3PV0F

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
488
structure length
483
Chain Sequence
b'SVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 138
structure length 483
sequence length 488
ec nomenclature
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3pv0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3pv0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3pv0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3pv0F02
4KHZG 3D31C 3DHWA 4YMWC 4JBWG 3PUXF 2R6GF 3PV0G 4KI0F 4YMSC 3PUZF 4TQUM 3PUVG 3PUWG 2ONKC 3PUYG 4YMUC 3RLFG 4YMTB 4XTCM 4KHZF 3TUJA 4XIGM 4JBWF 3PUXG 2R6GG 3PV0F 3TUZA 3TUIA 4KI0G 4TQUN 3PUVF 3PUZG 3PUYF 4YMVC 4XTCN 3PUWF 3RLFF 4XIGN
chains in the Genus database with same CATH superfamily
4LMJA 1BR2A 4P0BA 4AKRB 2LHNA 4G2AA 3TLSA 3TLWA 4X1KE 4X66T 3PV0G 4A97A 4C90A 2H7VC 5H6QB 2Z6EA 3HL6A 3KFWX 5AFUL 1IBLT 5CFBA 4OK0A 5J0ZA 2MYSA 1YKHB 1IJ5A 5L3GB 3K3NA 1X9BA 3P50A 3D0TA 3I0OA 3FHNA 5GONE 3NWIA 5TAOA 1KFYA 5FL1A 1HX8A 2V8SV 4I43B 3ZT5A 1SE7A 4ILCA 1ZEEA 3TUJA 3LSVA 4XAXB 3H3AA 3UU5A 2CM0A 1LVKA 3AE3A 5LNKA 4B6XA 4OFZA 4U2YA 3PE0A 3LK3B 3AA7B 4IIJE 2V7IA 2WMNA 4IREA 3RI5A 3RHWA 3CIRA 5JDGA 2B76A 4IHJE 3FZKB 1NENA 5LBMA 3UU8A 4U33A 4KHZG 3Q5EA 4IL4A 4DV2T 5L4HA 5J2UE 3CX6B 4IE0A 1R8IA 3ZMZB 4TNWA 2V7JA 1S35A 3O1HA 5BMVE 1O3XA 4OYKA 3R84B 4YSYA 1HG5A 3G06A 4L0RA 2UXDT 4CXWA 3L3PA 3RYFE 2IUBA 2LE8A 3UU3A 4PFOA 2XQ3A 3MK7C 3UUMA 5L4EA 4I55E 3C51A 5J2TE 4YSXA 3ZJ1A 2V26A 3Q5DA 3PU3A 3ETUA 4AXPA 3ZLIA 4QXHB 2CXDA 2XAGB 3GA8A 2V7MA 1G73A 4JI2T 4XBFB 4X65T 2R6GF 3CKDA 4UR9A 2WM9A 4KBMB 1HNWT 3BQLA 4YTMA 2JQKA 5LG4A 4QH1A 2IMLA 1N33T 1GQEA 4IE6A 5LJNA 4PK6A 5JH7E 1MIYA 1XZYA 2LKGA 3SWHA 5FKYA 3EI0A 4DUYT 5HCMA 4Z8XA 4CN6A 4KHPT 3UU4A 1HFAA 3F57A 5AQVB 4E7ZA 3L8RA 5FL0A 4DNDA 1MNEA 2WWUA 3AAAB 2DLRA 4HFCA 2DHRA 5C8YE 3A7MA 2PJQA 5CGMA 4BA9A 3RIFA 5IWAT 3LDQB 3B57A 2Q9QD 3B13A 4LF9T 4EGWA 3P4WA 2N9DA 4ZI3D 1G8XA 1MIWA 4JI5T 1D1BA 1YQ4A 2CHOA 2V6YA 4LF4T 3AEGA 3QK6A 4IDPA 2YU1A 2H88A 3ONXA 4HWFA 4U74A 3RYCE 1OXZA 5JR9C 3MA9A 5FNVE 3QNUA 2X9XA 4DR7T 1V9DA 2LSGA 2C5JA 3EUHA 2D0TA 2Q9QC 3TUZA 3H37A 1YW0A 4HWIB 3OPCA 1LKXA 5C3JA 2YKSA 5AQQB 3UUXB 5LGNB 2SPCA 5LYJE 1N34T 4DV4T 4Z91A 5A1LA 5FVKA 4BJMA 2YOEA 1JNZA 3NRXA 1CHUA 2J4GA 2NTXA 2W63A 4O4JE 2XAQB 3KBUA 2WDRA 5ABEA 1N36T 4QH4A 4V1Av 2UXXB 3KINB 4B3ST 1HF8A 5JR9B 3T8OA 1WCRA 3M65A 3UUNA 5FXWA 3MXZA 5IUXA 1MMDA 2UUBT 2Q9QB 4IE7A 5AQKB 1Z0PA 3C64A 3AE8A 2WY2A 3PUAA 4TV8E 1LRZA 4DR5T 4WNKA 3PV0F 2XQ6A 5HXCA 3D31C 2L3LA 5CA1E 4EB6E 4HFVA 2WB5A 2LSKA 3AE2A 3I1AA 2JRKA 2VK9A 4CXYA 2WAUA 1HTJF 4UVBB 4PNIA 3AAEB 3KVBA 5HXRA 4EOZB 4X64T 1KNRA 3P7IA 4YHHT 5FVLA 3T1YT 4OYJA 3VHLA 5HXHA 3VR8A 4UV8B 2UXCT 2OA5A 4IDZA 3HKEE 1J1JA 5AQSB 4DMVA 2VL8A 2CMRA 4HFBA 3PDYA 4TQUN 1BR0A 1QLBA 1U4QA 3S4UA 3AAIA 4E7SA 4NXNT 4ERRA 1D0ZA 1UURA 