVMA 1CHUA 2DWKA 3UTKA 4DUZT 3FXDB 3SS1A 2UXDT 4E7ZA 4X64T 2WBLA 3FZMB 3T8OA 3OTOT 3ANWB 1O3XA 3RIUC 3AA6B 3ONXA 4DMWA 5L3DB 4G63A 2Q9QA 4IIJE 2W67A 4OFZA 4EGWA 2VURA 2XAQB 2WDRA 5FXXA 3ZJ1A 3TUJA 4H9RC 4WW0A 3CX7B 4ASKA 1UURA 3M65A 5HXEA 3Q2MA 4IDNA 4UV8B 2WMOA 2X66A 3C64A 4OYKA 2BVLA 2W0GA 5ABEA 4DBRA 3Q5WA 4YSZA 2WP9A 3FXEB 4H63H 4PK4A 3CQCB 2FJDA 4HWCA 3W15B 3PUXF 3ZMTB 4ZXLA 4DV4T 3FZHB 3KBTA 4HWHA 1WRDA 3JC6D 2LEHA 5AFUL 1YQ3A 3NRXA 5E0OA 5EK2A 1T72A 5ABHA 3K3OA 3P4PA 2N9DA 2WDVA 5CA0E 2KWHA 1V9DA 2RA1A 3ZT5A 1KF6A 5HEOA 5JDFA 4HWFA 5JQGE 3RIFA 2X0HA 4ISTA 3FZKB 4AISA 2HHHT 3PURA 5JH7E 2XQ3A 2UXBT 5J0ZA 4N78D 2JPFA 2UU9T 1X9BA 2V5DA 3IBPA 4HWDA 2E9XC 2Y6XA 1MIWA 1GQEA 3QNUA 3CQXC 4WYVA 2B76A 2KT9A 2JRKA 2ZM6T 4YFSA 1L0VA 4QWNB 4PJMA 3VRBA 2YINA 4PJJA 3ZLIA 2X68A 4EAHA 4XTCN 4O2BE 3RLFG 3NWIA 4PFOA 3FB2A 3L3PA 5J2UE 2E2AA 2ACZA 2ODVA 2I0MA 1WLXA 3FBLA 4UXNB 1HX1B 4U74A 4AQFC 2V7JA 3PV0G 2BS4A 4UF0A 3P4QA 4EYYR 1Z0PA 3PUWG 2W61A 1FEWA 4X20E 5HXHA 4XTCM 5AQVB 1WR6A 1BR4A 1G8XA 2D0UA 2BG9A 2XQ4A 3JAEA 2B1EA 1FMWA 4ILUA 3V5UA 5F5WA 3PUYG 3RYFE 3RQWA 4UVAB 2Y8DA 2VVSA 3PJAJ 4MHCA 4X1IE 3TLWA 1OXZA 2YU1A 4LMLA 3AXJB 2AXDS 1XMQT 3AA0B 3RLFF 3N2KE 3ZKRA 4YLHA 1HTJF 5FY1A 2KNDA 2E9XD 5C2TA 3P8CD 4EEDA 3K3NA 1HG2A 3KVAA 4LF4T 5C3JA 1US7B 2C5JA 5LGNB 5JVDE 3TLSA 2H3RA 3A5XA 4LF6T 3RC8A 3PV0F 2J4GA 3AECA 2KWIB 2LM2A 2WZIA 3PUWF 2LSIA 3C4ZA 2E9XB 2WCAA 2BG9E 4PJLA 3ZMUB 5LP6E 2XQ8A 4DV7T 4OX9T 3AEFA 3UULA 2X9YA 5LHIB 2XPKA 4O2AE 5IWAT 5GONE 3ESLA 1KNPA 5LMNT 3VKGA 4J2CA 2PBIA 3AE3A 2NP9A 4KHPT 4TNVA 2XUEA 3NBXX 4F6RC 1LKXA 3ZMVB 3PUYF 5HAXA 3AEEA 1W0AA 4MLKA 4DR7T 1W0BA 3N2GE 4EYUA 5AQFB 4KP3C 3MZKB 2BS2A 1JNRA 2HPLA 1D0ZA 2CA5A 5AQUB 4EB6E 4C90A 3KFWX 3RQUA 2A9UA 2YDQA 4ZOLE 5ETWA 4YMWC 1HX8A 2DLRA 4H9SE 4K0KT 4LFCT 2V5CA 4KBMB 3PU8A 4B3MT 4LMKA 3A8YC 3R84B 3P4WA 5LOVE 4NUUA 4TV9E 5JDNA 2FUPA 1R8IA 4CXWA 2Q9QC 4ANJA 3HKBE 2J47A 2X67A 4BJMA 2CWYA 1T7SA 1XNRT 2JQQA 4I50E 4JI5T 3UQ7A 4P0AA 4KMCA 2X9XA 4DVDA 3AEBA 2XTLA 2KMFA 4ILCA 3AE1A 5FKYA 2Z6EA 4V1Av 4YMUC 4QXCB 3NZPA 1B7TA 1HCIA 2NR4A 3RIAA 5FP3A 5HCMA 4HFBA 4IE4A 3BK9A 