3RLFF

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
490
Chain Sequence
b'WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 147
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3rlfF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3rlfF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3rlfF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3rlfF02
4YMUC 4TQUN 3DHWA 4KI0F 3RLFG 4XTCN 3PV0F 3PUYF 3PUVF 3PUZF 4KHZF 2R6GF 4JBWG 3PUWG 3PUXF 4XIGN 4YMSC 4TQUM 4XIGM 4YMTB 4KI0G 3PV0G 4YMWC 3TUIA 4XTCM 3PUZG 3PUYG 3PUVG 3RLFF 3TUZA 3TUJA 4KHZG 2R6GG 3D31C 3PUXG 2ONKC 4JBWF 3PUWF 4YMVC
chains in the Genus database with same CATH superfamily
4ZS3A 1HCIA 5JR9A 2P9BA 2XJ7A 4IDNA 2I59A 4AISA 4WYVA 5JDQA 1QSDA 1IJ6A 4IGUA 1WFDA 5L47A 4IREA 2UXNB 2WU5A 2PBIA 3QNUA 3UTKA 3TLTA 5IHYA 5J1GA 4JI8T 3N9MA 3IA3A 4HFHA 4MALA 4PJNA 3B57A 2V5CA 4TWDA 4JV5T 1E1HB 5A1LA 2BG9A 1LVFA 3ABVA 1KEYA 4K0UA 2VVSA 5CGMA 2X68A 3KINB 4UVBB 5IYZE 1SHZC 1BR0A 2LSJA 3N2OA 2MOZA 2LHNA 4QH1A 2K24A 2DWKA 2AXDS 4B3RT 1ZKEA 2MYSA 3RYHE 1LKXA 2G0UA 3TUZA 5FVKA 4HFCA 3M65A 5KDMC 1FMWA 4KMCA 4NXNT 5LBMA 2XAQB 3RLFG 5LMUT 4ZI3C 5L3BB 3EUHA 3BQKA 4O2AE 2V7LA 5JH7E 3K3NA 3FZMB 5FY1A 5LJMA 4DUZT 2DI4A 4AIUA 3CPZA 2KXPB 3PU3A 4YXDA 1HF8A 5LJNA 4A97A 4CI3B 2BDEA 1BR2A 3A5XA 2ONKC 5KX5E 5AQRB 2WBLA 3O9XA 2UU9T 2LHRA 4AXPA 1ZOYA 4EOZB 1T7SA 2XQAA 5LG3A 3P7IA 2ZM8A 4CZZB 5LGTB 2HN1A 4H63V 4UIGA 3AB3B 2MTQA 2C0SA 3P4PA 4GKKT 5AQHB 3L39A 3PUQA 4TX5A 3EAMA 1OEDC 3QUJA 2CM0A 3AA6B 2A9UA 2W67A 3HKEE 1KNZA 1YXRA 4JLEA 4UEMA 3FZKB 3M3ZB 2XQ4A 4XBFB 3IF8B 2K5BB 4ADZA 2KINB 4JI2T 4PJMA 2NOXA 3AVRA 3CK6A 3RYCE 1SE7A 1BR4A 2LRLA 3Q5XA 4LFCT 4Q25A 2V8SV 3O1IA 5AQOB 1N36T 4I0UA 2V7KA 2KLQA 1HTJF 3DJBA 4ZZBA 3NVOA 4ISTA 3AAEB 3ETVA 2WU2A 1L0VA 3A7MA 3N9LA 1B7TA 3AXJA 4LMJA 3LK2B 5HAXA 4G2AA 5DABA 1WLXA 1WYBA 1CUNA 2V1DB 2ACZA 4B3ST 2WWVA 4PFPA 2Y8DA 4AQFC 4TZ4C 4ZEYA 4F6RC 4EZHA 3LFMA 4DR5T 3T1YT 3UT5E 3H37A 2LT3A 3Q5EA 1N32T 5CFBA 1IAPA 4YHJA 3ZT6A 3H3MA 3LK3B 4HFIA 3LK42 3RYIE 2V6YB 2H3RA 3O1HA 3KVAA 1GQEA 2Y6XA 3EDUA 4TQUN 4I43B 2VKHA 3RIFA 4C91A 1O3XA 3JAFA 4DVDA 3ONLC 4H9QC 1G73A 4NIQA 3KV4A 1WCRA 4BAYB 2JQ9A 1VOMA 5FMNA 2M6BA 4QHOA 4DR3T 2XTLA 2EHOB 3F57A 2KWIB 2RPAA 5F3JA 1UK5A 2BKOA 2DNXA 4X1IE 2HPJA 2WP9A 4LF6T 3Q5DA 1NENA 2CXFA 1KNRA 2JIWA 4GIWA 4B3MT 3PUZF 4U33A 4UF0B 3VRAA 2YINA 4X20E 4QX8B 4EEDA 2BS4A 5EZYE 4LFAT 3F2EA 2ZM2A 5AQSB 5AQQB 3AE1A 2CMRA 5ABHA 2JQKA 3PV0F 2XQ3A 2LSYA 3OBVE 5J2UE 3RRCA 2IMLA 2BZBA 3LJCA 3P50A 2YU2A 4NXMT 1LVKA 4ZI7E 3NZQA 3N2GE 4QH5A 2VWAA 2CA5A 2B1EA 2W62A 3ZPOA 2WDQA 4YFSA 4U31A 4P0BA 1MNDA 3GN5B 5FXWA 3UQ4A 1YW0A 1W9RA 4YJ2E 4JI3T 4TNWA 4MHCA 3PJAJ 4HWDA 2UXDT 2ODUA 4ZI2D 4IE0A 3LG7A 4DBRA 1N34T 3W15B 2E5LT 4U2ZA 2WAUA 4V1Av 3PE0A 3ETUA 2NW7A 1XDOA 4HE8A 2IAKA 3ZN1B 4ZI2C 5F8PA 2JMKA 3KV5A 