4EV6A 2XQ9A 1E1HB 3NVOA 3OKQA 4KHZF 5FXVA 4YSZA 2N2NA 3LK2B 4HWHA 2K5BB 3U3IA 3E22E 2BG9E 3OJAA 4ZOLE 3SFDA 4DV7T 4KUMB 4H9RC 2V5DA 4ASKA 2LRKA 1DU2A 4O2AE 2XAFB 3RLFG 3C50A 2BKNA 3P4QA 2VKOA 3FBLA 3PJAA 2XY8B 2V7KA 2VVSA 5LHHB 1MNDA 3HKCE 2UUCT 1AJ3A 1CUNA 2ZM0A 2WBLA 4XTCM 2FUPA 2CRBA 5JDQA 3K8PC 3SRZA 5LMUT 2I6HA 3T1HT 5KMGP 4NXMT 4YTPA 1W9RA 3OYZA 4K0UA 3RH3A 3VU7H 3PU8A 3K3OA 2W00A 2X9WA 2JQHA 4JI3T 3VRAA 1FIOA 2XQ5A 5JREA 4U3CA 4DV6T 3KV6A 3RIAA 1IBKT 3AA6B 3RKGA 2CWOA 5JDHA 2FJBA 1Y64B 2ODUA 4BAYB 2KZ7B 2X9YA 2HPLA 2BS2A 2EHOA 4O4HE 3CQXC 4L9IA 1XDOA 4AKIA 4PJLA 2OV9A 4DV1T 4MFRA 3NZPA 5LGTB 5HXSA 3AB3B 4LF6T 3RQWA 2CHNA 3TKLB 3RRCA 3BQKA 2E5VA 4LF7T 3OBVE 4YFSA 2LOPA 1D1AA 3Q5XA 3UUBA 4X5TA 4GOUA 4O8SA 2H7OA 3QUJA 4AKHA 3UFGA 2JMKA 1IZNB 3BK9A 5LHGB 2BS4A 2NW9A 3FZFB 3N9NA 4TZ4C 5HEHA 3EDUA 5IYZE 2RPAA 5AQIB 2NP9A 4MLKA 5LB7B 1MIVA 2YK0A 4TV9E 4CI2B 3ZJ2A 3ZT6A 3VRBA 4JI6T 4WBOA 2JMHA 3HA4A 4EYYR 3RC3A 3ANWA 4TX5A 2NR4A 3AA1B 2JQQA 4I0UA 3PTRB 2CXLA 5AQNB 1YQ3A 2BDEA 4DV3T 2VKJA 3CWZB 3TLVA 4HFDA 1ZOYA 3AA0B 3FXDB 2X9HA 4FJOA 5AQTB 1OEDC 3ZCIA 2CBJA 2NWBA 2RP4A 2X0YA 4YTNA 2IDOB 5LA6E 4KI0G 4ISSA 3ZKRA 5HWYA 3E0ZA 1QSDA 3UFEA 3J7Yq 1XWMA 3NRYA 3OTOT 5ADXL 2BKPA 1UX5A 4PJNA 2Y8DA 4DMWA 3N9QA 1UUSA 2KNDA 4F6RC 3R6NA 2YN6A 2PG8A 2WSSV 5DQWA 2VKDA 3LBXB 3FXEB 1M62A 5EK3A 2ONKC 4YMTB 2W67A 4AQFA 2I0MA 2K3WA 1OEDB 2A72A 3FBZA 5AQHB 2XAJB 4A98A 4AKGA 3UULA 4GK5E 5LGUB 2E8IA 4UF0A 3MACA 2A3DA 3ZPOA 2LLYA 3PUQA 3ONJA 3CMLA 3FZLB 2ZLYA 1S94A 2FJEA 2LKHA 4ADZA 1L0VA 3NZQA 1WFDA 2QA7A 3OYXA 3N5LA 4AQYT 1IBMT 3CQCB 2PFVA 2VASA 2F4VT 4OX9T 2FJDA 3KBTA 2CA5A 5L2LA 4ILBA 4HFHA 5L47A 5AQUB 2EHOD 2LOSA 4H9OC 2LEHA 2X68A 2VURA 3RYIE 5AQJB 3ZMUB 3MJXA 2KXPB 2K48A 2UXNB 3P4SA 4ZI2D 4KX6A 2H89A 2XHEB 2KWHA 3AVSA 3CK6A 4TWDA 1HS7A 4HFEA 4GKKT 3KV5A 2ODVA 3RLFF 4IDNA 3ZSTA 3KVAA 3O1IA 4YJ3E 3PUGA 1SA0E 1KNZA 2EHOC 3ZYKA 4UV9B 3C98B 2ZMAA 4DVDA 5DQVA 2NW7A 2WCAA 2J1DG 2D2SA 5EK4A 4UELA 4ILUA 3P4RA 3CX7B 1MMNA 3M3ZB 3ZSSA 2WQYA 4UVCB 5FYMA 2WWVA 2V5CA 1IJ6A 4ZI3C 1YXRA 4QWNB 1W0BA 4ZEYA 3WAKA 4AI6A 3X1DA 5JRCB 1Y01A 5C2TA 3NKZA 3LJCA 3ZMVB 3P4PA 3IBPA 3AEDA 2MTQA 5M4YA 2XQ7A 4A56A 5L3DB 2EHOB 3N9LA 3OVUA 2KLQA 1UK5A 4H9PC 2IW5B 3AEFA 2M6BA 4QH5A 4GKJT 1SUMB 4EXTA 5E0OA 4DUZT 3ZMTB 2CBIA 2LSYA 3O9XA 3AEAA 2WMOA 3RC8A 1VOMA 2I59A 1XNRT 2Y6XA 3FZHB 1D0XA 3C4WA 2JPFA 3V5UA 3Q5WA 3UQ7A 1W09A 3LBXA 3ZMSB 3ZN1B 3ABVA 2KINB 3DTOA 5CB4E 5HEOA 2LHRA 5ABGA 4JLEA 5L3FB 3J9X1 4COFA 4ZI7E 4QX8B 1WRDA 4U72A 1OEDA 2E9XD 4P0AA 2D5UA 4YJ2E 2WDVA 2LJLA 5KDMC 2W4XA 4HN9A 2VVNA 3O1JA 1UCUA 4JI4T 3PUXG 1YD8G 4U7YA 1W0AA 5ABFB 2CWYA 3UQ4A 4ISTA 1WR0A 2XPKA 5AQOB 4ANJA 4JYAT 1MMGA 2BS3A 3ANWB 3IA3A 4HE8A 5LOVE 3I9YA 1HX1B 4PW8A 4UEMA 3RF1A 1D0YA 1N32T 3RPUA 3ZC0A 4AQFC 4XIGN 3LG7A 1JNRA 2E9XC 4JBWG 5AQRB 4KI0F 2JJ9A 4TQUM 2HHHT 3ZYMA 3E08A 