4CXXA 3ZYLA 5JR9A 2NWBA 2PJQA 2IIUA 5LGTB 2ZMAA 5FL1A 2V8SV 2XSBA 3OYZA 4O4HE 3AE2A 3AA1B 2J62A 1J1JA 1OEDA 3LK42 1WYCA 2KSRA 3WAJA 3ZC0A 5AQNB 4P1NA 5AQIB 5JREA 2XJ7A 3K8PC 2NW7A 1WCRA 4I4TE 1J5WA 3RYCE 3KDSE 5JTGA 2JJ9A 4G2AA 1M7KA 4OHFA 3RX6A 2X9WA 3EVYA 3TUIA 4LFBT 4L9IA 3LBXA 4FJOA 5IUXA 5JRCA 4ADZA 4H63V 3BQKA 3H3MA 2LLYA 3P4RA 3ZEFB 4HTEA 2UUCT 4ILBA 2BZBA 3WI3A 3CX6B 3MACA 4JEHB 4MFRA 5LYJE 4ZZCA 4U33A 5AQLB 2Q9QD 3OBVE 4PNIA 2PG8A 1VCSA 2UUBT 2A2FX 5KX5E 2IC6A 3UU8A 5CGMA 1KK7A 2YKSA 3RKOA 3OKQA 1UX4A 1OEDE 1D1CA 4UVBB 3RHWA 3MKDA 2E5VA 2LOPA 3RPUA 2XZEA 3NZQA 4IE0A 4PK5A 2P9BA 4YHHT 2VB6A 2XQYA 2Q9QB 3RH3A 4QH1A 3VU7H 4DV2T 3FBZA 3RKGA 3EHZA 1VCTA 3I9WA 3J9X1 3UFGA 5DJQC 5LG4A 4JI4T 2A72A 5HEJA 1HF8A 3F31A 2WU5A 2NW8A 3RYIE 4TWDA 3N9QA 1YW0A 5JDQA 3ANWA 3T1HT 4XBFB 4B3RT 4WBOA 5FVLA 1XDPA 2LRLA 3H37A 4QHOA 1N32T 2EHOA 4JI0T 1YQ4A 1S94A 2IMLA 4TN7B 3LK2B 5AQPB 2R6GG 3KV4A 3EAMA 3EABA 1BR2A 4GYSA 5KDMC 3MA9A 2CCQA 2XAGB 4O4LE 2VASA 4X62T 1H7CA 1XZYA 3OPCA 3J7Yq 1HG5A 3BQIA 3G06A 4BJNA 1XMOT 1WFDA 2NTXA 3LFMA 3ETUA 5AQMB 3ZN0B 3N9OA 3LJCA 4DUYT 5CB4E 2CLYC 3UU4A 5ADXL 4HKAA 2C5KT 3UT5E 4DR2T 3GN5A 4UEMA 2KLQA
chains in the Genus database with same CATH topology
3RLFG 4YMVC 2R6GF 2R6GG 4XTCM 3PV0F 3D31C 3DHWA 3PV0G 4KI0F 4KI0G 3TUZA 3TUJA 3RLFF 4XIGM 3TUIA 4XIGN 4YMSC 3PUVF 4TQUM 3PUWF 3PUVG 4TQUN 4YMUC 3PUWG 4YMWC 3PUYF 4YMTB 3PUXF 3PUYG 4KHZF 3PUXG 2ONKC 4KHZG 4JBWF 3PUZF 4JBWG 4XTCN 3PUZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLF G;  4YMV C;  2R6G F;  2R6G G;  4XTC M;  3PV0 F;  3D31 C;  3DHW A;  3PV0 G;  4KI0 F;  4KI0 G;  3TUZ A;  3TUJ A;  3RLF F;  4XIG M;  3TUI A;  4XIG N;  4YMS C;  3PUV F;  4TQU M;  3PUW F;  3PUV G;  4TQU N;  4YMU C;  3PUW G;  4YMW C;  3PUY F;  4YMT B;  3PUX F;  3PUY G;  4KHZ F;  3PUX G;  2ONK C;  4KHZ G;  4JBW F;  3PUZ F;  4JBW G;  4XTC N;  3PUZ G; 
#chains in the Genus database with same CATH topology