3PURA 2NW9A 5JTGA 4XTCN 1M7KA 4N78D 2Q9QD 2X9YA 2E5VA 3ONJA 1VCSA 5GONE 4QX7B 4PJLA 3PUZG 2PFVA 5JDHA 2XM1A 3UU3A 4ILUA 5LB7B 4IE7A 4IDOA 2BKNA 2Q9QC 3L09A 5HCMA 5DJQC 4OK0A 2CHNA 3ZC0A 1WRDA 5LP6E 1KNPA 4HWCA 5HXRA 3PV0G 4TNVA 1YKEB 3A8YC 3ANWA 1W09A 2BS2A 2K48A 2L9QA 4JEUB 4JI5T 3ZYLA 1JNRA 2XAGB 3PUXF 4CN6A 4KHPT 2XAFB 5L3CB 5FYMA 2LOPA 2BG9C 4E7ZA 3BQLA 2E9XB 5FXVA 2YDSA 4LF5T 1D0YA 3R84B 2B76A 1T98A 2WQYA 4AQGA 2NWBA 1AJ3A 3C98B 2IDOB 4YMTB 2J4GA 1MMNA 4UV8B 4X62T 2KNDA 2KMFA 3UFGA 2LSIA 1E2AA 2VQET 5AQGB 4E7SA 3D0TA 3HR0A 3O1JA 2J1DG 4HFBA 4COFA 3AE4A 2IC6A 3NRXA 2VKDA 4DR2T 3SOLA 5C2TA 4LF9T 4EEBA 3QK6A 4QXBB 4AKIA 3J7Yq 5H6RB 3I0OA 2BS3A 2YN6A 4PNIA 4KP3C 4PFOA 3K3QC 2XY8B 3RRWA 4WW0A 3R6NA 4OFZA 3CX7B 2LSGA 2NP9A 4YSXA 4LF4T 5EK4A 2H88A 1ZV4X 5AQJB 3VR9A 3PJAA 4IDQA 2CE7A 3AEGA 4DUYT 4GKJT 2LLYA 3AECA 2UXXB 1HNXT 2QGSA 2SPCA 1NEKA 2OV9A 4DV2T 3ZKRA 3AE5A 3PDYA 5AQTB 4YTNA 4X5TA 3LSVA 3RKOA 5LOVE 3PUXG 2HH7A 4P1NA 1FEWA 2YOEA 4KI0F 1FIOA 3NBXX 5AQIB 3UFEA 4NPPA 2I0MA 3E0ZA 3OVUA 3V5SA 3I1AA 2DWGA 3KBTA 3CX8B 2L3LA 3CQXC 5AFUL 5LNKA 4CXYA 3RPUA 1KK7A 2W66A 5FY7A 3SWHA 3F31A 3HKCE 3ZMVB 3K8PC 4A5XA 2C5IT 3N9OA 3RH3A 2UUAT 4K0KT 2KWHA 5J0ZA 2BBHA 4U7YA 3UULA 3NKZA 2XQYA 3JAEA 5AQMB 3SFDA 4QH4A 3P4QA 4LF7T 3ONXA 1HG2A 4KUMB 3AA7B 4U3CA 1NAFA 2WM9A 4CN4A 4ZXLA 3RF1A 4DV6T 4EYUA 4YSYA 4CQIA 5EK2A 4KX6A 3OJAA 2VASA 5JDLA 2CWOA 2JRKA 4DR6T 2VL0A 4O4JE 3FZFB 4ISSA 3T1HT 2WZHA 3IBPA 3KV6A 1N33T 4DV5T 2QA7A 3I0QA 4YY3T 4H9SE 2X9HA 2X0HA 4YMSC 2PJQA 5ABEA 4KI0G 4JYAT 4PW8A 4DR7T 4A98A 5LBQB 3CQCB 5HCJA 2UUBT 2HPLA 2XUEA 4O4IE 5JRCB 4I55E 3HL6A 2WMOA 3N5LA 3OYXA 4WZXA 3ZJ2A 2LE8A 4JEHB 4IT4A 4KHZF 2ES0A 3SRZA 5KMGP 3PU8A 4XIGM 1YD8G 2QYWA 2IC9A 2E2AA 3SS1A 5L3EB 2BVMA 4PJJA 2DCFA 4LFBT 3N9NA 4B6XA 1ZHCA 4ASKA 3AA1B 2XQ8A 2V6YA 4IE4A 1HX1B 2BKPA 5HXCA 2UXCT 4ZZCA 4B3TT 1ZEEA 1U4QA 2OLTA 1HS7A 4L5GA 2VQFT 3X1DA 2V7MA 3UU4A 3FXDB 4NUVA 4HWHA 1XMOT 4IL4A 2GK9A 3C4WA 5F5WA 4TWFA 1HNWT 4IE6A 4H9RC 2K3WA 3KDSE 2EHOA 3AEEA 1MIVA 2VK9A 1FJGT 4AKLA 5LCYA 3ZCIA 2D2SA 1U5PA 3RYFE 5DQVA 2OA5A 4XTCM 4WNKA 5HEHA 5L3GB 1OEDB 4L0RA 4UF0A 2Z6EA 4YMVC 1MNEA 3JADA 4ZS2A 3C4XA 3RQUA 3VHLA 4GK0E 3MXZA 5JDFA 2YK0A 4AKHA 3ZMSB 3RHWA 3UUXB 5FNVE 5FL1A 4KHZG 2H7VC 1T8BA 2WY2A 3VKHA 4WBNE 3P4SA 4L9IA 4XZCA 5HXEA 1IJ5A 4LMKA 4O4HE 1MMAA 3AEFA 2J47A 4DR1T 3RI5A 3NZPA 4FJOA 5AQNB 2NTXA 4EYYR 2V7JA 1MIYA 2XHEB 1EZ3A 4YMUC 1UUSA 3GN5A 5L4HA 2XASB 5LHHB 2ZM0A 2JQQA 4GYSA 2JPFA 4MBQA 5ABGA 4TUYE 5CJ5A 4TWHA 2CCQA 2L8KA 5FXZA 2FBWA 2CXLA 1YKHB 3FB2A 3KBUA 4DV3T 4ILCA 2FJEA 3N2KE 5JDGA 3HKBE 4ZHQE 3TUJA 1HG5A 2RP4A 2MAWA 4X1YE 4U7IA 4EB6E 3C64A 3J9X1 2D0UA 2F4VT 2UXBT 4I4TE 3OPCA 4AI6A 4EXTA 2LOSA 1Z0PA 3AA0B 1IBMT 2W4XA 3GA8A 4G63A 3ZEFB 3CVRA 3GMIA 1BR1A 2XQ7A 4I50E 1UURA 4UR9A 2NTYA 3E22E 4Z8XA 4DMVA 3O4XE 3D31C 5LYJE 2W2UA 5AQFB 