3RLFF

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 147
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3rlfF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3rlfF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3rlfF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3rlfF02
4XTCN 3PV0F 4YMTB 2R6GF 3PUVG 3PUYG 4KI0G 3D31C 3PUVF 3PV0G 3PUZG 4YMSC 4YMWC 2R6GG 3PUYF 3PUZF 4YMUC 4KHZF 3TUZA 4JBWF 4TQUM 3PUWF 4XIGM 4KHZG 3RLFF 4XTCM 4JBWG 4XIGN 3PUWG 3RLFG 4YMVC 4TQUN 3TUJA 3PUXF 3PUXG 2ONKC 3TUIA 4KI0F 3DHWA
chains in the Genus database with same CATH superfamily
4Z8XA 3RQUA 2E9XC 1CUNA 3OPCA 4H63V 3RYCE 3TLUA 2K24A 4UVAB 5EK2A 5IUXA 4AKHA 3GN5B 2E5LT 5LG3A 2ZM0A 1Z0PA 3FZHB 2K5BB 4OYKA 3ZJ2A 4YXDA 2D9DA 4YMSC 2DWGA 3BQKA 4GYRA 2MBGA 5JRCA 3QB5K 4IE7A 4AKRB 4EYYR 1HR0T 2W66A 4HE8A 2FJAA 2LOSA 3AEFA 4YFSA 2PG8A 1T8BA 1US7B 2XJ7A 3QOFA 3PUAA 2J4GA 2XAQB 5AQQB 2PFVA 4IDQA 5ABGA 3V5UA 4BJMA 3ZN0B 1HFAA 1W9RA 1XWMA 4YMVC 3N9NA 1HX1B 3E22E 1OXZA 4TNWA 4O2AE 3G06A 1CHUA 3UU6A 2V26A 5L3BB 3CMLA 2HPJA 1E7PA 4EEBA 4ZS3A 4JI1T 3N5LA 4N78D 2Q9QD 3AE3A 2PBIA 3ETUA 4KX6A 3F57A 3AE4A 4HFBA 3ZSTA 1IBKT 3K1SA 4B3ST 2BZBA 4OX9T 2E9XA 3TUIA 1MIWA 3PJAJ 5LBQB 3TKLB 1HG5A 2C5JA 4O2BE 1OEDC 5FVLA 4UEMA 5AQUB 3X1DA 3K3OA 3FZKB 3PU8A 3N9LA 4A98A 2QRXA 2XM2A 4GOUA 3MZKB 4NXNT 4PFPA 4ZZCA 4YT0A 2W67A 3PUVF 2ES0A 2KMFA 5AQTB 5FY7A 4YSYA 2UXXB 4LF7T 2JQKA 4OK0A 4O8SA 5FNVE 2D0UA 3JAEA 1XZYA 4IDOA 4JI2T 1YD8G 2UUAT 3AAIA 1KNZA 1MMDA 4XIGM 4IDZA 3I9WA 4AQGA 2PTFA 4JI3T 3I0QA 4UF0B 4DVDA 5KMGP 2SPCA 2JQQA 4X62T 2LE8A 4B3TT 3PUXF 4IL9A 2YDSA 1JNZA 3CX6B 3H3MA 2XQAA 3QNUA 4JUYA 1WRDA 4U74A 4BAYB 5BMVE 2V6YB 5LXTE 3OBVE 4B3MT 3RIUC 2VKOA 3EABA 2XQ3A 4WZXA 5IYZE 5LJNA 3LJCA 4DUYT 4UR9A 4QH5A 5LGUB 2CLYB 3EI0A 3Q5DA 4PJMA 3VR9A 1L0VA 4HFEA 3VU7H 3KBTA 2X9XA 4KMCA 3ZSSA 1T7SA 3VRAA 1GQEA 3KINB 4KI0G 5LA6E 3A7MA 4PW8A 4U2YA 3RX6A 4KUMB 4YTMA 1D0XA 2RPAA 1N36T 2EHOB 3P7IA 5AQLB 5AQKB 4UV9B 1ZV4X 4MALA 4U72A 2LT3A 1BR4A 3U78A 3OVUA 3QB5A 4EV6A 5L4EA 3I9YA 3UFEA 2BKOA 2C5KT 1SHZC 2IC9A 2WBLA 2YU2A 3EAMA 3K3QC 3L39A 2CM0A 3RLFF 4FJOA 4XTCM 2E2AA 4HN9A 4H9NC 3UU4A 3IA3A 3AB3B 2XAJB 1D1BA 2WDQA 2K48A 2IC6A 4QWNB 1B7TA 1D1AA 5J2UE 3JC6C 2DLRA 2KT9A 4UV8B 4F6RC 1HG2A 4ILUA 2VQET 2W62A 5LHHB 3KV9A 4I0UA 3A5XA 2ZM6T 1M62A 1HS7A 2LOPA 1WYCA 2I59A 3ZPOA 4TNVA 2HH7A 3UU3A 2WMOA 2D2SA 3C50A 4ZI2D 1I6ZA 3LK3B 2LSKA 3N9MA 3MKDA 3O1JA 4YJ3E 3N2GE 4MFRA 3UUMA 4AKLA 4AISA 1AJ3A 1WYBA 4ZI3D 2CBJA 4TQUM 1V9DA 1BR0A 4PK5A 2VURA 4QXBB 5M4YA 1Y01A 3HI2A 3J7Yq 3CK6A 2FJBA 4DV7T 3CX7B 4XIGN 3T1YT 1ZKEA 3T8OA 5JREA 1XNQT 4X5TA 3AAEB 4Z91A 5HAXA 4ZI2C 4I50E 4COFA 3ZJ1A 4CN6A 5HEGA 3SFDA 2NW7A 2WMNA 4TWHA 4K0KT 4BJNA 1Z8UA 2GK9A 2VVNA 2A9UA 2XAGB 3FBLA 3OKQA 5FXWA 2NOXA 3RPUA 4NUVA 5A1LA 4NXMT 2XHEB 3SS1A 4AQFC 4C90A 1O3XA 