 3CML A;  4HWI B;  3JCF A;  4JEU B;  4YHJ A;  4JV5 T;  2M67 A;  3VR8 A;  2XQ7 A;  2OLT A;  3T1Y T;  4AIU A;  4UIG A;  4UR9 A;  4PFP A;  2MYS A;  2YEV C;  5J2T E;  4ZI2 C;  4COF A;  3AEG A;  4UEL A;  3I0O A;  4YY3 T;  2XM1 A;  4NIQ A;  3AE8 A;  5LHH B;  5LCY A;  2E8I A;  2CRB A;  5LGU B;  3B13 A;  4PK6 A;  3DP7 A;  4UF0 B;  4WZX A;  2JIW A;  2FJB A;  4K0U A;  3AAA B;  2R6G F;  2V6X A;  3B5M A;  1W9R A;  2QGS A;  5LMU T;  4TQU N;  2H7O A;  3DJB A;  1UK5 A;  3KBU A;  2BG9 B;  2BKP A;  5HWY A;  4CQI A;  2WQY A;  5HXR A;  3ZJ2 A;  2W63 A;  3N2O A;  2CBI A;  2G0U A;  5HEU A;  4CXY A;  4DO0 A;  4CI1 B;  3C98 B;  4QX8 B;  1SE7 A;  5A1L A;  3C4W A;  2V6Y B;  4OK0 A;  4I43 B;  4HGA A;  5HCJ A;  3F57 A;  4H9P C;  5AQJ B;  5AQT B;  2M6B A;  4YJ3 E;  5L3F B;  3RYH E;  1U5P A;  3PUZ G;  4EV6 A;  5JR9 C;  4P0B A;  2K9A A;  4CZZ B;  1Z8U A;  2J1D G;  2L3L A;  3SWH A;  3OJA A;  4YMS C;  1G73 A;  4TQU M;  4IE6 A;  4DV5 T;  5FNV E;  3AA7 B;  4QXB B;  1KEY A;  2NTY A;  4IDZ A;  4JYA T;  3B57 A;  2CMR A;  4AKG A;  2ODU A;  3E0Z A;  2DWG A;  5JDG A;  3O9X A;  2YN6 A;  1XNQ T;  1CUN A;  5CJ5 A;  4P09 A;  4CN1 A;  4X5T A;  3UUX B;  4DR6 T;  2PFV A;  2CXD A;  4B6X A;  5JDL A;  2D9D A;  3UQ4 A;  1S35 A;  2LSK A;  4JUY A;  4EXT A;  4YMV C;  4HFD A;  4JI2 T;  3QC9 A;  4ZI2 D;  2CLY B;  2WSS V;  2DNX A;  3M3Z B;  4ILA A;  3ONL C;  2FJA A;  4KX6 A;  3UUB A;  5L3B B;  4DMV A;  4HFC A;  5FYM A;  3HR0 A;  3PUS A;  4GK0 E;  4A56 A;  1T98 A;  2V7K A;  4DR1 T;  3P4S A;  3H3A A;  3HL6 A;  2L8K A;  1W09 A;  2LJL A;  4DND A;  1NWM X;  5EZY E;  2JMK A;  5AQR B;  3ZCI A;  3O1H A;  4KUM B;  2QYW A;  4IE5 A;  3N9M A;  4H9N C;  3AAE B;  4A5X A;  2X9H A;  3EUH A;  4HE8 A;  3GA8 A;  5M4Y A;  3PUZ F;  4ZS3 A;  4JI1 T;  1AJ3 A;  5LB7 B;  4MAL A;  4BA9 A;  1ZP0 A;  3TUZ A;  1YKH B;  2LHR A;  5CFB A;  3AE7 A;  1VOM A;  4PAG A;  3ZST A;  4DR3 T;  4ERR A;  2MTQ A;  1IZN B;  3HA4 A;  3UU3 A;  2QVA A;  5LG3 A;  4AI6 A;  3ZYK A;  5JDM A;  1IBM T;  4AKR B;  4JI6 T;  2VKJ A;  5F8P A;  2JQ9 A;  3C50 A;  4X1Y E;  3JAD A;  3QB5 A;  5IHY A;  4B3T T;  4YT0 A;  5KXJ A;  2XQA A;  2H89 A;  3EI0 A;  3D0T A;  4YMT B;  4L5G A;  3ZYM A;  4YTP A;  3CIR A;  4DV3 T;  3SRZ A;  3PUG A;  2CXF A;  5EK3 A;  2NW9 A;  1J5E T;  4DR4 T;  3UFE A;  3JAF A;  3RRC A;  