3TLUA 1VRBA 4U72A 1D1CA 1X79A 5KXJA 2N2NA 3RKGA 3RC3A 2CLYB 2UUCT 2E9XA 1YQ3A 2ACXA 3S4UA 5LHGB 3EVYA 1UGOA 4JBWF 3FZLB 5HWYA 4MLKA 2LKHA 1D0XA 5AQKB 4HWIB 2X51A 2LEHA 4A56A 4HFVA 4UVCB 1NWMX 3CKDA 5FKYA 5H6QB 3KFWX 3IEEA 2XQ9A 5CA1E 2WDVA 3JC6D 1OXZA 4CI1B 3OYZA 4KBMB 4PK5A 2X9WA 2D5UA 3AE9A 3AE8A 4ZOLE 1OEDE 3AE6A 3RIUC 3JC6C 4IDPA 1HNZT 2RA1A 3U78A 5ABFB 1QLBA 1IBKT 3T8OA 3DHWA 4ILBA 3LBXB 4H63H 3QC9A 4YHHT 3HI2A 2DLRA 5DQWA 3OTOT 4IIJE 5ADXL 4H9OC 3MKDA 2V7IA 4LMLA 2Y48B 3ZN0B 3UUNA 4HKAA 4IHJE 4C90A 3OKQA 3C50A 2ZM6T 1QUUA 2XQ5A 4DMWA 4AKGA 5ETWA 1FMVA 5HEOA 5C3JA 2LKGA 2NW8A 4X64T 3L8RA 3N9PA 1SUMB 2N1GA 4F8HA 2WWUA 3RIUA 1MMDA 1Z8UA 2LSKA 1R8IA 2Q9QB 4TN7B 4JI6T 4JBWG 1XZYA 4Z91A 5BR8T 2WDRA 3ZLIA 4CXWA 2LJLA 5JR9B 2VB6A 2YKSA 5CB4E 4JI7T 3IHRA 2V26A 2HN2A 5HEUA 5HXSA 1UX5A 3PUYF 2MBGA 4UXNB 4OYKA 4ZI3D 2AE9A 4PAGA 5HEJA 2XQ6A 2LM2A 2IUBA 3EI0A 1H7CA 3AAIA 2A2FX 4EIWA 4QWNB 3ZCJA 3PUWF 2YDRA 5IWAT 2BG9B 5JDMA 4H9PC 1MMGA 1S94A 4OYJA 4UV9B 2PTFA 3RX6A 4YSZA 4JI1T 4PK6A 2WZIA 2ZMAA 2WB5A 5JDNA 2XSBA 4M1PA 2KT9A 5C8YE 5JVDE 3QB5K 2V6XA 2FJBA 1XDPA 4HN9A 3RIAA 3ZSTA 2YEVC 4HTEA 2X66A 4DO0A 3K1SA 1UCUA 2E8IA 1I94T 3KV9A 4TQUM 3TLVA 4HGAA 2IW5B 3E08A 4HEAA 2JJ9A 3CIRA 4HFEA 4WBOA 4JI0T 3PUGA 1I6ZA 2XM2A 1W0AA 2NR4A 3AEDA 3I9YA 3NRYA 5JREA 2M67A 5L3DB 3MACA 3AE7A 3UU6A 5JRCA 3FXEB 5L4EA 1XNRT 3AVSA 4AKRB 3ZC1A 3ESLA 3I9WA 4LF8T 2C5JA 2EHOD 4QXCB 4H9NC 3EABA 1XNQT 3MZKB 5AQUB 2IIUA 4OHFA 2WS3A 3ZYMA 5CA0E 3TUIA 3ZMUB 3PUYG 4DIDB 4O2BE 3PUAA 4YTMA 2EHOC 2XZEA 1LRZA 3UU8A 4U2YA 2XAHB 3HKDE 2PG8A 4GK5E 2ZLYA 4P09A 3PUWG 3DTOA 2X0LB 1US7B 3MJXA 4IDZA 3ZYKA 4DV7T 2A72A 3UUBA 3FZHB 4GYRA 2W0GA 5HEGA 2MPKA 3PUVF 3ZT7A 5FY0A 2C5KT 2W61A 2W63A 4P0AA 5FL0A 1KF6A 4J2CA 2FUPA 3AE3A 3G06A 4CXXA 2X67A 1S35A 3BK9A 2VKJA 3GWHA 4PK4A 4Z90A 1OEDA 2YDQA 4EZ4A 3MK7C 3WAJA 4DV4T 1YQ4A 1VCTA 5JQGE 3FHNA 2X9XA 5LGNB 4BJNA 4MFRA 1G8XA 1CHUA 1OWAA 2CPTA 4GOUA 3AXJB 1MIWA 1HFAA 2WMNA 3C4ZA 3H3AA 5LXTE 2XPKA 2CWYA 4QKNA 4IL9A 2CBJA 1T72A 3AEAA 4NUUA 4DNDA 2VURA 1E7PA 4U74A 2BG9E 2CEAA 2WCAA 1IBLT 3K3OA 2H89A 1W0BA 5E0OA 4ANJA 4OX9T 3UU5A 3Q5WA 1ZP0A 4BJMA 4UVAB 2BBJA 2DHRA 4DBQA 4AQFA 1J5WA 2I6HA 3P4WA 4X65T 3MA9A 2VL8A 3PUVG 1XWMA 2YU1A 1HX8A 4DR4T 3PUSA 1WR0A 5AQVB 3ZMTB 4EV6A 3NWIA 4IE5A 3EHZA 4ERRA 2CLYC 1J5ET 2LRKA 2QRXA 2W00A 3CWZB 3KVBA 5TAOA 3B5MA 1JNZA 2VVNA 2XSAA 3Q9DA 1UX4A 4XIGN 3HA4A 2JMHA 2E9XD 3ZT5A 2DL1A 5LGUB 3DP7A 3PTRB 3VRBA 3JCFA 5L2LA 3WI3A 3TLWA 2D0TA 3QOFA 5L3FB 3N9QA 2X0YA 2E9XC 2KZ7B 4CN1A 3WAKA 4FI5A 4JUYA 3UQ7A 5LA6E 3CQGB 5HYAA 2CBIA 3EDVA 3ZMZB 1Y64B 1X9BA 5M4YA 2WSSV 2LM9A 1IZNB 2J62A 3AEBA 5BMVE 3AE2A 4YMWC 1D1AA 3VR8A 4TV8E 5FP3A 2FJAA 2A3DA 3VKGA 4QXHB 5HXHA 2VKOA 2R6GF 2H7OA 5EK3A 1D0ZA 2CHOA 5LG4A 3CMLA 3FBZA 5LMNT 2IHR1 2BVLA 4XAXB 3TLSA 5J2TE 3P4RA 3RQWA 3ZJ1A 2XAJB 3L3PA 4DV0T 