3JCFA 4LF8T 2K24A 3UTKA 4DBQA 2XZEA 4XZCA 2W2UA 3AVRA 3PUZG 5KXJA 3SFEA 1FMVA 4EZHA 2B1EA 1UGOA 2BKOA 2MPKA 3F31A 5LG3A 4N78D 1T72A 3CX8B 4ZZBA 4LMKA 2H3RA 3FB2A 2QVAA 3N9PA 5HEGA 4EEBA 3WAJA 2A2FX 2IHR1 2KSRA 2L8KA 5BR8T 2E9XB 1NWMX 1X79A 1YKEB 5FY1A 4LFBT 2IIUA 3JC6D 3L39A 4JI7T 1VRBA 4I4TE 4IDQA 1WYBA 4UF0B 4U31A 5AQMB 4QXBB 2LM9A 3SOLA 1E7PA 2ES0A 3Q9DA 3AE5A 2ACXA 4GYSA 2ZM8A 1D1CA 2WP9A 5JRCA 3K1SA 2X0HA 1ZP0A 3A8YC 1XMOT 3N9OA 5H6RB 3EABA 4JI0T 2HN2A 4GIWA 3RIUC 2QYWA 2VKHA 4CQIA 4DBRA 1I6ZA 3AE4A 4P09A 2DNXA 3RYHE 3JC6C 2E5LT 4YMVC 4BJNA 1OWAA 3AEEA 2BBHA 3NBXX 2GK9A 3JAEA 3F2EA 3DP7A 3CQGB 3ETVA 2NOXA 5F5WA 4TWHA 3PUWG 2WZIA 4QXCB 4P1NA 3HKBE 5FXXA 2W62A 4HWDA 2DL1A 1UX4A 2W61A 4PFPA 2DWGA 2J62A 4IE4A 2V6XA 4CZZB 1KNPA 1HR0T 4KMCA 5HAXA 3QOFA 4G63A 4UIGA 2BG9C 2VB6A 2YU2A 2V1DB 2BVLA 4ZS2A 5L3EB 4HWCA 4AQGA 2LSJA 2CXFA 1VCTA 5ABFA 5JDMA 5HEJA 3ZEFB 4JEUB 4O2BE 4TUYE 5JDLA 2XQ8A 1HNZT 4PK5A 4DR4T 5ETWA 1BR1A 4U7IA 1XDPA 5CJ5A 4EZ4A 1H7CA 4H9QC 2PTFA 3KV9A 2LSIA 2NTYA 3MZKB 1FJGT 5JDFA 2BBJA 3UT5E 3O4XE 1J5WA 2XM2A 4CI1B 3PUSA 2BG9B 4EIWA 2KT9A 4AKLA 1EZ3A 2BZBA 5LHIB 2XQYA 5ABHA 4UXNB 4ILAA 4U2ZA 2JIWA 2VWAA 4DV0T 4FI5A 3PUVF 4X1YE 3LFMA 5EK2A 3ZT7A 4H63V 4YT0A 3L09A 1T8BA 5HCJA 2LRLA 2IC9A 2X0LB 2E2AA 4HFIA 4JI8T 4H9NC 2E9XA 4X1IE 5AQGB 3PUYF 1SHZC 3AE7A 4AIUA 3PUXF 2AE9A 3BQIA 2PBIA 4GYRA 4DR3T 1T98A 4YXDA 2XSAA 3KV4A 2XAHB 2KMFA 2QRXA 4MHCA 4HTEA 4QX7B 5DJQC 3ZC1A 5LMNT 3W15B 2N1GA 3IEEA 5FY0A 5LCYA 2X67A 2YDRA 3AE6A 3N2GE 4WW0A 4JBWF 4X62T 3LK42 4DO0A 2D9DA 2XSBA 5FMNA 3U78A 2K9AA 4JUYA 4EAHA 2G0UA 1U5PA 2KWIB 3CVRA 5KX5E 3SS1A 2A9UA 3PUZF 3GN5A 4Q25A 2D0UA 2WS3A 2M67A 2CCQA 4DIDB 1B7TA 1XNQT 3RX6A 3RKOA 2XJ7A 4I50E 1KK7A 3PJAJ 1FMWA 4LMLA 2MAWA 4PJMA 3UU6A 3HI2A 3QC9A 3RGLA 2YDSA 3RRWA 4UVAB 4LF5T 4CI3B 2CLYC 3GMIA 3C4XA 2NW8A 2RA1A 1NEKA 4O4LE 1T7SA 3RIUA 1HCIA 4WBNE 3AE9A 3A5XA 4ZI2C 3DJBA 1WYCA 2HN1A 4JV5T 2MBGA 3I9WA 4CXXA 3WI3A 3GWHA 1FEWA 3V5SA 2LM2A 5HEUA 3JADA 4YHJA 4JEHB 1HNXT 1VCSA 4H63H 4DR1T 4F8HA 4YMSC 1ZV4X 4YMUC 3P8CD 4OHFA 3TUIA 2MOZA 2CPTA 3N9MA 3Q2MA 4QHOA 4PK4A 2FBWA 2YINA 2CLYB 4PJJA 1US7B 5F8PA 4WYVA 3FZMB 4AISA 3ZYLA 2BG9A 3VKGA 1KEYA 2C5KT 4B3MT 2X66A 5DABA 4IDOA 5J1GA 4IGUA 3PUWF 2YDQA 4B3TT 4YMWC 4KP3C 3TLTA 1M7KA 3EDVA 4ZHQE 1Z8UA 1I94T 2QGSA 3PUVG 4M1PA 2UXBT 1J5ET 3H3MA 4H9SE 4QKNA 4O4IE 2HPJA 1NAFA 3AXJB 2AXDS 2C0SA 2LT3A 2V7LA 2ZM6T 2XM1A 4IL9A 5JVDE 3ESLA 2C5IT 3PUYG 5HXEA 1BR4A 5HWXA 2WU5A 3TLUA 1QUUA 2WU2A 3C4ZA 2WZHA 2ACZA 5JDNA 5LBQB 2BVMA 3I0QA 2YEVC 2DCFA 4Z90A 2XTLA 1MMAA 4IE5A 2VL0A 5L3CB 2J47A 2R6GG 5LP6E 3HKDE 1ZKEA 4ZZCA 4GK0E 2UU9T 3AEBA 3AECA 4PAGA 4EEDA 3AE1A 2DWKA 5AQLB 4CN1A 4XIGM 4TN7B 3HR0A 2UUAT 4DR6T 5HYAA 5F3JA 5EZYE 2W66A 2X51A 1WR6A 2WDQA 4MBQA 4K0KT 4NPPA 3MKDA 4EYUA 2W0GA 1KF6A 1IAPA 3PURA 5JTGA 2IC6A 2CEAA 4ZS3A 2FJAA 4DV5T 4YY3T 