1IBK T;  5JR9 B;  3N5L A;  3RI5 A;  3DTO A;  2K3W A;  5AQG B;  5ABF B;  2Y48 B;  4FI5 A;  5LBM A;  1YKE B;  4UVC B;  5AQK B;  4HFH A;  4AKI A;  2W66 A;  2HH7 A;  4XIG N;  1LVF A;  5ABG A;  1D1B A;  2V26 A;  3ZC1 A;  2V7M A;  5BR8 T;  2LSG A;  3S4U A;  2IHR 1;  1Y64 B;  3ZMS B;  2WM9 A;  1D0Y A;  1NAF A;  1NEN A;  1MNE A;  3AED A;  1LRZ A;  1YXR A;  3N9L A;  2XQ6 A;  3LBX B;  5JRC B;  5DQW A;  2VL0 A;  1DU2 A;  2V7I A;  3EDV A;  4XIG M;  4ZI3 C;  2XM2 A;  3CK6 A;  4YXD A;  3SFE A;  4IT4 A;  3CVR A;  2WB5 A;  1XDO A;  5DQV A;  2FJE A;  5TAO A;  1SHZ C;  2ZM8 A;  3R6N A;  2W00 A;  2WWV A;  4EZH A;  3D31 C;  3DHW A;  4NXN T;  4CN4 A;  3ONJ A;  4IE7 A;  2H7V C;  5AQH B;  4LFA T;  4LF5 T;  4TZ4 C;  3IA3 A;  2VKD A;  5L4H A;  1ZEE A;  3SFD A;  1EZ3 A;  2MAW A;  4U72 A;  4GKK T;  1ZHC A;  3I0Q A;  2XHE B;  3ZN1 B;  2CBJ A;  1D0X A;  4TUY E;  1BR0 A;  4H9O C;  3I1A A;  4YJ2 E;  2V7L A;  2ZM0 A;  2OV9 A;  2XAS B;  3PDY A;  3LDQ B;  4EEB A;  4LMJ A;  2ES0 A;  3C51 A;  2EHO D;  4HFE A;  1T8B A;  3CPZ A;  2YDS A;  4Z8X A;  4JI7 T;  2WWU A;  4XZC A;  1ZKE A;  4Z91 A;  3CQG B;  3PUV G;  1Y01 A;  4GIW A;  2DCF A;  3VRA A;  2IUB A;  5L3G B;  3L09 A;  1VRB A;  3FZF B;  2I6H A;  2KIN B;  5H6Q B;  4KHZ G;  2C0S A;  3ABV A;  4AXP A;  2BG9 C;  3PUQ A;  4AKL A;  4HEA A;  3O1J A;  3VKH A;  2X0L B;  5LXT E;  4O8S A;  1MIY A;  4L0R A;  4HFV A;  3CWZ B;  2EHO B;  3TKL B;  4YSY A;  2LKH A;  2LM9 A;  2K24 A;  5IYZ E;  2CPT A;  1IJ6 A;  3IEE A;  3KVB A;  2IW5 B;  3N9P A;  3RC3 A;  1HS7 A;  2FBW A;  1KNZ A;  3KIN B;  4DV6 T;  3ZMZ B;  4Q25 A;  3ZPO A;  4ZI3 D;  2SPC A;  2F4V T;  4U3C A;  2UXN B;  1I6Z A;  3K3Q C;  4MBQ A;  5L3C B;  3NRY A;  3V5S A;  2BBH A;  3PU3 A;  1I94 T;  5DAB A;  4QXH B;  1KFY A;  3U3I A;  4AQY T;  1QUU A;  4HFI A;  3Q5E A;  1UCU A;  3OVU A;  3E22 E;  4EIW A;  4IHJ E;  4IDP A;  3GN5 B;  3HKD E;  4NPP A;  2YU2 A;  4WBN E;  4JI3 T;  5HYA A;  1N36 T;  2W2U A;  2GK9 A;  3PUV F;  2QA7 A;  2YOE A;  5L4E A;  2A3D A;  4CN6 A;  4KHZ F;  2D2S A;  4ZI7 E;  1IAP A;  2WDQ A;  3LG7 A;  5HEG A;  5J1G A;  4IGU A;  2M6I A;  4WNK A;  1HR0 