3E08A 4GKJT 4XTCN 4Z90A 4EEDA 5KX5E 4J2CA 4X65T 4AI6A 3VKGA 5GONE 1M7KA 5ABFB 4X1KE 2H7VC 5JDLA 1W0AA 4DV4T 2XUEA 2Y6XA 3DJBA 1MNDA 2V5DA 1IJ6A 2WZHA 4EYUA 3OYZA 3PUYF 2LSGA 4H9OC 3RH3A 2UXNB 3GMIA 1KFYA 2DWKA 3AE1A 4KBMB 4U2ZA 3UU5A 4EB6E 3Q5XA 3N9PA 4CI3B 4HGAA 4HWFA 4AQYT 5ETWA 5L3DB 4LFAT 4DR4T 4YSXA 3P4RA 2WM9A 4JBWG 4GK0E 5AQSB 3F31A 5HXRA 3NZQA 4KP3C 1KNPA 5JH7E 5JDNA 4JI7T 2BS4A 2V7IA 5C3JA 5L4HA 2J1DG 1XNRT 1Y64B 1WR6A 4ZI7E 3VKHA 4E7ZA 1YW0A 3SFEA 3RRCA 1XMOT 5HEHA 1N33T 2V6XA 3LBXA 2BS2A 2KXPB 2XZEA 3QK6A 3PV0F 2NP9A 2NTXA 4OHFA 3P4SA 2W4XA 2VWAA 3AEEA 1ZOYA 3ZMUB 2KINB 3FBZA 2LSIA 5CB4E 5HYAA 3LDQB 3PV0G 3C51A 2AXDS 4I55E 4A5XA 5DQVA 3AEAA 4YMUC 2V7KA 1UX5A 2W63A 2WWVA 2F4VT 3AEGA 5LHGB 3AA7B 3FZFB 3CPZA 4O4HE 5L47A 3JC6D 3ABVA 2HN1A 3K3NA 1HX8A 3RF1A 3RLFG 2LHRA 2W2UA 4JEHB 2LRLA 2Z6EA 5ADXL 5LP6E 2XQ9A 3EUHA 3L3PA 2OLTA 5LGTB 2A72A 2CEAA 1D0YA 4HWIB 2CXDA 1BR1A 4ZXLA 2BG9E 1NWMX 4ISTA 1HF8A 4KI0F 3AEBA 3VRBA 5FKYA 1X79A 3MXZA 5HWYA 2B76A 4HFHA 3KVAA 4OFZA 2E8IA 2BS3A 3QUJA 4WBNE 5LMUT 4QXCB 5HXCA 4H9SE 4ERRA 1J1JA 2XSBA 2VKHA 3RIFA 3ONLC 3AXJB 2W61A 2WS3A 4UVBB 3AE5A 2CXFA 5AQPB 4CQIA 2MAWA 4DV6T 4LF9T 2N2NA 1QSDA 1W0BA 4TN7B 1KK7A 2ZMAA 2FJEA 3CWZB 4U3CA 5HXEA 5HXSA 4YHHT 4P09A 2Q9QA 4X20E 4CI2B 4DR5T 5LG4A 4JEUB 5JDGA 2D5UA 2YOEA 3P8CD 3KDSE 4TX5A 4ZOLE 5LOVE 3TLSA 5EK3A 2RP4A 3EHZA 5CA0E 4EIWA 5DQWA 3Q9DA 2VQFT 2JPFA 2OV9A 2WQYA 3PE0A 4H9RC 2IIUA 5HCJA 5AQJB 3UTKA 5L3GB 1MMNA 3ZCIA 4HTEA 4IHJE 5L3CB 5F3JA 2ZM2A 3MA9A 4PJJA 3WI3A 1UCUA 2FUPA 2XAFB 2C0SA 2FBWA 3D31C 2LRKA 5HEUA 3RHWA 3SOLA 3EDVA 2VK9A 4PK6A 5L2LA 3P4PA 3HL6A 1N34T 2H3RA 2HPLA 3ZCJA 4DNDA 4EZHA 4LFCT 3BQLA 2JQHA 4QKNA 5FXXA 5H6QB 2NR4A 1XDPA 4CXYA 3PUWF 2KLQA 2J47A 2IMLA 4ILAA 4JI5T 2XASB 3CIRA 2J62A 5CFBA 2XSAA 3ETVA 3ZMVB 5IWAT 1YQ4A 2BDEA 3TLWA 2X0YA 1UX4A 2WWUA 5LNKA 2LLYA 2YINA 2LSJA 3CQGB 3LFMA 4IDNA 2UUCT 2WAUA 4I43B 3B57A 3Q5EA 3ZKRA 4QX8B 2QVAA 3UULA 4P0AA 2H7OA 3ESLA 4BA9A 4HWDA 2XTLA 1WFDA 3TLVA 4CZZB 2R6GF 3C4WA 1QUUA 2KWHA 2JMKA 2N1GA 2I0MA 1BR2A 3CVRA 4EOZB 5JR9C 3R84B 3AECA 3H37A 4IREA 2R6GG 3AE8A 3FXEB 2XY8B 5LBMA 2V5CA 3TUZA 1YQ3A 1E1HB 2WSSV 5HXHA 4JYAT 3PU3A 2M67A 4UXNB 5AQFB 2CLYC 3LBXB 4H9QC 4JI8T 2KZ7B 5FL1A 4DV5T 4CXXA 4HEAA 2HHHT 4U33A 4DBQA 2JJ9A 1G73A 4NIQA 1LVKA 2LM9A 3IEEA 1ZHCA 4ADZA 3UT5E 4YY3T 5EZYE 3W15B 2LEHA 4LFBT 2UU9T 2UXDT 1XMQT 3HA4A 4HWCA 5JR9B 4P1NA 2JRKA 2P9BA 3ANWA 1XDOA 4IDPA 3L09A 3ZEFB 5JQGE 2CA5A 5F5WA 1OEDB 1LRZA 5IHYA 4DV1T 4M1PA 4YMTB 4JI0T 1VOMA 3UUXB 2E5VA 2XQ4A 2RA1A 4X1IE 4DUZT 1ZP0A 2BBJA 4YMWC 1D1CA 2CPTA 2LM2A 4LMJA 2BKNA 1N32T 3ANWB 4A56A 3KFWX 4X64T 5FP3A 3KV6A 1HTJF 4P0BA 3VR8A 2IDOB 5C2TA 3N2OA 2DL1A 2WCAA 3WAJA 3C98B 4CXWA 4PFOA 4U7YA 3UQ4A 5CGMA 2D0TA 3TUJA 3AE2A 3I0OA 2CBIA 3E0ZA 3MK7C 4YHJA 1YXRA 4TV8E 2XQYA 5E0OA 4DMWA 3AAAB 4MLKA 2JMHA 