4LFAT 4L5GA 4XTCN 2L9QA 3ZN0B 5JQGE 3B5MA 4JI1T 1OEDE 4WZXA 4CN4A 2HH7A 2Y48B 1WLXA 2JQ9A 5LJMA 5AQFB 5LXTE 4LFCT 1ZHCA 3DHWA 5AQPB 2IAKA 2XQAA 4HGAA 5FP3A 4HKAA 4A5XA 3JAFA 3VKHA 3IHRA 4B3RT 3EVYA 3IF8B 3QB5A 3VR9A 2P9BA 5FY7A 4X20E 2VQET 3QB5K 3GN5B 4HEAA 2XASB 4DR2T 3EAMA 5JR9A 4MALA 2VQFT 2M6IA 4TWFA 4IT4A 2CE7A 5FXZA 5CA0E 2XUEA 4J2CA 2ZM2A 4NIQA 4ZXLA 3RQUA 5L3BB 4NUUA 3ZCJA 3K3QC 3N2KE 1LVFA 3AXJA 2DI4A 2Q9QA 3KDSE 4TNVA 3EHZA 5IHYA 3ONLC 4YLHA 1XMQT 3N2OA 4C91A 2XQ4A 4NUVA 1HG2A 2OLTA 1E2AA 2V6YB 3CPZA
chains in the Genus database with same CATH topology
4KHZG 3D31C 3DHWA 4YMWC 4JBWG 3PUXF 2R6GF 3PV0G 4KI0F 4YMSC 3PUZF 4TQUM 3PUVG 3PUWG 2ONKC 3PUYG 4YMUC 3RLFG 4YMTB 4XTCM 4KHZF 3TUJA 4XIGM 4JBWF 3PUXG 2R6GG 3PV0F 3TUZA 3TUIA 4KI0G 4TQUN 3PUVF 3PUZG 3PUYF 4YMVC 4XTCN 3PUWF 3RLFF 4XIGN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ G;  3D31 C;  3DHW A;  4YMW C;  4JBW G;  3PUX F;  2R6G F;  3PV0 G;  4KI0 F;  4YMS C;  3PUZ F;  4TQU M;  3PUV G;  3PUW G;  2ONK C;  3PUY G;  4YMU C;  3RLF G;  4YMT B;  4XTC M;  4KHZ F;  3TUJ A;  4XIG M;  4JBW F;  3PUX G;  2R6G G;  3PV0 F;  3TUZ A;  3TUI A;  4KI0 G;  4TQU N;  3PUV F;  3PUZ G;  3PUY F;  4YMV C;  4XTC N;  3PUW F;  3RLF F;  4XIG N; 
#chains in the Genus database with same CATH topology
 4LMJ A;  1BR2 A;  4P0B A;  4AKR B;  2LHN A;  4G2A A;  3TLS A;  3TLW A;  4X1K E;  4X66 T;  3PV0 G;  4A97 A;  4C90 A;  2H7V C;  5H6Q B;  2Z6E A;  3HL6 A;  3KFW X;  5AFU L;  1IBL T;  5CFB A;  4OK0 A;  5J0Z A;  2MYS A;  1YKH B;  1IJ5 A;  5L3G B;  3K3N A;  1X9B A;  3P50 A;  3D0T A;  3I0O A;  3FHN A;  5GON E;  3NWI A;  5TAO A;  1KFY A;  5FL1 A;  1HX8 A;  2V8S V;  4I43 B;  3ZT5 A;  1SE7 A;  4ILC A;  1ZEE A;  3TUJ A;  3LSV A;  4XAX B;  3H3A A;  3UU5 A;  2CM0 A;  1LVK A;  3AE3 A;  5LNK A;  4B6X A;  4OFZ A;  4U2Y A;  3PE0 A;  3LK3 B;  3AA7 B;  4IIJ E;  2V7I A;  2WMN A;  4IRE A;  3RI5 A;  3RHW A;  3CIR A;  5JDG A;  2B76 A;  4IHJ E;  3FZK B;  1NEN A;  5LBM A;  3UU8 A;  4U33 A;  4KHZ G;  3Q5E A;  4IL4 A;  4DV2 T;  5L4H A;  5J2U E;  3CX6 B;  4IE0 A;  1R8I A;  3ZMZ B;  4TNW A;  2V7J A;  1S35 A;  3O1H A;  5BMV E;  1O3X A;  4OYK A;  3R84 B;  4YSY A;  1HG5 A;  3G06 A;  4L0R A;  2UXD T;  4CXW A;  3L3P A;  3RYF E;  2IUB A;  2LE8 A;  3UU3 A;  4PFO A;  2XQ3 A;  3MK7 C;  3UUM A;  5L4E A;  4I55 E;  3C51 A;  5J2T E;  4YSX A;  3ZJ1 A;  2V26 A;  3Q5D A;  3PU3 A;  3ETU A;  4AXP A;  3ZLI A;  4QXH B;  2CXD A;  2XAG B;  3GA8 A;  2V7M A;  1G73 A;  4JI2 T;  4XBF B;  4X65 T;  2R6G F;  3CKD A;  4UR9 A;  2WM9 A;  4KBM B;  1HNW T;  3BQL A;  4YTM A;  2JQK A;  5LG4 A;  4QH1 A;  2IML A;  1N33 T;  1GQE A;  4IE6 A;  5LJN A;  4PK6 A;  5JH7 E;  1MIY A;  1XZY A;  2LKG A;  3SWH A;  5FKY A;  3EI0 A;  4DUY T;  5HCM A;  4Z8X A;  4CN6 A;  4KHP T;  3UU4 A;  1HFA A;  3F57 A;  5AQV B;  4E7Z A;  3L8R A;  5FL0 A;  4DND