T;  1E2A A;  2V1D B;  2D0T A;  1MND A;  1N34 T;  3L39 A;  2W62 A;  4UV9 B;  2CM0 A;  2LSY A;  3K1S A;  1HNW T;  1E7P A;  4PW8 A;  4NXM T;  4O4I E;  3UUM A;  3LK3 B;  4GOU A;  3HKC E;  1UUS A;  3QB5 K;  4A97 A;  1MMA A;  3QK6 A;  2VQE T;  2WU2 A;  3U78 A;  4LF7 T;  5H6R B;  3LSV A;  1MMG A;  4TNW A;  2XAH B;  2ONK C;  4U2Z A;  2BKO A;  1WR0 A;  2LOS A;  3OYX A;  2IC9 A;  3TLU A;  1JNZ A;  4DV0 T;  1LVK A;  5LHG B;  4U7Y A;  3SOL A;  5FMN A;  5KMG P;  4ZHQ E;  2RPA A;  1XWM A;  2IAK A;  2PTF A;  3PUA A;  2MBG A;  3MJX A;  1KNR A;  2VL8 A;  2JQK A;  2NOX A;  2ACX A;  2YDR A;  3RIU A;  5HXS A;  4C91 A;  2RP4 A;  2XY8 B;  2MOZ A;  2JQH A;  2CHO A;  5JDH A;  1QSD A;  5AQS B;  4JLE A;  4JI8 T;  2UXX B;  3O1I A;  4CI2 B;  5LBQ B;  1IJ5 A;  2N2N A;  2CHN A;  2XQ9 A;  3L8R A;  3NKZ A;  3GWH A;  4I0U A;  2VQF T;  1OED C;  3FZL B;  3ZCJ A;  4E7S A;  2HN1 A;  2XSA A;  4X1K E;  2V6Y A;  5FY0 A;  5BMV E;  3Q5D A;  3AVS A;  2AE9 A;  2CEA A;  2X0Y A;  3N9N A;  5HEH A;  2YK0 A;  2HPJ A;  3QUJ A;  2WZH A;  5LNK A;  2DI4 A;  1ZV4 X;  2BS3 A;  4ZZB A;  1HNZ T;  4KI0 G;  4IRE A;  5L2L A;  4I55 E;  4LF9 T;  4TWH A;  3AXJ A;  4QH5 A;  3UUN A;  5LJM A;  4QX7 B;  5EK4 A;  5HWX A;  3KV6 A;  4QKN A;  3P7I A;  2LRK A;  2XQ5 A;  4GYR A;  3P50 A;  4U2Y A;  2DHR A;  4YSX A;  1YD8 G;  4PJN A;  3WAK A;  3UU5 A;  5HXC A;  3NVO A;  2LT3 A;  4U7I A;  3C4X A;  1NEK A;  2OA5 A;  1QLB A;  1UGO A;  4XAX B;  4HN9 A;  2E9X A;  2ZM2 A;  2KZ7 B;  2XAF B;  2X51 A;  1SA0 E;  4AQG A;  4GKJ T;  2MPK A;  4IDO A;  2HN2 A;  2LKG A;  3MXZ A;  1E1H B;  2WMN A;  3AE6 A;  4F8H A;  3IF8 B;  4DR5 T;  4X65 T;  1X79 A;  2D5U A;  3AE4 A;  2DL1 A;  3AAI A;  3UU6 A;  3E08 A;  3CX8 B;  2CXL A;  3AEA A;  3AE9 A;  4DBQ A;  5C8Y E;  4NUV A;  2XAJ B;  4O4J E;  4KI0 F;  4U31 A;  1FJG T;  4AQF A;  2H88 A;  2I59 A;  4OYJ A;  2UUA T;  1MIV A;  4A98 A;  1BR1 A;  2VKH A;  1FIO A;  3A7M A;  4JBW G;  3ETV A;  1U4Q A;  2IDO B;  3AE5 A;  2EHO C;  2CWO A;  1MMN A;  5FY7 A;  2K48 A;  1OED B;  2LSJ A;  1M62 A;  2VK9 A;  2W4X A;  3ZSS A;  3X1D A;  4DV1 T;  3CKD A;  5L47 A;  3BQL A;  5LA6 E;  