4YJ2E 5BR8T 2MPKA 2K3WA 1WCRA 2IUBA 1X9BA 3HR0A 4H9PC 4PJLA 3BK9A 2WZIA 1YKHB 4ANJA 1UUSA 2CCQA 1FMVA 2A3DA 5AQRB 2L8KA 4LF5T 4L0RA 3TLTA 5LJMA 3FHNA 1UURA 1G8XA 3AE7A 4K0UA 4UELA 1IBMT 1QLBA 4DIDB 2YU1A 5HEJA 2NWBA 2LKGA 2MOZA 5FXZA 4DR3T 2BG9A 2LSYA 1IAPA 2LJLA 2ODUA 2V7LA 2VL0A 3AXJA 5LB7B 2ODVA 2MYSA 4KHPT 1J5WA 4HWHA 3UQ7A 3ZC0A 2C5IT 1MNEA 4IT4A 3FB2A 4ZEYA 3RI5A 1FEWA 4UVCB 2BG9C 3B13A 2LKHA 4HFIA 4DV0T 2IHR1 2OA5A 2NW8A 3ZYLA 4LMLA 3ZT5A 2ONKC 2CE7A 1U4QA 2WB5A 3NBXX 1S94A 4QHOA 4WW0A 3O4XE 4QH4A 3PTRB 4UIGA 5JR9A 4CI1B 4YTPA 4YLHA 1YKEB 5LCYA 3BQIA 3LSVA 4PJNA 3KVBA 2QGSA 3RIAA 3PUGA 4AXPA 3DHWA 3P50A 2CHOA 2QYWA 3FZLB 2ACZA 3OJAA 5FL0A 3CX8B 2X51A 4GIWA 2CMRA 4IGUA 5EK4A 5TAOA 3NZPA 3U3IA 2IW5B 4ZHQE 5JDMA 3H3AA 2L3LA 2ACXA 2I6HA 3AEDA 3NKZA 5AQNB 4X1YE 2M6BA 3PUZG 5JTGA 1VCTA 2V1DB 4MHCA 5HWXA 2WU5A 4U7IA 4U31A 5JDQA 2BG9B 3PDYA 2XPKA 3N9QA 3ONXA 2L9QA 3ZMZB 3AA6B 2EHOD 3UFGA 4DR2T 4HFDA 2VVSA 2YDRA 4DBRA 2YN6A 3F2EA 2BBHA 2VL8A 3RKOA 2VB6A 3PJAA 2AE9A 3EDUA 2CWOA 1JNRA 3NVOA 2V6YA 3KV5A 2X9YA 3Q2MA 3VHLA 2YEVC 3C64A 3HKDE 2UXCT 4TWFA 5FY1A 5FXVA 2X68A 4IE0A 1UK5A 4B6XA 1VRBA 4QH1A 3WAKA 3PURA 2QA7A 3QC9A 3RQWA 3JAFA 4A97A 2BVMA 2CXLA 2DI4A 4G2AA 3GA8A 3PUYG 3PUVG 3P4QA 2A2FX 3AVRA 1EZ3A 4XBFB 2DCFA 2NTYA 2JQ9A 5DJQC 4HKAA 4IE5A 2FJDA 2K9AA 2X9WA 3V5SA 4LF6T 5JRCB 1KEYA 4FI5A 5HEOA 4EAHA 5LHIB 4ILCA 3GWHA 3R6NA 4JBWF 2Y8DA 2NW9A 2H89A 4PAGA 4GKKT 3S4UA 4AIUA 3N2KE 4LF4T 2M6IA 2XQ6A 1VCSA 2KSRA 2WP9A 2YK0A 2ZM8A 3AE9A 1IZNB 3Q5WA 4ILBA 4E7SA 5LYJE 2EHOA 3UU8A 1FMWA 2XAHB 1UGOA 2H88A 5L3EB 3KV4A 2CRBA 4TZ4C 5H6RB 2MTQA 2EHOC 4QXHB 3ZC1A 4TWDA 1MIVA 2XQ5A 3JCFA 1WLXA 3UUNA 4X66T 3KBUA 5AQGB 4EZ4A 5HCMA 4AQFA 3IBPA 3IF8B 4C91A 2XQ8A 4HFCA 2G0UA 4XAXB 5FYMA 2CHNA 2YDQA 3A8YC 1KF6A 2ZLYA 3JADA 2E9XD 2W00A 4L9IA 5DABA 2WDRA 4DMVA 3SWHA 5JDFA 4O4LE 1HCIA 4PNIA 4CN1A 4GK5E 5C8YE 3NRYA 1FIOA 3C4ZA 2Y48B 4Q25A 4ASKA 5FMNA 1E2AA 5CJ5A 3O9XA 4PK4A 3ZMTB 4V1Av 2W0GA 5AQHB 4KHZG 1W09A 3RKGA 4JI4T 2PJQA 3B5MA 5FVKA 3SRZA 1NAFA 3P4WA 5J2TE 1SE7A 3PUWG 1IJ5A 1H7CA 3ZYKA 4TQUN 3DTOA 2WDVA 3NRXA 4LMKA 5AFUL 5FY0A 4I4TE 1HNZT 3HKCE 3UUBA 4JV5T 3MACA 3M3ZB 4IIJE 4QX7B 4DO0A 3AVSA 3HKEE 5L3FB 4B3RT 2Q9QC 1T72A 1T98A 2V7MA 3PUSA 3CKDA 3AA0B 3ZYMA 3RGLA 2X0HA 5JVDE 3FZMB 1KNRA 1ZEEA 2N9DA 1J5ET 3LK2B 3RC8A 1SA0E 2WU2A 4WYVA 4ZS2A 3J9X1 4GYSA 1LVFA 2KNDA 2UUBT 3CQXC 2JIWA 1MMAA 5KDMC 3PUZF 5J0ZA 3O1HA 5AQIB 4KHZF 2E9XB 2WY2A 2KWIB 3N9OA 4HFVA 3RYFE 3ZN1B 3ZT7A 1I94T 5LGNB 3EVYA 3K8PC 4ISSA 1SUMB 3M65A 4IL4A 3MJXA 2X67A 5J1GA 1MMGA 3T1HT 2X9HA 4H63H 1U5PA 4JLEA 3PUXG 1NEKA 3CQCB 3DP7A 3NWIA 4XZCA 2X0LB 5ABHA 1FJGT 5AQOB 3PUQA 5KXJA 4DR7T 4EXTA 1HNXT 2IAKA 3RYIE 4F8HA 5JDHA 4AKGA 2XQ7A 4L5GA 4JI6T 5F8PA 1IBLT 4O4JE 3AA1B 3GN5A 4TV9E 2BVLA 2VASA 2CWYA 4WNKA 4DR1T 3RIUA 1NENA 2UXBT 4AKIA 4UF0A 