A;  1MNE A;  2WWU A;  3AAA B;  2DLR A;  4HFC A;  2DHR A;  5C8Y E;  3A7M A;  2PJQ A;  5CGM A;  4BA9 A;  3RIF A;  5IWA T;  3LDQ B;  3B57 A;  2Q9Q D;  3B13 A;  4LF9 T;  4EGW A;  3P4W A;  2N9D A;  4ZI3 D;  1G8X A;  1MIW A;  4JI5 T;  1D1B A;  1YQ4 A;  2CHO A;  2V6Y A;  4LF4 T;  3AEG A;  3QK6 A;  4IDP A;  2YU1 A;  2H88 A;  3ONX A;  4HWF A;  4U74 A;  3RYC E;  1OXZ A;  5JR9 C;  3MA9 A;  5FNV E;  3QNU A;  2X9X A;  4DR7 T;  1V9D A;  2LSG A;  2C5J A;  3EUH A;  2D0T A;  2Q9Q C;  3TUZ A;  3H37 A;  1YW0 A;  4HWI B;  3OPC A;  1LKX A;  5C3J A;  2YKS A;  5AQQ B;  3UUX B;  5LGN B;  2SPC A;  5LYJ E;  1N34 T;  4DV4 T;  4Z91 A;  5A1L A;  5FVK A;  4BJM A;  2YOE A;  1JNZ A;  3NRX A;  1CHU A;  2J4G A;  2NTX A;  2W63 A;  4O4J E;  2XAQ B;  3KBU A;  2WDR A;  5ABE A;  1N36 T;  4QH4 A;  4V1A v;  2UXX B;  3KIN B;  4B3S T;  1HF8 A;  5JR9 B;  3T8O A;  1WCR A;  3M65 A;  3UUN A;  5FXW A;  3MXZ A;  5IUX A;  1MMD A;  2UUB T;  2Q9Q B;  4IE7 A;  5AQK B;  1Z0P A;  3C64 A;  3AE8 A;  2WY2 A;  3PUA A;  4TV8 E;  1LRZ A;  4DR5 T;  4WNK A;  3PV0 F;  2XQ6 A;  5HXC A;  3D31 C;  2L3L A;  5CA1 E;  4EB6 E;  4HFV A;  2WB5 A;  2LSK A;  3AE2 A;  3I1A A;  2JRK A;  2VK9 A;  4CXY A;  2WAU A;  1HTJ F;  4UVB B;  4PNI A;  3AAE B;  3KVB A;  5HXR A;  4EOZ B;  4X64 T;  1KNR A;  3P7I A;  4YHH T;  5FVL A;  3T1Y T;  4OYJ A;  3VHL A;  5HXH A;  3VR8 A;  4UV8 B;  2UXC T;  2OA5 A;  4IDZ A;  3HKE E;  1J1J A;  5AQS B;  4DMV A;  2VL8 A;  2CMR A;  4HFB A;  3PDY A;  4TQU N;  1BR0 A;  1QLB A;  1U4Q A;  3S4U A;  3AAI A;  4E7S A;  4NXN T;  4ERR A;  1D0Z A;  1UUR A;  4EV6 A;  2XQ9 A;  1E1H B;  3NVO A;  3OKQ A;  4KHZ F;  5FXV A;  4YSZ A;  2N2N A;  3LK2 B;  4HWH A;  2K5B B;  3U3I A;  3E22 E;  2BG9 E;  3OJA A;  4ZOL E;  3SFD A;  4DV7 T;  4KUM B;  4H9R C;  2V5D A;  4ASK A;  2LRK A;  1DU2 A;  4O2A E;  2XAF B;  3RLF G;  3C50 A;  2BKN A;  3P4Q A;  2VKO A;  3FBL A;  3PJA A;  2XY8 B;  2V7K A;  2VVS A;  5LHH B;  1MND A;  3HKC E;  2UUC T;  1AJ3 A;  1CUN A;  2ZM0 A;  2WBL A;  4XTC M;  2FUP A;  2CRB A;  5JDQ A;  3K8P C;  3SRZ A;  5LMU T;  2I6H A;  3T1H T;  5KMG P;  4NXM T;  4YTP A;  1W9R A;  3OYZ A;  4K0U A;  3RH3 A;  3VU7 H;  3PU8 A;  3K3O A;  2W00 A;  2X9W A;  2JQH A;  4JI3 T;  3VRA A;  1FIO A;  2XQ5 A;  5JRE A;  4U3C A;  4DV6 T;  3KV6 A;  3RIA A;  1IBK T;  3AA6 B;  3RKG A;  2CWO A;  5JDH A;  2FJB A;  1Y64 B;  2ODU A;  4BAY B;  2KZ7 B;  2X9Y A;  2HPL A;  2BS2 A;  2EHO A;  4O4H E;  3CQX C;  4L9I A;  1XDO A;  4AKI A;  4PJL A;  2OV9 A;  4DV1 T;  4MFR A;  3NZP A;  5LGT B;  5HXS A;  3AB3 B;  4LF6 T;  3RQW A;  2CHN A;  3TKL B;  3RRC A;  3BQK A;  2E5V A;  4LF7 T;  3OBV E;  4YFS A;  2LOP A;  1D1A A;  3Q5X A;  3UUB A;  4X5T A;  4GOU A;  4O8S A;  2H7O A;  3QUJ A;  4AKH A;  3UFG A;  2JMK A;  1IZN B;  3BK9 A;  5LHG B;  2BS4 A;  2NW9 A;  3FZF B;  3N9N A;  4TZ4 C;  5HEH A;  3EDU A;  5IYZ E;  2RPA A;  