4IL4 A;  4Z90 A;  2VKO A;  4TWF A;  4TV8 E;  5FXZ A;  2N1G A;  3AVR A;  3RF1 A;  2VWA A;  1UX5 A;  4M1P A;  3PJA A;  3VR9 A;  4ZEY A;  2BBJ A;  3O4X E;  2CE7 A;  3EDU A;  5ABF A;  3TLT A;  5F3J A;  2WAU A;  4IDQ A;  5FXW A;  2WY2 A;  4BAY B;  5FL0 A;  2QRX A;  3MK7 C;  5LJN A;  4ZS2 A;  5FVK A;  1OWA A;  1N33 T;  4EZ4 A;  3KV5 A;  4YTM A;  4GK5 E;  3HKE E;  3AB3 B;  4X66 T;  5AQO B;  3ZT6 A;  5AQQ B;  4AKH A;  3I9Y A;  2VVN A;  2LE8 A;  1HFA A;  3F2E A;  3HI2 A;  2LHN A;  5L3E B;  3TLV A;  3FHN A;  5FXV A;  4CI3 B;  4DID B;  3GMI A;  2ZLY A;  3Q5X A;  1MMD A;  4JBW F;  2KXP B;  1SUM B;  1HNX T;  3JC6 C;  4TX5 A;  3Q9D A;  3ZT7 A;  1ZOY A;  2K5B B;  2L9Q A;  3QOF A;  4LF8 T;  3PE0 A;  3KV9 A;  4B3S T;  2BDE A;  3VHL A;  3RRW A;  4H9Q C;  3PTR B;  4IL9 A;  1FMV A;  3PUX G;  4QH4 A;  5CA1 E;  4ISS A;  2BKN A;  2JMH A;  4EOZ B;  1D1A A;  3IHR A;  2C5I T;  1IBL T;  2UXC T;  2E5L T;  3RGL A;  1WYB A;  4YTN A;  2WS3 A;  2BVM A;  1CHU A;  2DWK A;  3UTK A;  4DUZ T;  3FXD B;  3SS1 A;  2UXD T;  4E7Z A;  4X64 T;  2WBL A;  3FZM B;  3T8O A;  3OTO T;  3ANW B;  1O3X A;  3RIU C;  3AA6 B;  3ONX A;  4DMW A;  5L3D B;  4G63 A;  2Q9Q A;  4IIJ E;  2W67 A;  4OFZ A;  4EGW A;  2VUR A;  2XAQ B;  2WDR A;  5FXX A;  3ZJ1 A;  3TUJ A;  4H9R C;  4WW0 A;  3CX7 B;  4ASK A;  1UUR A;  3M65 A;  5HXE A;  3Q2M A;  4IDN A;  4UV8 B;  2WMO A;  2X66 A;  3C64 A;  4OYK A;  2BVL A;  2W0G A;  5ABE A;  4DBR A;  3Q5W A;  4YSZ A;  2WP9 A;  3FXE B;  4H63 H;  4PK4 A;  3CQC B;  2FJD A;  4HWC A;  3W15 B;  3PUX F;  3ZMT B;  4ZXL A;  4DV4 T;  3FZH B;  3KBT A;  4HWH A;  1WRD A;  3JC6 D;  2LEH A;  5AFU L;  1YQ3 A;  3NRX A;  5E0O A;  5EK2 A;  1T72 A;  5ABH A;  3K3O A;  3P4P A;  2N9D A;  2WDV A;  5CA0 E;  2KWH A;  1V9D A;  2RA1 A;  3ZT5 A;  1KF6 A;  5HEO A;  5JDF A;  4HWF A;  5JQG E;  3RIF A;  2X0H A;  4IST A;  3FZK B;  4AIS A;  2HHH T;  3PUR A;  5JH7 E;  2XQ3 A;  2UXB T;  5J0Z A;  4N78 D;  2JPF A;  2UU9 T;  1X9B A;  2V5D A;  3IBP A;  4HWD A;  2E9X C;  2Y6X A;  1MIW A;  1GQE A;  3QNU A;  3CQX C;  4WYV A;  2B76 A;  2KT9 A;  2JRK A;  2ZM6 T;  4YFS A;  1L0V A;  4QWN B;  4PJM A;  