1V9DA 1M62A 4X66T 1J1JA 4YT0A 4BA9A 3SFEA 3QB5A 3RGLA 2QVAA 3Q2MA 5AQPB 4X1KE 4O8SA 5AQLB 4TV9E 2JQHA 2M6IA 2V5DA 2ODVA 4DV1T 1WR6A 4EGWA 3LDQB 5ABFA 5JR9C 1KFYA 2FJDA 1DU2A 3LBXA 2CXDA 2K9AA 4YTPA 4ILAA 4HWFA 5LHIB 3VU7H 5FVLA 3U3IA 3TKLB 3FBLA 3AAAB 3V5UA 3UUMA 2CRBA 2KSRA 3BQIA 1SA0E 4O4LE 4JI4T 4YJ3E 3C51A 1WYCA 3ZSSA 3RLFF 2N9DA 5FXXA 4HFDA 2HHHT 1HR0T 4AQYT 2D9DA 4EAHA 3RC8A 3P8CD 3CX6B 1XMQT 3B13A 5IUXA 4UELA 4CI2B 5HWXA 3ANWB 1Y01A 2R6GG 2Q9QA 4YLHA 1D1BA
chains in the Genus database with same CATH topology
4YMUC 4TQUN 3DHWA 4KI0F 3RLFG 4XTCN 3PV0F 3PUYF 3PUVF 3PUZF 4KHZF 2R6GF 4JBWG 3PUWG 3PUXF 4XIGN 4YMSC 4TQUM 4XIGM 4YMTB 4KI0G 3PV0G 4YMWC 3TUIA 4XTCM 3PUZG 3PUYG 3PUVG 3RLFF 3TUZA 3TUJA 4KHZG 2R6GG 3D31C 3PUXG 2ONKC 4JBWF 3PUWF 4YMVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMU C;  4TQU N;  3DHW A;  4KI0 F;  3RLF G;  4XTC N;  3PV0 F;  3PUY F;  3PUV F;  3PUZ F;  4KHZ F;  2R6G F;  4JBW G;  3PUW G;  3PUX F;  4XIG N;  4YMS C;  4TQU M;  4XIG M;  4YMT B;  4KI0 G;  3PV0 G;  4YMW C;  3TUI A;  4XTC M;  3PUZ G;  3PUY G;  3PUV G;  3RLF F;  3TUZ A;  3TUJ A;  4KHZ G;  2R6G G;  3D31 C;  3PUX G;  2ONK C;  4JBW F;  3PUW F;  4YMV C; 
#chains in the Genus database with same CATH topology
 4ZS3 A;  1HCI A;  5JR9 A;  2P9B A;  2XJ7 A;  4IDN A;  2I59 A;  4AIS A;  4WYV A;  5JDQ A;  1QSD A;  1IJ6 A;  4IGU A;  1WFD A;  5L47 A;  4IRE A;  2UXN B;  2WU5 A;  2PBI A;  3QNU A;  3UTK A;  3TLT A;  5IHY A;  5J1G A;  4JI8 T;  3N9M A;  3IA3 A;  4HFH A;  4MAL A;  4PJN A;  3B57 A;  2V5C A;  4TWD A;  4JV5 T;  1E1H B;  5A1L A;  2BG9 A;  1LVF A;  3ABV A;  1KEY A;  4K0U A;  2VVS A;  5CGM A;  2X68 A;  3KIN B;  4UVB B;  5IYZ E;  1SHZ C;  1BR0 A;  2LSJ A;  3N2O A;  2MOZ A;  2LHN A;  4QH1 A;  2K24 A;  2DWK A;  2AXD S;  4B3R T;  1ZKE A;  2MYS A;  3RYH E;  1LKX A;  2G0U A;  3TUZ A;  5FVK A;  4HFC A;  3M65 A;  5KDM C;  1FMW A;  4KMC A;  4NXN T;  5LBM A;  2XAQ B;  3RLF G;  5LMU T;  4ZI3 C;  5L3B B;  3EUH A;  3BQK A;  4O2A E;  2V7L A;  5JH7 E;  3K3N A;  3FZM B;  5FY1 A;  5LJM A;  4DUZ T;  2DI4 A;  4AIU A;  3CPZ A;  2KXP B;  3PU3 A;  4YXD A;  1HF8 A;  5LJN A;  4A97 A;  4CI3 B;  2BDE A;  1BR2 A;  3A5X A;  2ONK C;  5KX5 E;  5AQR B;  2WBL A;  3O9X A;  2UU9 T;  2LHR A;  4AXP A;  1ZOY A;  4EOZ B;  1T7S A;  2XQA A;  5LG3 A;  3P7I A;  2ZM8 A;  4CZZ B;  5LGT B;  2HN1 A;  4H63 V;  4UIG A;  3AB3 B;  2MTQ A;  2C0S A;  3P4P A;  4GKK T;  5AQH B;  3L39 A;  3PUQ A;  4TX5 A;  3EAM A;  1OED C;  3QUJ A;  2CM0 A;  3AA6 B;  2A9U A;  2W67 A;  3HKE E;  1KNZ A;  1YXR A;  4JLE A;  4UEM A;  3FZK B;  3M3Z B;  2XQ4 A;  4XBF B;  3IF8 B;  2K5B B;  4ADZ A;  2KIN B;  4JI2 T;  4PJM A;  2NOX A;  3AVR A;  3CK6 A;  3RYC E;  1SE7 A;  1BR4 A;  2LRL A;  3Q5X A;  4LFC T;  4Q25 A;  2V8S V;  3O1I A;  5AQO B;  1N36 T;  4I0U A;  2V7K A;  2KLQ A;  1HTJ F;  3DJB A;  