2DHRA 3OYXA 1WR0A 4WBOA 3RYHE 2VKDA 1OWAA 3ZT6A 2X66A 4YTNA 1HNWT 3ZMSB 4TUYE 3O1IA 3ONJA 4IE4A 3IHRA 3LK42 4NPPA 4O4IE 4MBQA 2YKSA 2DNXA 4DR6T 3LG7A 3OTOT 2V7JA 1OEDE 2Q9QB 2BKPA 3L8RA 3ZLIA 1R8IA 4DV2T 3FXDB 4G63A 4NUUA 5ABFA 1D0ZA 5AQMB 3AE6A 2HN2A 1DU2A 3C4XA 4CN4A 4YSZA 3HKBE 4DV3T 1S35A 5ABEA 3I1AA 4LF8T 5AQVB 2LHNA 2V8SV 4ZI3C 1LKXA 3D0TA 3RRWA 2B1EA 4IE6A 4OYJA 4ZZBA 2VKJA 4EGWA 5LMNT 1OEDA 2XM1A 5CA1E 3RC3A 1MIYA
chains in the Genus database with same CATH topology
4XTCN 3PV0F 4YMTB 2R6GF 3PUVG 3PUYG 4KI0G 3D31C 3PUVF 3PV0G 3PUZG 4YMSC 4YMWC 2R6GG 3PUYF 3PUZF 4YMUC 4KHZF 3TUZA 4JBWF 4TQUM 3PUWF 4XIGM 4KHZG 3RLFF 4XTCM 4JBWG 4XIGN 3PUWG 3RLFG 4YMVC 4TQUN 3TUJA 3PUXF 3PUXG 2ONKC 3TUIA 4KI0F 3DHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTC N;  3PV0 F;  4YMT B;  2R6G F;  3PUV G;  3PUY G;  4KI0 G;  3D31 C;  3PUV F;  3PV0 G;  3PUZ G;  4YMS C;  4YMW C;  2R6G G;  3PUY F;  3PUZ F;  4YMU C;  4KHZ F;  3TUZ A;  4JBW F;  4TQU M;  3PUW F;  4XIG M;  4KHZ G;  3RLF F;  4XTC M;  4JBW G;  4XIG N;  3PUW G;  3RLF G;  4YMV C;  4TQU N;  3TUJ A;  3PUX F;  3PUX G;  2ONK C;  3TUI A;  4KI0 F;  3DHW A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  3RQU A;  2E9X C;  1CUN A;  3OPC A;  4H63 V;  3RYC E;  3TLU A;  2K24 A;  4UVA B;  5EK2 A;  5IUX A;  4AKH A;  3GN5 B;  2E5L T;  5LG3 A;  2ZM0 A;  1Z0P A;  3FZH B;  2K5B B;  4OYK A;  3ZJ2 A;  4YXD A;  2D9D A;  4YMS C;  2DWG A;  3BQK A;  4GYR A;  2MBG A;  5JRC A;  3QB5 K;  4IE7 A;  4AKR B;  4EYY R;  1HR0 T;  2W66 A;  4HE8 A;  2FJA A;  2LOS A;  3AEF A;  4YFS A;  2PG8 A;  1T8B A;  1US7 B;  2XJ7 A;  3QOF A;  3PUA A;  2J4G A;  2XAQ B;  5AQQ B;  2PFV A;  4IDQ A;  5ABG A;  3V5U A;  4BJM A;  3ZN0 B;  1HFA A;  1W9R A;  1XWM A;  4YMV C;  3N9N A;  1HX1 B;  3E22 E;  1OXZ A;  4TNW A;  4O2A E;  3G06 A;  1CHU A;  3UU6 A;  2V26 A;  5L3B B;  3CML A;  2HPJ A;  1E7P A;  4EEB A;  4ZS3 A;  4JI1 T;  3N5L A;  4N78 D;  2Q9Q D;  3AE3 A;  2PBI A;  3ETU A;  4KX6 A;  3F57 A;  3AE4 A;  4HFB A;  3ZST A;  1IBK T;  3K1S A;  4B3S T;  2BZB A;  4OX9 T;  2E9X A;  3TUI A;  1MIW A;  3PJA J;  5LBQ B;  3TKL B;  1HG5 A;  2C5J A;  4O2B E;  1OED C;  5FVL A;  4UEM A;  5AQU B;  3X1D A;  3K3O A;  3FZK B;  3PU8 A;  3N9L A;  4A98 A;  2QRX A;  2XM2 A;  4GOU A;  3MZK B;  4NXN T;  4PFP A;  4ZZC A;  4YT0 A;  2W67 A;  3PUV F;  2ES0 A;  2KMF A;  5AQT B;  5FY7 A;  4YSY A;  2UXX B;  4LF7 T;  2JQK A;  4OK0 A;  4O8S A;  5FNV E;  2D0U A;  3JAE A;  1XZY A;  4IDO A;  4JI2 T;  1YD8 G;  2UUA T;  3AAI A;  1KNZ A;  1MMD A;  4XIG M;  4IDZ A;  3I9W A;  4AQG A;  2PTF A;  4JI3 T;  3I0Q A;  4UF0 B;  4DVD A;  5KMG P;  2SPC A;  2JQQ A;  4X62 T;  2LE8 A;  4B3T T;  3PUX F;  4IL9 A;  2YDS A;  1JNZ A;  3CX6 B;  3H3M A;  2XQA A;  3QNU A;  4JUY A;  1WRD A;  4U74 A;  4BAY B;  5BMV E;  2V6Y B;  5LXT E;  3OBV E;  4B3M