5AQI B;  2NP9 A;  4MLK A;  5LB7 B;  1MIV A;  2YK0 A;  4TV9 E;  4CI2 B;  3ZJ2 A;  3ZT6 A;  3VRB A;  4JI6 T;  4WBO A;  2JMH A;  3HA4 A;  4EYY R;  3RC3 A;  3ANW A;  4TX5 A;  2NR4 A;  3AA1 B;  2JQQ A;  4I0U A;  3PTR B;  2CXL A;  5AQN B;  1YQ3 A;  2BDE A;  4DV3 T;  2VKJ A;  3CWZ B;  3TLV A;  4HFD A;  1ZOY A;  3AA0 B;  3FXD B;  2X9H A;  4FJO A;  5AQT B;  1OED C;  3ZCI A;  2CBJ A;  2NWB A;  2RP4 A;  2X0Y A;  4YTN A;  2IDO B;  5LA6 E;  4KI0 G;  4ISS A;  3ZKR A;  5HWY A;  3E0Z A;  1QSD A;  3UFE A;  3J7Y q;  1XWM A;  3NRY A;  3OTO T;  5ADX L;  2BKP A;  1UX5 A;  4PJN A;  2Y8D A;  4DMW A;  3N9Q A;  1UUS A;  2KND A;  4F6R C;  3R6N A;  2YN6 A;  2PG8 A;  2WSS V;  5DQW A;  2VKD A;  3LBX B;  3FXE B;  1M62 A;  5EK3 A;  2ONK C;  4YMT B;  2W67 A;  4AQF A;  2I0M A;  2K3W A;  1OED B;  2A72 A;  3FBZ A;  5AQH B;  2XAJ B;  4A98 A;  4AKG A;  3UUL A;  4GK5 E;  5LGU B;  2E8I A;  4UF0 A;  3MAC A;  2A3D A;  3ZPO A;  2LLY A;  3PUQ A;  3ONJ A;  3CML A;  3FZL B;  2ZLY A;  1S94 A;  2FJE A;  2LKH A;  4ADZ A;  1L0V A;  3NZQ A;  1WFD A;  2QA7 A;  3OYX A;  3N5L A;  4AQY T;  1IBM T;  3CQC B;  2PFV A;  2VAS A;  2F4V T;  4OX9 T;  2FJD A;  3KBT A;  2CA5 A;  5L2L A;  4ILB A;  4HFH A;  5L47 A;  5AQU B;  2EHO D;  2LOS A;  4H9O C;  2LEH A;  2X68 A;  2VUR A;  3RYI E;  5AQJ B;  3ZMU B;  3MJX A;  2KXP B;  2K48 A;  2UXN B;  3P4S A;  4ZI2 D;  4KX6 A;  2H89 A;  2XHE B;  2KWH A;  3AVS A;  3CK6 A;  4TWD A;  1HS7 A;  4HFE A;  4GKK T;  3KV5 A;  2ODV A;  3RLF F;  4IDN A;  3ZST A;  3KVA A;  3O1I A;  4YJ3 E;  3PUG A;  1SA0 E;  1KNZ A;  2EHO C;  3ZYK A;  4UV9 B;  3C98 B;  2ZMA A;  4DVD A;  5DQV A;  2NW7 A;  2WCA A;  2J1D G;  2D2S A;  5EK4 A;  4UEL A;  4ILU A;  3P4R A;  3CX7 B;  1MMN A;  3M3Z B;  3ZSS A;  2WQY A;  4UVC B;  5FYM A;  2WWV A;  2V5C A;  1IJ6 A;  4ZI3 C;  1YXR A;  4QWN B;  1W0B A;  4ZEY A;  3WAK A;  4AI6 A;  3X1D A;  5JRC B;  1Y01 A;  5C2T A;  3NKZ A;  3LJC A;  3ZMV B;  3P4P A;  3IBP A;  3AED A;  2MTQ A;  5M4Y A;  2XQ7 A;  4A56 A;  5L3D B;  2EHO B;  3N9L A;  3OVU A;  2KLQ A;  1UK5 A;  4H9P C;  2IW5 B;  3AEF A;  2M6B A;  4QH5 A;  4GKJ T;  1SUM B;  4EXT A;  5E0O A;  4DUZ T;  3ZMT B;  2CBI A;  2LSY A;  3O9X A;  3AEA A;  2WMO A;  3RC8 A;  1VOM A;  2I59 A;  1XNR T;  2Y6X A;  3FZH B;  1D0X A;  3C4W A;  2JPF A;  3V5U A;  3Q5W A;  3UQ7 A;  1W09 A;  3LBX A;  3ZMS B;  3ZN1 B;  3ABV A;  2KIN B;  3DTO A;  5CB4 E;  5HEO A;  2LHR A;  5ABG A;  4JLE A;  5L3F B;  3J9X 1;  4COF A;  4ZI7 E;  4QX8 B;  1WRD A;  4U72 A;  1OED A;  2E9X D;  4P0A A;  2D5U A;  4YJ2 E;  2WDV A;  2LJL A;  5KDM C;  2W4X A;  4HN9 A;  2VVN A;  3O1J A;  1UCU A;  4JI4 T;  3PUX G;  1YD8 G;  4U7Y A;  1W0A A;  5ABF B;  2CWY A;  3UQ4 A;  4IST A;  1WR0 A;  2XPK A;  5AQO B;  4ANJ A;  4JYA T;  1MMG A;  2BS3 A;  3ANW B;  3IA3 A;  4HE8 A;  5LOV E;  3I9Y A;  1HX1 B;  4PW8 A;  4UEM A;  3RF1 A;  1D0Y A;  1N32 