3RLFF

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 147
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3rlfF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3rlfF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3rlfF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3rlfF02
4YMUC 3RLFG 3PUZF 3PUXG 4TQUN 2ONKC 4KHZF 3D31C 4KI0G 4YMSC 4XTCM 4YMWC 3TUIA 3PV0F 4YMVC 3TUJA 3PUWF 4XIGM 3PUYF 4JBWG 3RLFF 2R6GG 3PUVG 4XTCN 3PUXF 3PUZG 3TUZA 4KI0F 4KHZG 4TQUM 4XIGN 3PV0G 3DHWA 4YMTB 3PUWG 4JBWF 3PUYG 2R6GF 3PUVF
chains in the Genus database with same CATH superfamily
3EAMA 4UXNB 4H9QC 4PAGA 4ILBA 3PUAA 2M6BA 4EOZB 2L9QA 2XM1A 1IBMT 4DMWA 4WZXA 1M62A 3AE3A 1SHZC 3ZEFB 3JC6D 3N9LA 2XAHB 3UU5A 4DUYT 3P4PA 4AKIA 2LRKA 3C64A 1OEDB 3ZN1B 5AQKB 1QUUA 1MNEA 2W66A 4G63A 1T98A 3EI0A 2V8SV 2V5CA 5JREA 4TWHA 3H3AA 5HEUA 4I50E 5FL0A 2LM9A 2YKSA 3L3PA 3SRZA 3KV4A 2X9WA 5C3JA 1HTJF 3A8YC 2IUBA 4K0KT 2K9AA 5LYJE 1CUNA 1IBKT 3AE5A 3GA8A 3HI2A 3QOFA 3SS1A 4KHPT 1HNZT 1IZNB 3LJCA 3RKOA 1KF6A 2WU5A 1ZOYA 1IJ5A 1FIOA 1GQEA 3JAFA 4PK4A 3ZCIA 3AEAA 3RIUC 1WR6A 2E9XA 4C90A 3P4WA 3ZMVB 4U7YA 1WFDA 2CLYB 4QXBB 5JDQA 3H3MA 4YSXA 4QX7B 3ZMTB 1S35A 3B5MA 5BR8T 5DQVA 3SOLA 5LMUT 3UUXB 4EGWA 3D0TA 3GMIA 2VQFT 2VASA 2WCAA 1KFYA 3UTKA 3CX8B 2QGSA 4ISSA 2XAJB 2LHNA 5J2UE 2JQKA 5J1GA 5IWAT 2KWIB 4XTCM 3ZJ2A 3UU4A 4P0BA 5FKYA 3Q2MA 1G8XA 5FXVA 2EHOB 4OK0A 3AA1B 2BS2A 2J47A 2XM2A 5AQIB 1MMNA 2I0MA 4ASKA 3AEFA 2NW7A 3R6NA 1W09A 4KBMB 3PURA 3PUXF 3PUZG 3ZMSB 2LSKA 1HNXT 4KMCA 4QH1A 4NUUA 3C98B 5JR9A 3K1SA 2Z6EA 4LFCT 2EHOD 2VB6A 5LCYA 5AFUL 2WP9A 4DO0A 2F4VT 3K3OA 4YHHT 3NBXX 5F8PA 4JBWF 2DLRA 1MNDA 3PUVF 3UQ4A 2L8KA 1WYCA 5LMNT 5A1LA 4DNDA 4EYYR 5FNVE 4E7SA 5HWXA 4AIUA 2ES0A 4U2ZA 2CMRA 2LM2A 3JAEA 5JVDE 3LBXA 1VCTA 3FB2A 5E0OA 1HG2A 2VKDA 4ADZA 1MIVA 4EXTA 4JI7T 4L0RA 4TV9E 4ZOLE 4XIGN 5L3GB 5BMVE 2XAGB 2XQ5A 5CB4E 4IL9A 2WMOA 3AE9A 2ZM8A 1HS7A 3TLVA 3PJAJ 3H37A 4H9PC 2D9DA 3VRBA 2DWKA 3N9QA 4EV6A 2LSIA 4A98A 4LMLA 2MYSA 2X9XA 3ZN0B 2V6YA 4H9OC 5JDFA 3I1AA 4DV7T 4JV5T 4O4LE 2V7JA 2E9XC 1YXRA 5AQGB 1V9DA 2X51A 2BKNA 3I9WA 4YT0A 4HFHA 5CGMA 2GK9A 4CI1B 3CK6A 4TNWA 4WBNE 2MAWA 1ZV4X 