T;  3RIU C;  2VKO A;  3EAB A;  2XQ3 A;  4WZX A;  5IYZ E;  5LJN A;  3LJC A;  4DUY T;  4UR9 A;  4QH5 A;  5LGU B;  2CLY B;  3EI0 A;  3Q5D A;  4PJM A;  3VR9 A;  1L0V A;  4HFE A;  3VU7 H;  3KBT A;  2X9X A;  4KMC A;  3ZSS A;  1T7S A;  3VRA A;  1GQE A;  3KIN B;  4KI0 G;  5LA6 E;  3A7M A;  4PW8 A;  4U2Y A;  3RX6 A;  4KUM B;  4YTM A;  1D0X A;  2RPA A;  1N36 T;  2EHO B;  3P7I A;  5AQL B;  5AQK B;  4UV9 B;  1ZV4 X;  4MAL A;  4U72 A;  2LT3 A;  1BR4 A;  3U78 A;  3OVU A;  3QB5 A;  4EV6 A;  5L4E A;  3I9Y A;  3UFE A;  2BKO A;  2C5K T;  1SHZ C;  2IC9 A;  2WBL A;  2YU2 A;  3EAM A;  3K3Q C;  3L39 A;  2CM0 A;  3RLF F;  4FJO A;  4XTC M;  2E2A A;  4HN9 A;  4H9N C;  3UU4 A;  3IA3 A;  3AB3 B;  2XAJ B;  1D1B A;  2WDQ A;  2K48 A;  2IC6 A;  4QWN B;  1B7T A;  1D1A A;  5J2U E;  3JC6 C;  2DLR A;  2KT9 A;  4UV8 B;  4F6R C;  1HG2 A;  4ILU A;  2VQE T;  2W62 A;  5LHH B;  3KV9 A;  4I0U A;  3A5X A;  2ZM6 T;  1M62 A;  1HS7 A;  2LOP A;  1WYC A;  2I59 A;  3ZPO A;  4TNV A;  2HH7 A;  3UU3 A;  2WMO A;  2D2S A;  3C50 A;  4ZI2 D;  1I6Z A;  3LK3 B;  2LSK A;  3N9M A;  3MKD A;  3O1J A;  4YJ3 E;  3N2G E;  4MFR A;  3UUM A;  4AKL A;  4AIS A;  1AJ3 A;  1WYB A;  4ZI3 D;  2CBJ A;  4TQU M;  1V9D A;  1BR0 A;  4PK5 A;  2VUR A;  4QXB B;  5M4Y A;  1Y01 A;  3HI2 A;  3J7Y q;  3CK6 A;  2FJB A;  4DV7 T;  3CX7 B;  4XIG N;  3T1Y T;  1ZKE A;  3T8O A;  5JRE A;  1XNQ T;  4X5T A;  3AAE B;  4Z91 A;  5HAX A;  4ZI2 C;  4I50 E;  4COF A;  3ZJ1 A;  4CN6 A;  5HEG A;  3SFD A;  2NW7 A;  2WMN A;  4TWH A;  4K0K T;  4BJN A;  1Z8U A;  2GK9 A;  2VVN A;  2A9U A;  2XAG B;  3FBL A;  3OKQ A;  5FXW A;  2NOX A;  3RPU A;  4NUV A;  5A1L A;  4NXM T;  2XHE B;  3SS1 A;  4AQF C;  4C90 A;  1O3X A;  3E08 A;  4GKJ T;  4XTC N;  4Z90 A;  4EED A;  5KX5 E;  4J2C A;  4X65 T;  4AI6 A;  3VKG A;  5GON E;  1M7K A;  5ABF B;  4X1K E;  2H7V C;  5JDL A;  1W0A A;  4DV4 T;  2XUE A;  2Y6X A;  3DJB A;  1MND A;  2V5D A;  1IJ6 A;  2WZH A;  4EYU A;  3OYZ A;  3PUY F;  2LSG A;  4H9O C;  3RH3 A;  2UXN B;  3GMI A;  1KFY A;  2DWK A;  3AE1 A;  4KBM B;  4U2Z A;  3UU5 A;  4EB6 E;  3Q5X A;  3N9P A;  4CI3 B;  4HGA A;  4HWF A;  4AQY T;  5ETW A;  5L3D B;  4LFA T;  4DR4 T;  4YSX A;  3P4R A;  2WM9 A;  4JBW G;  4GK0 E;  5AQS B;  3F31 A;  5HXR A;  3NZQ A;  4KP3 C;  1KNP A;  5JH7 E;  5JDN A;  4JI7 T;  2BS4 A;  2V7I A;  5C3J A;  5L4H A;  2J1D G;  1XNR T;  1Y64 B;  1WR6 A;  4ZI7 E;  3VKH A;  4E7Z A;  1YW0 A;  3SFE A;  3RRC A;  1XMO T;  5HEH A;  1N33 T;  2V6X A;  3LBX A;  2BS2 A;  2KXP B;  2XZE A;  3QK6 A;  3PV0 F;  2NP9 A;  2NTX A;  4OHF A;  3P4S A;  2W4X A;  2VWA A;  3AEE A;  1ZOY A;  3ZMU B;  2KIN B;  3FBZ A;  2LSI A;  5CB4 E;  5HYA A;  3LDQ B;  3PV0 G;  3C51 A;  2AXD S;  4I55 E;  4A5X A;  5DQV A;  3AEA A;  4YMU C;  2V7K A;  1UX5 A;  2W63 A;  2WWV A;  2F4V T;  3AEG A;  5LHG B;  3AA7 B;  3FZF B;  3CPZ A;  4O4H