T;  3RPU A;  3ZC0 A;  4AQF C;  4XIG N;  3LG7 A;  1JNR A;  2E9X C;  4JBW G;  5AQR B;  4KI0 F;  2JJ9 A;  4TQU M;  2HHH T;  3ZYM A;  3E08 A;  3JCF A;  4LF8 T;  2K24 A;  3UTK A;  4DBQ A;  2XZE A;  4XZC A;  2W2U A;  3AVR A;  3PUZ G;  5KXJ A;  3SFE A;  1FMV A;  4EZH A;  2B1E A;  1UGO A;  2BKO A;  2MPK A;  3F31 A;  5LG3 A;  4N78 D;  1T72 A;  3CX8 B;  4ZZB A;  4LMK A;  2H3R A;  3FB2 A;  2QVA A;  3N9P A;  5HEG A;  4EEB A;  3WAJ A;  2A2F X;  2IHR 1;  2KSR A;  2L8K A;  5BR8 T;  2E9X B;  1NWM X;  1X79 A;  1YKE B;  5FY1 A;  4LFB T;  2IIU A;  3JC6 D;  3L39 A;  4JI7 T;  1VRB A;  4I4T E;  4IDQ A;  1WYB A;  4UF0 B;  4U31 A;  5AQM B;  4QXB B;  2LM9 A;  3SOL A;  1E7P A;  2ES0 A;  3Q9D A;  3AE5 A;  2ACX A;  4GYS A;  2ZM8 A;  1D1C A;  2WP9 A;  5JRC A;  3K1S A;  2X0H A;  1ZP0 A;  3A8Y C;  1XMO T;  3N9O A;  5H6R B;  3EAB A;  4JI0 T;  2HN2 A;  4GIW A;  3RIU C;  2QYW A;  2VKH A;  4CQI A;  4DBR A;  1I6Z A;  3AE4 A;  4P09 A;  2DNX A;  3RYH E;  3JC6 C;  2E5L T;  4YMV C;  4BJN A;  1OWA A;  3AEE A;  2BBH A;  3NBX X;  2GK9 A;  3JAE A;  3F2E A;  3DP7 A;  3CQG B;  3ETV A;  2NOX A;  5F5W A;  4TWH A;  3PUW G;  2WZI A;  4QXC B;  4P1N A;  3HKB E;  5FXX A;  2W62 A;  4HWD A;  2DL1 A;  1UX4 A;  2W61 A;  4PFP A;  2DWG A;  2J62 A;  4IE4 A;  2V6X A;  4CZZ B;  1KNP A;  1HR0 T;  4KMC A;  5HAX A;  3QOF A;  4G63 A;  4UIG A;  2BG9 C;  2VB6 A;  2YU2 A;  2V1D B;  2BVL A;  4ZS2 A;  5L3E B;  4HWC A;  4AQG A;  2LSJ A;  2CXF A;  1VCT A;  5ABF A;  5JDM A;  5HEJ A;  3ZEF B;  4JEU B;  4O2B E;  4TUY E;  5JDL A;  2XQ8 A;  1HNZ T;  4PK5 A;  4DR4 T;  5ETW A;  1BR1 A;  4U7I A;  1XDP A;  5CJ5 A;  4EZ4 A;  1H7C A;  4H9Q C;  2PTF A;  3KV9 A;  2LSI A;  2NTY A;  3MZK B;  1FJG T;  5JDF A;  2BBJ A;  3UT5 E;  3O4X E;  1J5W A;  2XM2 A;  4CI1 B;  3PUS A;  2BG9 B;  4EIW A;  2KT9 A;  4AKL A;  1EZ3 A;  2BZB A;  5LHI B;  2XQY A;  5ABH A;  4UXN B;  4ILA A;  4U2Z A;  2JIW A;  2VWA A;  4DV0 T;  4FI5 A;  3PUV F;  4X1Y E;  3LFM A;  5EK2 A;  3ZT7 A;  4H63 V;  4YT0 A;  3L09 A;  1T8B A;  5HCJ A;  2LRL A;  2IC9 A;  2X0L B;  2E2A A;  4HFI A;  4JI8 T;  4H9N C;  2E9X A;  4X1I E;  5AQG B;  3PUY F;  1SHZ C;  3AE7 A;  4AIU A;  3PUX F;  2AE9 A;  3BQI A;  2PBI A;  4GYR A;  4DR3 T;  1T98 A;  4YXD A;  2XSA A;  3KV4 A;  2XAH B;  2KMF A;  2QRX A;  4MHC A;  4HTE A;  4QX7 B;  5DJQ C;  3ZC1 A;  5LMN T;  3W15 B;  2N1G A;  3IEE A;  5FY0 A;  5LCY A;  2X67 A;  2YDR A;  3AE6 A;  3N2G E;  4WW0 A;  4JBW F;  4X62 T;  3LK4 2;  4DO0 A;  2D9D A;  2XSB A;  5FMN A;  3U78 A;  2K9A A;  4JUY A;  4EAH A;  2G0U A;  1U5P A;  2KWI B;  3CVR A;  5KX5 E;  3SS1 A;  2A9U A;  3PUZ F;  3GN5 A;  4Q25 A;  2D0U A;  2WS3 A;  2M67 A;  2CCQ A;  4DID B;  1B7T A;  1XNQ T;  3RX6 A;  3RKO A;  2XJ7 A;  4I50 E;  1KK7 A;  3PJA J;  1FMW A;  4LML A;  2MAW A;  4PJM A;  3UU6 A;  3HI2 A;  3QC9 A;  3RGL A;  2YDS A;  3RRW A;  4UVA B;  4LF5 