3RRWA 2CXLA 2FBWA 3X1DA 2BG9C 2PG8A 4YSYA 3L39A 3LK3B 3RRCA 1KNRA 4HFEA 4ZI2C 5AQLB 1HX8A 4IE6A 4GOUA 2G0UA 3CKDA 2WBLA 3RX6A 3Q5DA 1X9BA 3W15B 1WCRA 4I0UA 3JCFA 1SE7A 2BZBA 5JDNA 1WYBA 4CI3B 4QHOA 2KLQA 5ABFA 2LRLA 2MPKA 2V7LA 1YD8G 3ZPOA 4HFCA 3PUYG 4JUYA 2D0UA 3I9YA 1KNZA 3ANWA 5C8YE 5IHYA 2KWHA 3L8RA 5CA0E 1XDOA 3VU7H 2RA1A 3MA9A 3K8PC 2XHEB 2LSYA 1HR0T 2NW8A 4NIQA 4LF4T 1UK5A 4ILCA 2DHRA 5L4EA 4DV6T 4ZXLA 2WAUA 2W61A 4AKLA 2KT9A 3KVBA 2WU2A 5JR9C 4AKGA 3CQCB 4CN6A 1FJGT 4JYAT 3M3ZB 1OEDE 3QC9A 2VQET 5FXXA 2DL1A 4HWCA 3A5XA 4ILAA 4I43B 3CX7B 4X5TA 3N5LA 3RYCE 1D0YA 3UU6A 3LDQB 2LHRA 2VKOA 4LF5T 2XAFB 3ZJ1A 2PBIA 2DI4A 4EAHA 4HFVA 4KI0F 3FBLA 5LJMA 3O9XA 2LKHA 2WDRA 4YMTB 3JADA 2R6GF 1SA0E 4JEHB 3U3IA 4MBQA 2CHNA 4YXDA 2ONKC 1UCUA 3KBTA 3NRXA 4A97A 2A9UA 2LE8A 4UF0A 4F8HA 2D2SA 2CCQA 2Y8DA 3C4XA 4HWDA 3C4WA 3ZC0A 3AE8A 1Y64B 3CWZB 1WRDA 4O8SA 2KNDA 4Z8XA 3TLSA 4XIGM 4LFBT 4PNIA 1NENA 4OHFA 1UURA 3ZYLA 2X9YA 4YFSA 4ZHQE 2E8IA 3ZCJA 4DR5T 2ACXA 3LG7A 4OX9T 4YLHA 3FZHB 4X1IE 1UX5A 2RP4A 2YK0A 4U7IA 4LFAT 2XQ4A 3CMLA 2CE7A 1I94T 4U33A 3RF1A 1BR2A 3UU8A 5LNKA 5J0ZA 5EZYE 3MXZA 4Z91A 4UVAB 3A7MA 4YTNA 2CBJA 5H6QB 4NXNT 4AISA 1CHUA 3N9OA 4DV3T 4LF6T 2XQ8A 4H9NC 3QNUA 2ACZA 1U4QA 1XMOT 2A3DA 4OFZA 3Q5EA 5DABA 2V5DA 1D1CA 3V5SA 2XQYA 4XZCA 2QYWA 4ZEYA 3AECA 2XJ7A 3BQIA 3CVRA 4X66T 3HKEE 2Q9QA 4IHJE 3I0QA 3C4ZA 1Z8UA 3J9X1 3P8CD 2LSGA 4N78D 2IW5B 3CIRA 4O2BE 4EZHA 1QSDA 4IDNA 4MLKA 3TUIA 4UVCB 4CQIA 3RH3A 4WBOA 1MMAA 3LFMA 2BBJA 3OVUA 5JH7E 1OWAA 2V26A 5AQQB 1HNWT 1E2AA 2X0LB 1HFAA 3PV0G 3AAAB 1LVKA 3RLFG 4HTEA 1E7PA 5JDHA 4MHCA 4U74A 3F2EA 4HFBA 4IDQA 4CN4A 2DWGA 4DR7T 3K3QC 3PUQA 4TX5A 3HKBE 3K3NA 4ZI3D 3D31C 5L3BB 2QRXA 4PJLA 5HXEA 4KX6A 4UEMA 3TUJA 2IC6A 2IC9A 2JQHA 1NAFA 2HN1A 1HCIA 1WLXA 2E5VA 4HWFA 4ZZCA 4JI3T 4CZZB 2CBIA 3PUXG 4TQUN 1US7B 4PFPA 5EK4A 1UX4A 1T7SA 2XTLA 4WNKA 2E9XB 1T8BA 4TV8E 3EDVA 1ZKEA 3WAJA 1DU2A 5KX5E 3CQXC 4PJJA 2BG9B 3M65A 4TZ4C 3KBUA 2H7OA 3PU8A 4IDOA 1JNZA 4JBWG 2CWYA 3T1YT 5AQFB 3RYHE 3HA4A 4EEDA 4UR9A 2KZ7B 1AJ3A 4L9IA 4PJMA 5L3EB 4OYJA 3R84B 2FJBA 3OPCA 3BQKA 2XSAA 5AQTB 4UVBB 1IAPA 2W0GA 3N2GE 3TUZA 4DR4T 3AA6B 1YW0A 3UFEA 3ZMUB 3P50A 