E;  5L47 A;  3JC6 D;  3ABV A;  2HN1 A;  3K3N A;  1HX8 A;  3RF1 A;  3RLF G;  2LHR A;  2W2U A;  4JEH B;  2LRL A;  2Z6E A;  5ADX L;  5LP6 E;  2XQ9 A;  3EUH A;  3L3P A;  2OLT A;  5LGT B;  2A72 A;  2CEA A;  1D0Y A;  4HWI B;  2CXD A;  1BR1 A;  4ZXL A;  2BG9 E;  1NWM X;  4IST A;  1HF8 A;  4KI0 F;  3AEB A;  3VRB A;  5FKY A;  1X79 A;  3MXZ A;  5HWY A;  2B76 A;  4HFH A;  3KVA A;  4OFZ A;  2E8I A;  2BS3 A;  3QUJ A;  4WBN E;  5LMU T;  4QXC B;  5HXC A;  4H9S E;  4ERR A;  1J1J A;  2XSB A;  2VKH A;  3RIF A;  3ONL C;  3AXJ B;  2W61 A;  2WS3 A;  4UVB B;  3AE5 A;  2CXF A;  5AQP B;  4CQI A;  2MAW A;  4DV6 T;  4LF9 T;  2N2N A;  1QSD A;  1W0B A;  4TN7 B;  1KK7 A;  2ZMA A;  2FJE A;  3CWZ B;  4U3C A;  5HXE A;  5HXS A;  4YHH T;  4P09 A;  2Q9Q A;  4X20 E;  4CI2 B;  4DR5 T;  5LG4 A;  4JEU B;  5JDG A;  2D5U A;  2YOE A;  3P8C D;  3KDS E;  4TX5 A;  4ZOL E;  5LOV E;  3TLS A;  5EK3 A;  2RP4 A;  3EHZ A;  5CA0 E;  4EIW A;  5DQW A;  3Q9D A;  2VQF T;  2JPF A;  2OV9 A;  2WQY A;  3PE0 A;  4H9R C;  2IIU A;  5HCJ A;  5AQJ B;  3UTK A;  5L3G B;  1MMN A;  3ZCI A;  4HTE A;  4IHJ E;  5L3C B;  5F3J A;  2ZM2 A;  3MA9 A;  4PJJ A;  3WI3 A;  1UCU A;  2FUP A;  2XAF B;  2C0S A;  2FBW A;  3D31 C;  2LRK A;  5HEU A;  3RHW A;  3SOL A;  3EDV A;  2VK9 A;  4PK6 A;  5L2L A;  3P4P A;  3HL6 A;  1N34 T;  2H3R A;  2HPL A;  3ZCJ A;  4DND A;  4EZH A;  4LFC T;  3BQL A;  2JQH A;  4QKN A;  5FXX A;  5H6Q B;  2NR4 A;  1XDP A;  4CXY A;  3PUW F;  2KLQ A;  2J47 A;  2IML A;  4ILA A;  4JI5 T;  2XAS B;  3CIR A;  2J62 A;  5CFB A;  2XSA A;  3ETV A;  3ZMV B;  5IWA T;  1YQ4 A;  2BDE A;  3TLW A;  2X0Y A;  1UX4 A;  2WWU A;  5LNK A;  2LLY A;  2YIN A;  2LSJ A;  3CQG B;  3LFM A;  4IDN A;  2UUC T;  2WAU A;  4I43 B;  3B57 A;  3Q5E A;  3ZKR A;  4QX8 B;  2QVA A;  3UUL A;  4P0A A;  2H7O A;  3ESL A;  4BA9 A;  4HWD A;  2XTL A;  1WFD A;  3TLV A;  4CZZ B;  2R6G F;  3C4W A;  1QUU A;  2KWH A;  2JMK A;  2N1G A;  2I0M A;  1BR2 A;  3CVR A;  4EOZ B;  5JR9 C;  3R84 B;  3AEC A;  3H37 A;  4IRE A;  2R6G G;  3AE8 A;  3FXE B;  2XY8 B;  5LBM A;  2V5C A;  3TUZ A;  1YQ3 A;  1E1H B;  2WSS V;  5HXH A;  4JYA T;  3PU3 A;  2M67 A;  4UXN B;  5AQF B;  2CLY C;  3LBX B;  4H9Q C;  4JI8 T;  2KZ7 B;  5FL1 A;  4DV5 T;  4CXX A;  4HEA A;  2HHH T;  4U33 A;  4DBQ A;  2JJ9 A;  1G73 A;  4NIQ A;  1LVK A;  2LM9 A;  3IEE A;  1ZHC A;  4ADZ A;  3UT5 E;  4YY3 T;  5EZY E;  3W15 B;  2LEH A;  4LFB T;  2UU9 T;  2UXD T;  1XMQ T;  3HA4 A;  4HWC A;  5JR9 B;  4P1N A;  2JRK A;  2P9B A;  3ANW A;  1XDO A;  4IDP A;  3L09 A;  3ZEF B;  5JQG E;  2CA5 A;  5F5W A;  1OED B;  1LRZ A;  5IHY A;  4DV1 T;  4M1P A;  4YMT B;  4JI0 T;  1VOM A;  3UUX B;  2E5V A;  2XQ4 A;  2RA1 A;  4X1I E;  4DUZ T;  1ZP0 A;  2BBJ A;  4YMW C;  1D1C A;  2CPT A;  2LM2 A;  4LMJ A;  2BKN A;  1N32 T;  3ANW B;  4A56 A;  3KFW X;  4X64 T;  5FP3 A;  3KV6 A;  1HTJ F;  4P0B A;  3VR8 A;  2IDO B;  5C2T A;  3N2O A;  2DL1 A;  2WCA A;  3WAJ A;  3C98 B;  4CXW A;  4PFO A;  4U7Y A;  3UQ4 A;  5CGM A;  2D0T A;  3TUJ A;  3AE2 A;  3I0O A;  2CBI A;  3E0Z A;  3MK7 C;  4YHJ A;  1YXR A;  4TV8 E;  2XQY A;  5E0O A;  4DMW A;  3AAA B;  4MLK A;  2JMH A;  4YJ2 E;  5BR8 T;  2MPK A;  2K3W A;  1WCR A;  2IUB A;  1X9B A;  3HR0 A;  4H9P C;  4PJL A;  3BK9 A;  2WZI A;  1YKH B;  4ANJ A;  1UUS A;  2CCQ A;  1FMV A;  2A3D A;  5AQR B;  2L8K A;  4LF5 T;  4L0R A;  3TLT A;  5LJM A;  3FHN A;  1UUR A;  1G8X A;  3AE7 A;  4K0U A;  4UEL A;  1IBM T;  1QLB A;  4DID B;  2YU1 A;  5HEJ A;  2NWB A;  2LKG A;  2MOZ A;  5FXZ A;  4DR3 T;  2BG9 A;  2LSY A;  1IAP A;  2LJL A;  2ODU A;  2V7L A;  2VL0 A;  3AXJ A;  5LB7 B;  2ODV A;  2MYS A;  4KHP T;  1J5W A;  4HWH A;  3UQ7 A;  3ZC0 A;  2C5I T;  1MNE A;  4IT4 A;  3FB2 A;  4ZEY A;  3RI5 A;  1FEW A;  4UVC B;  2BG9 C;  3B13 A;  2LKH A;  4HFI A;  4DV0 T;  2IHR 1;  2OA5 A;  2NW8 A;  3ZYL A;  4LML A;  3ZT5 A;  2ONK C;  2CE7 A;  1U4Q A;  2WB5 A;  3NBX X;  1S94 A;  4QHO A;  4WW0 A;  3O4X E;  4QH4 A;  3PTR B;  4UIG A;  5JR9 A;  4CI1 B;  4YTP A;  4YLH A;  1YKE B;  5LCY A;  3BQI A;  3LSV A;  4PJN A;  3KVB A;  2QGS A;  3RIA A;  3PUG A;  4AXP A;  3DHW A;  3P50 A;  2CHO A;  2QYW A;  3FZL B;  2ACZ A;  3OJA A;  5FL0 A;  3CX8 B;  2X51 A;  4GIW A;  2CMR A;  4IGU A;  5EK4 A;  5TAO A;  3NZP A;  3U3I A;  2IW5 B;  4ZHQ E;  5JDM A;  3H3A A;  2L3L A;  2ACX A;  2I6H A;  3AED A;  3NKZ A;  5AQN B;  4X1Y E;  2M6B A;  3PUZ G;  5JTG A;  1VCT A;  2V1D B;  4MHC A;  5HWX A;  2WU5 A;  4U7I A;  4U31 A;  5JDQ A;  2BG9 B;  3PDY A;  2XPK A;  3N9Q A;  3ONX A;  2L9Q A;  3ZMZ B;  3AA6 B;  2EHO D;  3UFG A;  4DR2 T;  4HFD A;  2VVS A;  2YDR A;  4DBR A;  2YN6 A;  3F2E A;  2BBH A;  2VL8 A;  3RKO A;  2VB6 A;  3PJA A;  2AE9 A;  3EDU A;  2CWO A;  1JNR A;  3NVO A;  2V6Y A;  3KV5 A;  2X9Y A;  3Q2M A;  3VHL A;  2YEV C;  3C64 A;  3HKD E;  2UXC T;  4TWF A;  5FY1 A;  5FXV A;  2X68 A;  4IE0 A;  1UK5 A;  4B6X A;  1VRB A;  4QH1 A;  3WAK A;  3PUR A;  2QA7 A;  3QC9 A;  3RQW A;  3JAF A;  4A97 A;  2BVM A;  2CXL A;  2DI4 A;  4G2A A;  3GA8 A;  3PUY G;  3PUV G;  3P4Q A;  2A2F X;  3AVR A;  1EZ3 A;  4XBF B;  2DCF A;  2NTY A;  2JQ9 A;  5DJQ C;  4HKA A;  4IE5 A;  2FJD A;  2K9A A;  2X9W A;  3V5S A;  4LF6 T;  5JRC B;  1KEY A;  4FI5 A;  5HEO A;  4EAH A;  5LHI B;  4ILC A;  3GWH A;  3R6N A;  4JBW F;  2Y8D A;  2NW9 A;  2H89 A;  4PAG A;  4GKK T;  3S4U A;  4AIU A;  3N2K E;  4LF4 T;  2M6I A;  2XQ6 A;  1VCS A;  2KSR A;  2WP9 A;  2YK0 A;  2ZM8 A;  3AE9 A;  1IZN B;  3Q5W A;  4ILB A;  4E7S A;  5LYJ E;  2EHO A;  3UU8 A;  1FMW A;  2XAH B;  1UGO A;  2H88 A;  5L3E B;  3KV4 A;  2CRB A;  4TZ4 C;  5H6R B;  2MTQ A;  2EHO C;  4QXH B;  3ZC1 A;  4TWD A;  1MIV A;  2XQ5 A;  3JCF A;  1WLX A;  3UUN A;  4X66 T;  3KBU A;  5AQG B;  4EZ4 A;  5HCM