4ZZB A;  3NVO A;  4IST A;  3AAE B;  3ETV A;  2WU2 A;  1L0V A;  3A7M A;  3N9L A;  1B7T A;  3AXJ A;  4LMJ A;  3LK2 B;  5HAX A;  4G2A A;  5DAB A;  1WLX A;  1WYB A;  1CUN A;  2V1D B;  2ACZ A;  4B3S T;  2WWV A;  4PFP A;  2Y8D A;  4AQF C;  4TZ4 C;  4ZEY A;  4F6R C;  4EZH A;  3LFM A;  4DR5 T;  3T1Y T;  3UT5 E;  3H37 A;  2LT3 A;  3Q5E A;  1N32 T;  5CFB A;  1IAP A;  4YHJ A;  3ZT6 A;  3H3M A;  3LK3 B;  4HFI A;  3LK4 2;  3RYI E;  2V6Y B;  2H3R A;  3O1H A;  3KVA A;  1GQE A;  2Y6X A;  3EDU A;  4TQU N;  4I43 B;  2VKH A;  3RIF A;  4C91 A;  1O3X A;  3JAF A;  4DVD A;  3ONL C;  4H9Q C;  1G73 A;  4NIQ A;  3KV4 A;  1WCR A;  4BAY B;  2JQ9 A;  1VOM A;  5FMN A;  2M6B A;  4QHO A;  4DR3 T;  2XTL A;  2EHO B;  3F57 A;  2KWI B;  2RPA A;  5F3J A;  1UK5 A;  2BKO A;  2DNX A;  4X1I E;  2HPJ A;  2WP9 A;  4LF6 T;  3Q5D A;  1NEN A;  2CXF A;  1KNR A;  2JIW A;  4GIW A;  4B3M T;  3PUZ F;  4U33 A;  4UF0 B;  3VRA A;  2YIN A;  4X20 E;  4QX8 B;  4EED A;  2BS4 A;  5EZY E;  4LFA T;  3F2E A;  2ZM2 A;  5AQS B;  5AQQ B;  3AE1 A;  2CMR A;  5ABH A;  2JQK A;  3PV0 F;  2XQ3 A;  2LSY A;  3OBV E;  5J2U E;  3RRC A;  2IML A;  2BZB A;  3LJC A;  3P50 A;  2YU2 A;  4NXM T;  1LVK A;  4ZI7 E;  3NZQ A;  3N2G E;  4QH5 A;  2VWA A;  2CA5 A;  2B1E A;  2W62 A;  3ZPO A;  2WDQ A;  4YFS A;  4U31 A;  4P0B A;  1MND A;  3GN5 B;  5FXW A;  3UQ4 A;  1YW0 A;  1W9R A;  4YJ2 E;  4JI3 T;  4TNW A;  4MHC A;  3PJA J;  4HWD A;  2UXD T;  2ODU A;  4ZI2 D;  4IE0 A;  3LG7 A;  4DBR A;  1N34 T;  3W15 B;  2E5L T;  4U2Z A;  2WAU A;  4V1A v;  3PE0 A;  3ETU A;  2NW7 A;  1XDO A;  4HE8 A;  2IAK A;  3ZN1 B;  4ZI2 C;  5F8P A;  2JMK A;  3KV5 A;  3PUR A;  2NW9 A;  5JTG A;  4XTC N;  1M7K A;  4N78 D;  2Q9Q D;  2X9Y A;  2E5V A;  3ONJ A;  1VCS A;  5GON E;  4QX7 B;  4PJL A;  3PUZ G;  2PFV A;  5JDH A;  2XM1 A;  3UU3 A;  4ILU A;  5LB7 B;  4IE7 A;  4IDO A;  2BKN A;  2Q9Q C;  3L09 A;  5HCM A;  5DJQ C;  4OK0 A;  2CHN A;  3ZC0 A;  1WRD A;  5LP6 E;  1KNP A;  4HWC A;  5HXR A;  3PV0 G;  4TNV A;  1YKE B;  3A8Y C;  3ANW A;  1W09 A;  2BS2 A;  2K48 A;  2L9Q A;  4JEU B;  4JI5 T;  3ZYL A;  1JNR A;  2XAG B;  3PUX F;  4CN6 A;  4KHP T;  2XAF B;  5L3C B;  5FYM A;  2LOP A;  2BG9 C;  4E7Z A;  3BQL A;  2E9X B;  5FXV A;  2YDS A;  4LF5 T;  1D0Y A;  3R84 B;  2B76 A;  1T98 A;  2WQY A;  4AQG A;  2NWB A;  1AJ3 A;  3C98 B;  2IDO B;  4YMT B;  2J4G A;  1MMN A;  4UV8 B;  4X62 T;  2KND A;  2KMF A;  3UFG A;  2LSI A;  1E2A A;  2VQE T;  5AQG B;  4E7S A;  3D0T A;  3HR0 A;  3O1J A;  2J1D G;  4HFB A;  4COF A;  3AE4 A;  2IC6 A;  3NRX A;  2VKD A;  4DR2 T;  3SOL A;  5C2T A;  4LF9 T;  4EEB A;  3QK6 A;  4QXB B;  4AKI A;  3J7Y q;  5H6R B;  3I0O A;  2BS3 A;  2YN6 A;  4PNI A;  4KP3 C;  4PFO A;  3K3Q C;  2XY8 B;  3RRW A;  4WW0 A;  3R6N A;  4OFZ A;  3CX7 B;  2LSG A;  2NP9 A;  4YSX A;  4LF4 T;  5EK4 A;  2H88 A;  1ZV4 X;  5AQJ B;  3VR9 A;  