3VRB A;  2YIN A;  4PJJ A;  3ZLI A;  2X68 A;  4EAH A;  4XTC N;  4O2B E;  3RLF G;  3NWI A;  4PFO A;  3FB2 A;  3L3P A;  5J2U E;  2E2A A;  2ACZ A;  2ODV A;  2I0M A;  1WLX A;  3FBL A;  4UXN B;  1HX1 B;  4U74 A;  4AQF C;  2V7J A;  3PV0 G;  2BS4 A;  4UF0 A;  3P4Q A;  4EYY R;  1Z0P A;  3PUW G;  2W61 A;  1FEW A;  4X20 E;  5HXH A;  4XTC M;  5AQV B;  1WR6 A;  1BR4 A;  1G8X A;  2D0U A;  2BG9 A;  2XQ4 A;  3JAE A;  2B1E A;  1FMW A;  4ILU A;  3V5U A;  5F5W A;  3PUY G;  3RYF E;  3RQW A;  4UVA B;  2Y8D A;  2VVS A;  3PJA J;  4MHC A;  4X1I E;  3TLW A;  1OXZ A;  2YU1 A;  4LML A;  3AXJ B;  2AXD S;  1XMQ T;  3AA0 B;  3RLF F;  3N2K E;  3ZKR A;  4YLH A;  1HTJ F;  5FY1 A;  2KND A;  2E9X D;  5C2T A;  3P8C D;  4EED A;  3K3N A;  1HG2 A;  3KVA A;  4LF4 T;  5C3J A;  1US7 B;  2C5J A;  5LGN B;  5JVD E;  3TLS A;  2H3R A;  3A5X A;  4LF6 T;  3RC8 A;  3PV0 F;  2J4G A;  3AEC A;  2KWI B;  2LM2 A;  2WZI A;  3PUW F;  2LSI A;  3C4Z A;  2E9X B;  2WCA A;  2BG9 E;  4PJL A;  3ZMU B;  5LP6 E;  2XQ8 A;  4DV7 T;  4OX9 T;  3AEF A;  3UUL A;  2X9Y A;  5LHI B;  2XPK A;  4O2A E;  5IWA T;  5GON E;  3ESL A;  1KNP A;  5LMN T;  3VKG A;  4J2C A;  2PBI A;  3AE3 A;  2NP9 A;  4KHP T;  4TNV A;  2XUE A;  3NBX X;  4F6R C;  1LKX A;  3ZMV B;  3PUY F;  5HAX A;  3AEE A;  1W0A A;  4MLK A;  4DR7 T;  1W0B A;  3N2G E;  4EYU A;  5AQF B;  4KP3 C;  3MZK B;  2BS2 A;  1JNR A;  2HPL A;  1D0Z A;  2CA5 A;  5AQU B;  4EB6 E;  4C90 A;  3KFW X;  3RQU A;  2A9U A;  2YDQ A;  4ZOL E;  5ETW A;  4YMW C;  1HX8 A;  2DLR A;  4H9S E;  4K0K T;  4LFC T;  2V5C A;  4KBM B;  3PU8 A;  4B3M T;  4LMK A;  3A8Y C;  3R84 B;  3P4W A;  5LOV E;  4NUU A;  4TV9 E;  5JDN A;  2FUP A;  1R8I A;  4CXW A;  2Q9Q C;  4ANJ A;  3HKB E;  2J47 A;  2X67 A;  4BJM A;  2CWY A;  1T7S A;  1XNR T;  2JQQ A;  4I50 E;  4JI5 T;  3UQ7 A;  4P0A A;  4KMC A;  2X9X A;  4DVD A;  3AEB A;  2XTL A;  2KMF A;  4ILC A;  3AE1 A;  5FKY A;  2Z6E A;  4V1A v;  4YMU C;  4QXC B;  3NZP A;  1B7T A;  1HCI A;  2NR4 A;  3RIA A;  5FP3 A;  5HCM A;  4HFB A;  4IE4 A;  3BK9 A;  4CXX A;  3ZYL A;  5JR9 A;  2NWB A;  2PJQ A;  2IIU A;  5LGT B;  2ZMA A;  5FL1 A;  2V8S V;  2XSB