T;  4CI3 B;  2CLY C;  3GMI A;  3C4X A;  2NW8 A;  2RA1 A;  1NEK A;  4O4L E;  1T7S A;  3RIU A;  1HCI A;  4WBN E;  3AE9 A;  3A5X A;  4ZI2 C;  3DJB A;  1WYC A;  2HN1 A;  4JV5 T;  2MBG A;  3I9W A;  4CXX A;  3WI3 A;  3GWH A;  1FEW A;  3V5S A;  2LM2 A;  5HEU A;  3JAD A;  4YHJ A;  4JEH B;  1HNX T;  1VCS A;  4H63 H;  4DR1 T;  4F8H A;  4YMS C;  1ZV4 X;  4YMU C;  3P8C D;  4OHF A;  3TUI A;  2MOZ A;  2CPT A;  3N9M A;  3Q2M A;  4QHO A;  4PK4 A;  2FBW A;  2YIN A;  2CLY B;  4PJJ A;  1US7 B;  5F8P A;  4WYV A;  3FZM B;  4AIS A;  3ZYL A;  2BG9 A;  3VKG A;  1KEY A;  2C5K T;  4B3M T;  2X66 A;  5DAB A;  4IDO A;  5J1G A;  4IGU A;  3PUW F;  2YDQ A;  4B3T T;  4YMW C;  4KP3 C;  3TLT A;  1M7K A;  3EDV A;  4ZHQ E;  1Z8U A;  1I94 T;  2QGS A;  3PUV G;  4M1P A;  2UXB T;  1J5E T;  3H3M A;  4H9S E;  4QKN A;  4O4I E;  2HPJ A;  1NAF A;  3AXJ B;  2AXD S;  2C0S A;  2LT3 A;  2V7L A;  2ZM6 T;  2XM1 A;  4IL9 A;  5JVD E;  3ESL A;  2C5I T;  3PUY G;  5HXE A;  1BR4 A;  5HWX A;  2WU5 A;  3TLU A;  1QUU A;  2WU2 A;  3C4Z A;  2WZH A;  2ACZ A;  5JDN A;  5LBQ B;  2BVM A;  3I0Q A;  2YEV C;  2DCF A;  4Z90 A;  2XTL A;  1MMA A;  4IE5 A;  2VL0 A;  5L3C B;  2J47 A;  2R6G G;  5LP6 E;  3HKD E;  1ZKE A;  4ZZC A;  4GK0 E;  2UU9 T;  3AEB A;  3AEC A;  4PAG A;  4EED A;  3AE1 A;  2DWK A;  5AQL B;  4CN1 A;  4XIG M;  4TN7 B;  3HR0 A;  2UUA T;  4DR6 T;  5HYA A;  5F3J A;  5EZY E;  2W66 A;  2X51 A;  1WR6 A;  2WDQ A;  4MBQ A;  4K0K T;  4NPP A;  3MKD A;  4EYU A;  2W0G A;  1KF6 A;  1IAP A;  3PUR A;  5JTG A;  2IC6 A;  2CEA A;  4ZS3 A;  2FJA A;  4DV5 T;  4YY3 T;  4LFA T;  4L5G A;  4XTC N;  2L9Q A;  3ZN0 B;  5JQG E;  3B5M A;  4JI1 T;  1OED E;  4WZX A;  4CN4 A;  2HH7 A;  2Y48 B;  1WLX A;  2JQ9 A;  5LJM A;  5AQF B;  5LXT E;  4LFC T;  1ZHC A;  3DHW A;  5AQP B;  2IAK A;  2XQA A;  4HGA A;  5FP3 A;  4HKA A;  4A5X A;  3JAF A;  3VKH A;  3IHR A;  4B3R T;  3EVY A;  3IF8 B;  3QB5 A;  3VR9 A;  2P9B A;  5FY7 A;  4X20 E;  2VQE T;  3QB5 K;  3GN5 B;  4HEA A;  2XAS B;  4DR2 T;  3EAM A;  5JR9 A;  4MAL A;  2VQF T;  2M6I A;  4TWF A;  4IT4 A;  2CE7 A;  5FXZ A;  5CA0 E;  2XUE A;  4J2C A;  2ZM2 A;  4NIQ A;  4ZXL A;  3RQU A;  5L3B B;  4NUU A;  3ZCJ A;  3K3Q C;  3N2K E;  1LVF A;  3AXJ A;  2DI4 A;  2Q9Q A;  3KDS E;  4TNV A;  3EHZ A;  5IHY A;  3ONL C;  4YLH A;  1XMQ T;  3N2O A;  4C91 A;  2XQ4 A;  4NUV A;  1HG2 A;  2OLT A;  1E2A A;  2V6Y B;  3CPZ A; 
#chains in the Genus database with same CATH homology
 4KHZ G;  3D31 C;  3DHW A;  4YMW C;  4JBW G;  3PUX F;  2R6G F;  3PV0 G;  4KI0 F;  4YMS C;  3PUZ F;  4TQU M;  3PUV G;  3PUW G;  2ONK C;  3PUY G;  4YMU C;  3RLF G;  4YMT B;  4XTC M;  4KHZ F;  3TUJ A;  4XIG M;  4JBW F;  3PUX G;  2R6G G;  3PV0 F;  3TUZ A;  3TUI A;  4KI0 G;  4TQU N;  3PUV F;  3PUZ G;  3PUY F;  4YMV C;  4XTC N;  3PUW F;  3RLF F;  4XIG N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...