3PJA A;  4IDQ A;  2CE7 A;  3AEG A;  4DUY T;  4GKJ T;  2LLY A;  3AEC A;  2UXX B;  1HNX T;  2QGS A;  2SPC A;  1NEK A;  2OV9 A;  4DV2 T;  3ZKR A;  3AE5 A;  3PDY A;  5AQT B;  4YTN A;  4X5T A;  3LSV A;  3RKO A;  5LOV E;  3PUX G;  2HH7 A;  4P1N A;  1FEW A;  2YOE A;  4KI0 F;  1FIO A;  3NBX X;  5AQI B;  3UFE A;  4NPP A;  2I0M A;  3E0Z A;  3OVU A;  3V5S A;  3I1A A;  2DWG A;  3KBT A;  3CX8 B;  2L3L A;  3CQX C;  5AFU L;  5LNK A;  4CXY A;  3RPU A;  1KK7 A;  2W66 A;  5FY7 A;  3SWH A;  3F31 A;  3HKC E;  3ZMV B;  3K8P C;  4A5X A;  2C5I T;  3N9O A;  3RH3 A;  2UUA T;  4K0K T;  2KWH A;  5J0Z A;  2BBH A;  4U7Y A;  3UUL A;  3NKZ A;  2XQY A;  3JAE A;  5AQM B;  3SFD A;  4QH4 A;  3P4Q A;  4LF7 T;  3ONX A;  1HG2 A;  4KUM B;  3AA7 B;  4U3C A;  1NAF A;  2WM9 A;  4CN4 A;  4ZXL A;  3RF1 A;  4DV6 T;  4EYU A;  4YSY A;  4CQI A;  5EK2 A;  4KX6 A;  3OJA A;  2VAS A;  5JDL A;  2CWO A;  2JRK A;  4DR6 T;  2VL0 A;  4O4J E;  3FZF B;  4ISS A;  3T1H T;  2WZH A;  3IBP A;  3KV6 A;  1N33 T;  4DV5 T;  2QA7 A;  3I0Q A;  4YY3 T;  4H9S E;  2X9H A;  2X0H A;  4YMS C;  2PJQ A;  5ABE A;  4KI0 G;  4JYA T;  4PW8 A;  4DR7 T;  4A98 A;  5LBQ B;  3CQC B;  5HCJ A;  2UUB T;  2HPL A;  2XUE A;  4O4I E;  5JRC B;  4I55 E;  3HL6 A;  2WMO A;  3N5L A;  3OYX A;  4WZX A;  3ZJ2 A;  2LE8 A;  4JEH B;  4IT4 A;  4KHZ F;  2ES0 A;  3SRZ A;  5KMG P;  3PU8 A;  4XIG M;  1YD8 G;  2QYW A;  2IC9 A;  2E2A A;  3SS1 A;  5L3E B;  2BVM A;  4PJJ A;  2DCF A;  4LFB T;  3N9N A;  4B6X A;  1ZHC A;  4ASK A;  3AA1 B;  2XQ8 A;  2V6Y A;  4IE4 A;  1HX1 B;  2BKP A;  5HXC A;  2UXC T;  4ZZC A;  4B3T T;  1ZEE A;  1U4Q A;  2OLT A;  1HS7 A;  4L5G A;  2VQF T;  3X1D A;  2V7M A;  3UU4 A;  3FXD B;  4NUV A;  4HWH A;  1XMO T;  4IL4 A;  2GK9 A;  3C4W A;  5F5W A;  4TWF A;  1HNW T;  4IE6 A;  4H9R C;  2K3W A;  3KDS E;  2EHO A;  3AEE A;  1MIV A;  2VK9 A;  1FJG T;  4AKL A;  5LCY A;  3ZCI A;  2D2S A;  1U5P A;  3RYF E;  5DQV A;  2OA5 A;  4XTC M;  4WNK A;  5HEH A;  5L3G B;  1OED B;  4L0R A;  4UF0 A;  2Z6E A;  4YMV C;  1MNE A;  3JAD A;  4ZS2 A;  3C4X A;  3RQU A;  3VHL A;  4GK0 E;  3MXZ A;  5JDF A;  2YK0 A;  4AKH A;  3ZMS B;  3RHW A;  3UUX B;  5FNV E;  5FL1 A;  4KHZ G;  2H7V C;  1T8B A;  2WY2 A;  3VKH A;  4WBN E;  3P4S A;  4L9I A;  4XZC A;  5HXE A;  1IJ5 A;  4LMK A;  4O4H E;  1MMA A;  3AEF A;  2J47 A;  4DR1 T;  3RI5 A;  3NZP A;  4FJO A;  5AQN B;  2NTX A;  4EYY R;  2V7J A;  1MIY A;  2XHE B;  1EZ3 A;  4YMU C;  1UUS A;  3GN5 A;  5L4H A;  2XAS B;  5LHH B;  2ZM0 A;  2JQQ A;  4GYS A;  2JPF A;  4MBQ A;  5ABG A;  4TUY E;  5CJ5 A;  4TWH A;  2CCQ A;  2L8K A;  5FXZ A;  2FBW A;  2CXL A;  1YKH B;  3FB2 A;  3KBU A;  4DV3 T;  4ILC A;  2FJE A;  3N2K E;  5JDG A;  3HKB E;  4ZHQ E;  3TUJ A;  1HG5 A;  2RP4 A;  2MAW A;  4X1Y E;  4U7I A;  4EB6 E;  3C64 A;  3J9X 1;  2D0U A;  2F4V T;  2UXB T;  4I4T E;  3OPC A;  4AI6 A;  4EXT A;  2LOS