A;  3OYZ A;  4O4H E;  3AE2 A;  3AA1 B;  2J62 A;  1J1J A;  1OED A;  3LK4 2;  1WYC A;  2KSR A;  3WAJ A;  3ZC0 A;  5AQN B;  4P1N A;  5AQI B;  5JRE A;  2XJ7 A;  3K8P C;  2NW7 A;  1WCR A;  4I4T E;  1J5W A;  3RYC E;  3KDS E;  5JTG A;  2JJ9 A;  4G2A A;  1M7K A;  4OHF A;  3RX6 A;  2X9W A;  3EVY A;  3TUI A;  4LFB T;  4L9I A;  3LBX A;  4FJO A;  5IUX A;  5JRC A;  4ADZ A;  4H63 V;  3BQK A;  3H3M A;  2LLY A;  3P4R A;  3ZEF B;  4HTE A;  2UUC T;  4ILB A;  2BZB A;  3WI3 A;  3CX6 B;  3MAC A;  4JEH B;  4MFR A;  5LYJ E;  4ZZC A;  4U33 A;  5AQL B;  2Q9Q D;  3OBV E;  4PNI A;  2PG8 A;  1VCS A;  2UUB T;  2A2F X;  5KX5 E;  2IC6 A;  3UU8 A;  5CGM A;  1KK7 A;  2YKS A;  3RKO A;  3OKQ A;  1UX4 A;  1OED E;  1D1C A;  4UVB B;  3RHW A;  3MKD A;  2E5V A;  2LOP A;  3RPU A;  2XZE A;  3NZQ A;  4IE0 A;  4PK5 A;  2P9B A;  4YHH T;  2VB6 A;  2XQY A;  2Q9Q B;  3RH3 A;  4QH1 A;  3VU7 H;  4DV2 T;  3FBZ A;  3RKG A;  3EHZ A;  1VCT A;  3I9W A;  3J9X 1;  3UFG A;  5DJQ C;  5LG4 A;  4JI4 T;  2A72 A;  5HEJ A;  1HF8 A;  3F31 A;  2WU5 A;  2NW8 A;  3RYI E;  4TWD A;  3N9Q A;  1YW0 A;  5JDQ A;  3ANW A;  3T1H T;  4XBF B;  4B3R T;  4WBO A;  5FVL A;  1XDP A;  2LRL A;  3H37 A;  4QHO A;  1N32 T;  2EHO A;  4JI0 T;  1YQ4 A;  1S94 A;  2IML A;  4TN7 B;  3LK2 B;  5AQP B;  2R6G G;  3KV4 A;  3EAM A;  3EAB A;  1BR2 A;  4GYS A;  5KDM C;  3MA9 A;  2CCQ A;  2XAG B;  4O4L E;  2VAS A;  4X62 T;  1H7C A;  1XZY A;  3OPC A;  3J7Y q;  1HG5 A;  3BQI A;  3G06 A;  4BJN A;  1XMO T;  1WFD A;  2NTX A;  3LFM A;  3ETU A;  5AQM B;  3ZN0 B;  3N9O A;  3LJC A;  4DUY T;  5CB4 E;  2CLY C;  3UU4 A;  5ADX L;  4HKA A;  2C5K T;  3UT5 E;  4DR2 T;  3GN5 A;  4UEM A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 3RLF G;  4YMV C;  2R6G F;  2R6G G;  4XTC M;  3PV0 F;  3D31 C;  3DHW A;  3PV0 G;  4KI0 F;  4KI0 G;  3TUZ A;  3TUJ A;  3RLF F;  4XIG M;  3TUI A;  4XIG N;  4YMS C;  3PUV F;  4TQU M;  3PUW F;  3PUV G;  4TQU N;  4YMU C;  3PUW G;  4YMW C;  3PUY F;  4YMT B;  3PUX F;  3PUY G;  4KHZ F;  3PUX G;  2ONK C;  4KHZ G;  4JBW F;  3PUZ F;  4JBW G;  4XTC N;  3PUZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...