A;  4AQF A;  3IBP A;  3IF8 B;  4C91 A;  2XQ8 A;  4HFC A;  2G0U A;  4XAX B;  5FYM A;  2CHN A;  2YDQ A;  3A8Y C;  1KF6 A;  2ZLY A;  3JAD A;  2E9X D;  2W00 A;  4L9I A;  5DAB A;  2WDR A;  4DMV A;  3SWH A;  5JDF A;  4O4L E;  1HCI A;  4PNI A;  4CN1 A;  4GK5 E;  5C8Y E;  3NRY A;  1FIO A;  3C4Z A;  2Y48 B;  4Q25 A;  4ASK A;  5FMN A;  1E2A A;  5CJ5 A;  3O9X A;  4PK4 A;  3ZMT B;  4V1A v;  2W0G A;  5AQH B;  4KHZ G;  1W09 A;  3RKG A;  4JI4 T;  2PJQ A;  3B5M A;  5FVK A;  3SRZ A;  1NAF A;  3P4W A;  5J2T E;  1SE7 A;  3PUW G;  1IJ5 A;  1H7C A;  3ZYK A;  4TQU N;  3DTO A;  2WDV A;  3NRX A;  4LMK A;  5AFU L;  5FY0 A;  4I4T E;  1HNZ T;  3HKC E;  3UUB A;  4JV5 T;  3MAC A;  3M3Z B;  4IIJ E;  4QX7 B;  4DO0 A;  3AVS A;  3HKE E;  5L3F B;  4B3R T;  2Q9Q C;  1T72 A;  1T98 A;  2V7M A;  3PUS A;  3CKD A;  3AA0 B;  3ZYM A;  3RGL A;  2X0H A;  5JVD E;  3FZM B;  1KNR A;  1ZEE A;  2N9D A;  1J5E T;  3LK2 B;  3RC8 A;  1SA0 E;  2WU2 A;  4WYV A;  4ZS2 A;  3J9X 1;  4GYS A;  1LVF A;  2KND A;  2UUB T;  3CQX C;  2JIW A;  1MMA A;  5KDM C;  3PUZ F;  5J0Z A;  3O1H A;  5AQI B;  4KHZ F;  2E9X B;  2WY2 A;  2KWI B;  3N9O A;  4HFV A;  3RYF E;  3ZN1 B;  3ZT7 A;  1I94 T;  5LGN B;  3EVY A;  3K8P C;  4ISS A;  1SUM B;  3M65 A;  4IL4 A;  3MJX A;  2X67 A;  5J1G A;  1MMG A;  3T1H T;  2X9H A;  4H63 H;  1U5P A;  4JLE A;  3PUX G;  1NEK A;  3CQC B;  3DP7 A;  3NWI A;  4XZC A;  2X0L B;  5ABH A;  1FJG T;  5AQO B;  3PUQ A;  5KXJ A;  4DR7 T;  4EXT A;  1HNX T;  2IAK A;  3RYI E;  4F8H A;  5JDH A;  4AKG A;  2XQ7 A;  4L5G A;  4JI6 T;  5F8P A;  1IBL T;  4O4J E;  3AA1 B;  3GN5 A;  4TV9 E;  2BVL A;  2VAS A;  2CWY A;  4WNK A;  4DR1 T;  3RIU A;  1NEN A;  2UXB T;  4AKI A;  4UF0 A;  2DHR A;  3OYX A;  1WR0 A;  4WBO A;  3RYH E;  2VKD A;  1OWA A;  3ZT6 A;  2X66 A;  4YTN A;  1HNW T;  3ZMS B;  4TUY E;  3O1I A;  3ONJ A;  4IE4 A;  3IHR A;  3LK4 2;  4NPP A;  4O4I E;  4MBQ A;  2YKS A;  2DNX A;  4DR6 T;  3LG7 A;  3OTO T;  2V7J A;  1OED E;  2Q9Q B;  2BKP A;  3L8R A;  3ZLI A;  1R8I A;  4DV2 T;  3FXD B;  4G63 A;  4NUU A;  5ABF A;  1D0Z A;  5AQM B;  3AE6 A;  2HN2 A;  1DU2 A;  3C4X A;  4CN4 A;  4YSZ A;  3HKB E;  4DV3 T;  1S35 A;  5ABE A;  3I1A A;  4LF8 T;  5AQV B;  2LHN A;  2V8S V;  4ZI3 C;  1LKX A;  3D0T A;  3RRW A;  2B1E A;  4IE6 A;  4OYJ A;  4ZZB A;  2VKJ A;  4EGW A;  5LMN T;  1OED A;  2XM1 A;  5CA1 E;  3RC3 A;  1MIY A; 
#chains in the Genus database with same CATH homology
 4XTC N;  3PV0 F;  4YMT B;  2R6G F;  3PUV G;  3PUY G;  4KI0 G;  3D31 C;  3PUV F;  3PV0 G;  3PUZ G;  4YMS C;  4YMW C;  2R6G G;  3PUY F;  3PUZ F;  4YMU C;  4KHZ F;  3TUZ A;  4JBW F;  4TQU M;  3PUW F;  4XIG M;  4KHZ G;  3RLF F;  4XTC M;  4JBW G;  4XIG N;  3PUW G;  3RLF G;  4YMV C;  4TQU N;  3TUJ A;  3PUX F;  3PUX G;  2ONK C;  3TUI A;  4KI0 F;  3DHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...