A;  1Z0P A;  3AA0 B;  1IBM T;  2W4X A;  3GA8 A;  4G63 A;  3ZEF B;  3CVR A;  3GMI A;  1BR1 A;  2XQ7 A;  4I50 E;  1UUR A;  4UR9 A;  2NTY A;  3E22 E;  4Z8X A;  4DMV A;  3O4X E;  3D31 C;  5LYJ E;  2W2U A;  5AQF B;  3TLU A;  1VRB A;  4U72 A;  1D1C A;  1X79 A;  5KXJ A;  2N2N A;  3RKG A;  3RC3 A;  2CLY B;  2UUC T;  2E9X A;  1YQ3 A;  2ACX A;  3S4U A;  5LHG B;  3EVY A;  1UGO A;  4JBW F;  3FZL B;  5HWY A;  4MLK A;  2LKH A;  1D0X A;  5AQK B;  4HWI B;  2X51 A;  2LEH A;  4A56 A;  4HFV A;  4UVC B;  1NWM X;  3CKD A;  5FKY A;  5H6Q B;  3KFW X;  3IEE A;  2XQ9 A;  5CA1 E;  2WDV A;  3JC6 D;  1OXZ A;  4CI1 B;  3OYZ A;  4KBM B;  4PK5 A;  2X9W A;  2D5U A;  3AE9 A;  3AE8 A;  4ZOL E;  1OED E;  3AE6 A;  3RIU C;  3JC6 C;  4IDP A;  1HNZ T;  2RA1 A;  3U78 A;  5ABF B;  1QLB A;  1IBK T;  3T8O A;  3DHW A;  4ILB A;  3LBX B;  4H63 H;  3QC9 A;  4YHH T;  3HI2 A;  2DLR A;  5DQW A;  3OTO T;  4IIJ E;  5ADX L;  4H9O C;  3MKD A;  2V7I A;  4LML A;  2Y48 B;  3ZN0 B;  3UUN A;  4HKA A;  4IHJ E;  4C90 A;  3OKQ A;  3C50 A;  2ZM6 T;  1QUU A;  2XQ5 A;  4DMW A;  4AKG A;  5ETW A;  1FMV A;  5HEO A;  5C3J A;  2LKG A;  2NW8 A;  4X64 T;  3L8R A;  3N9P A;  1SUM B;  2N1G A;  4F8H A;  2WWU A;  3RIU A;  1MMD A;  1Z8U A;  2LSK A;  1R8I A;  2Q9Q B;  4TN7 B;  4JI6 T;  4JBW G;  1XZY A;  4Z91 A;  5BR8 T;  2WDR A;  3ZLI A;  4CXW A;  2LJL A;  5JR9 B;  2VB6 A;  2YKS A;  5CB4 E;  4JI7 T;  3IHR A;  2V26 A;  2HN2 A;  5HEU A;  5HXS A;  1UX5 A;  3PUY F;  2MBG A;  4UXN B;  4OYK A;  4ZI3 D;  2AE9 A;  4PAG A;  5HEJ A;  2XQ6 A;  2LM2 A;  2IUB A;  3EI0 A;  1H7C A;  3AAI A;  2A2F X;  4EIW A;  4QWN B;  3ZCJ A;  3PUW F;  2YDR A;  5IWA T;  2BG9 B;  5JDM A;  4H9P C;  1MMG A;  1S94 A;  4OYJ A;  4UV9 B;  2PTF A;  3RX6 A;  4YSZ A;  4JI1 T;  4PK6 A;  2WZI A;  2ZMA A;  2WB5 A;  5JDN A;  2XSB A;  4M1P A;  2KT9 A;  5C8Y E;  5JVD E;  3QB5 K;  2V6X A;  2FJB A;  1XDP A;  4HN9 A;  3RIA A;  3ZST A;  2YEV C;  4HTE A;  2X66 A;  4DO0 A;  3K1S A;  1UCU A;  2E8I A;  1I94 T;  3KV9 A;  4TQU M;  3TLV A;  4HGA A;  2IW5 B;  3E08 A;  4HEA A;  2JJ9 A;  3CIR A;  4HFE A;  4WBO A;  4JI0 T;  3PUG A;  1I6Z A;  2XM2 A;  1W0A A;  2NR4 A;  3AED A;  3I9Y A;  3NRY A;  5JRE A;  2M67 A;  5L3D B;  3MAC A;  3AE7 A;  3UU6 A;  5JRC A;  3FXE B;  5L4E A;  1XNR T;  3AVS A;  4AKR B;  3ZC1 A;  3ESL A;  3I9W A;  4LF8 T;  2C5J A;  2EHO D;  4QXC B;  4H9N C;  3EAB A;  1XNQ T;  3MZK B;  5AQU B;  2IIU A;  4OHF A;  2WS3 A;  3ZYM A;  5CA0 E;  3TUI A;  3ZMU B;  3PUY G;  4DID B;  4O2B E;  3PUA A;  4YTM A;  2EHO C;  2XZE A;  1LRZ A;  3UU8 A;  4U2Y A;  2XAH B;  3HKD E;  2PG8 A;  4GK5 E;  2ZLY A;  4P09 A;  3PUW G;  3DTO A;  2X0L B;  1US7 B;  3MJX A;  4IDZ A;  3ZYK A;  4DV7 T;  2A72 A;  3UUB A;  3FZH B;  4GYR A;  2W0G A;  5HEG A;  2MPK A;  3PUV F;  3ZT7 A;  5FY0 A;  2C5K T;  2W61 A;  2W63 A;  4P0A A;  5FL0 A;  1KF6 A;  4J2C A;  2FUP A;  3AE3 A;  3G06 A;  4CXX A;  2X67 A;  1S35 A;  3BK9 A;  2VKJ A;  3GWH A;  4PK4 A;  4Z90 A;  1OED A;  2YDQ A;  4EZ4 A;  3MK7 C;  3WAJ A;  4DV4 T;  1YQ4 A;  1VCT A;  5JQG E;  3FHN A;  2X9X A;  5LGN B;  4BJN A;  4MFR A;  1G8X A;  1CHU A;  1OWA A;  2CPT A;  4GOU A;  3AXJ B;  1MIW A;  1HFA A;  2WMN A;  3C4Z A;  3H3A A;  5LXT E;  2XPK A;  2CWY A;  4QKN A;  4IL9 A;  2CBJ A;  1T72 A;  3AEA A;  4NUU A;  4DND A;  2VUR A;  1E7P A;  4U74 A;  2BG9 E;  2CEA A;  2WCA A;  1IBL T;  3K3O A;  2H89 A;  1W0B A;  5E0O A;  4ANJ A;  4OX9 T;  3UU5 A;  3Q5W A;  1ZP0 A;  4BJM A;  4UVA B;  2BBJ A;  2DHR A;  4DBQ A;  4AQF A;  1J5W A;  2I6H A;  3P4W A;  4X65 T;  3MA9 A;  2VL8 A;  3PUV G;  1XWM A;  2YU1 A;  1HX8 A;  4DR4 T;  3PUS A;  1WR0 A;  5AQV B;  3ZMT B;  4EV6 A;  3NWI A;  4IE5 A;  3EHZ A;  4ERR A;  2CLY C;  1J5E T;  2LRK A;  2QRX A;  2W00 A;  3CWZ B;  3KVB A;  5TAO A;  3B5M A;  1JNZ A;  2VVN A;  2XSA A;  3Q9D A;  1UX4 A;  4XIG N;  3HA4 A;  2JMH A;  2E9X D;  3ZT5 A;  2DL1 A;  5LGU B;  3DP7 A;  3PTR B;  3VRB A;  3JCF A;  5L2L A;  3WI3 A;  3TLW A;  2D0T A;  3QOF A;  5L3F B;  3N9Q A;  2X0Y A;  2E9X C;  2KZ7 B;  4CN1 A;  3WAK A;  4FI5 A;  4JUY A;  3UQ7 A;  5LA6 E;  3CQG B;  5HYA A;  2CBI A;  3EDV A;  3ZMZ B;  1Y64 B;  1X9B A;  5M4Y A;  2WSS V;  2LM9 A;  1IZN B;  2J62 A;  3AEB A;  5BMV E;  3AE2 A;  4YMW C;  1D1A A;  3VR8 A;  4TV8 E;  5FP3 A;  2FJA A;  2A3D A;  3VKG A;  4QXH B;  5HXH A;  2VKO A;  2R6G F;  2H7O A;  5EK3 A;  1D0Z A;  2CHO A;  5LG4 A;  3CML A;  3FBZ A;  5LMN T;  2IHR 1;  2BVL A;  4XAX B;  3TLS A;  5J2T E;  3P4R A;  3RQW A;  3ZJ1 A;  2XAJ B;  3L3P A;  4DV0 T;  1V9D A;  1M62 A;  4X66 T;  1J1J A;  4YT0 A;  4BA9 A;  3SFE A;  3QB5 A;  3RGL A;  2QVA A;  3Q2M A;  5AQP B;  4X1K E;  4O8S A;  5AQL B;  4TV9 E;  2JQH A;  2M6I A;  2V5D A;  2ODV A;  4DV1 T;  1WR6 A;  4EGW A;  3LDQ B;  5ABF A;  5JR9 C;  1KFY A;  2FJD A;  1DU2 A;  3LBX A;  2CXD A;  2K9A A;  4YTP A;  4ILA A;  4HWF A;  5LHI B;  3VU7 H;  5FVL A;  3U3I A;  3TKL B;  3FBL A;  3AAA B;  3V5U A;  3UUM A;  2CRB A;  2KSR A;  3BQI A;  1SA0 E;  4O4L E;  4JI4 T;  4YJ3 E;  3C51 A;  1WYC A;  3ZSS A;  3RLF F;  2N9D A;  5FXX A;  4HFD A;  2HHH T;  1HR0 T;  4AQY T;  2D9D A;  4EAH A;  3RC8 A;  3P8C D;  3CX6 B;  1XMQ T;  3B13 A;  5IUX A;  4UEL A;  4CI2 B;  5HWX A;  3ANW B;  1Y01 A;  2R6G G;  2Q9Q A;  4YLH A;  1D1B A; 
#chains in the Genus database with same CATH homology
 4YMU C;  4TQU N;  3DHW A;  4KI0 F;  3RLF G;  4XTC N;  3PV0 F;  3PUY F;  3PUV F;  3PUZ F;  4KHZ F;  2R6G F;  4JBW G;  3PUW G;  3PUX F;  4XIG N;  4YMS C;  4TQU M;  4XIG M;  4YMT B;  4KI0 G;  3PV0 G;  4YMW C;  3TUI A;  4XTC M;  3PUZ G;  3PUY G;  3PUV G;  3RLF F;  3TUZ A;  3TUJ A;  4KHZ G;  2R6G G;  3D31 C;  3PUX G;  2ONK C;  4JBW F;  3PUW F;  4YMV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...