1W0AA 3G06A 1D0XA 4JI5T 3P4QA 3E22E 4HFDA 3PJAA 2BVMA 4EZ4A 3P7IA 1G73A 3FXEB 5FYMA 4GK5E 5JR9B 2Q9QC 2EHOA 1QLBA 4DV1T 4DBQA 3ETVA 2YDSA 2ZLYA 2HHHT 2JRKA 4IE0A 3AAEB 4O4IE 2NR4A 1LRZA 2JQQA 3EHZA 3PUGA 3JC6C 3N9PA 2UXNB 3ZYMA 3WI3A 4NPPA 5L47A 2XQ9A 4AKRB 2M6IA 2YOEA 4IE5A 1JNRA 1WR0A 2X0HA 4B6XA 1D0ZA 4J2CA 2AE9A 2WDQA 2CM0A 2X0YA 5GONE 3KV6A 2KMFA 3AA0B 5LHGB 4LF7T 2LSJA 3V5UA 2BBHA 3UUMA 2Y48B 3EABA 5HCJA 5CA1E 4BA9A 1ZHCA 4UV9B 4EIWA 4YTMA 4B3ST 2ODVA 2NWBA 4QKNA 3AE2A 1IJ6A 4GKJT 4BJMA 3FZLB 2V6YB 1UUSA 3TLUA 4DR1T 4PW8A 4TQUM 3IEEA 1N36T 1XNRT 2MOZA 3LK42 4IREA 3PUZF 3VHLA 1H7CA 3ETUA 4IL4A 4X62T 1YQ4A 2X67A 3PDYA 2K24A 5TAOA 3RPUA 2W62A 2UUBT 3MACA 1M7KA 4AQFA 4FJOA 5FXZA 4X64T 4HFIA 3ABVA 2DCFA 1R8IA 3DP7A 3HR0A 5M4YA 5ABFB 3EDUA 5AQSB 1XMQT 3AE1A 1MMGA 4OYKA 5CFBA 3DTOA 5HAXA 5HXHA 3ANWB 4YMUC 4LMKA 4ZS2A 4P09A 4HE8A 4AKHA 3PTRB 3OTOT 5JDLA 4HWHA 3O1JA 2JJ9A 4Q25A 1D1AA 3QB5A 5IUXA 2I6HA 1Z0PA 1T72A 3UUNA 3CQGB 2W00A 1NEKA 1ZEEA 2XQ7A 4U2YA 2WS3A 3KINB 2FJDA 2IAKA 2LEHA 3PUWG 3RGLA 3B57A 3NRYA 3HKDE 1XDPA 4HWIB 2QVAA 2WQYA 5AQHB 4ERRA 2CEAA 3ZLIA 2FJAA 2YU1A 2MTQA 2C5IT 2JPFA 3VKHA 4IE4A 4YHJA 4X65T 2X9HA 3ONJA 2KSRA 2CXFA 2VVNA 4M1PA 2UU9T 3AXJA 3KDSE 2XQAA 5HEGA 4UF0B 4B3TT 3AEEA 2HPLA 3OKQA 3IF8B 2P9BA 2XUEA 4X1KE 5L3CB 4TN7B 2HN2A 2LLYA 3N2KE 2RPAA 5AQOB 3AEDA 2LOPA 4O2AE 1YQ3A 5JRCA 3HKCE 4K0UA 5FXWA 3GN5B 5HCMA 4YMWC 2DNXA 1FMWA 2BG9E 2PJQA 3PUYF 3RYFE 2WMNA 3AEGA 2UUAT 2A2FX 4DBRA 4DR3T 2FUPA 3ZYKA 2LOSA 2WZIA 5AQUB 3NZPA 4PFOA 3RYIE 4GK0E 2AXDS 3FZKB 2VK9A 3QUJA 2KINB 3TKLB 4CI2B 2NTYA 1NWMX 2H3RA 5ABEA 5ETWA 4JI4T 4ISTA 4ZI7E 1XNQT 2XQ6A 4AQFC 5LB7B 2XQ3A 3AVSA 1YKHB 3NZQA 2JIWA 2BS4A 3L09A 2N9DA 2Q9QB 3RI5A 4KHZF 2UXDT 5AQNB 4FI5A 2D0TA 5FL1A 3AE7A 4HGAA 4H9SE 5DQWA 4IE7A 4COFA 5EK2A 2H88A 2YDRA 2E2AA 2CA5A 3ZT7A 2VKHA 5JQGE 3MKDA 4QH5A 2V7MA 5LBMA 5JDMA 1BR0A 4DV2T 1SUMB 2V6XA 2VKJA 3OJAA 2X68A 4AI6A 4LMJA 2BS3A 4QWNB 5FY0A 2PTFA 3KVAA 2VURA 3CX6B 4CN1A 4H63V 3VR9A 3OYXA 4TWFA 3NVOA 4JI0T 2D5UA 3C51A 1KEYA 4PK6A 3BQLA 4CXXA 5ABHA 1N33T 2LJLA 1KNPA 3AEBA 2J4GA 3RKGA 1MIWA 2WY2A 5LGNB 2XZEA 5C2TA 4IT4A 2XAQB 1N34T 5KDMC 2OV9A 4A56A 2KXPB 3ZSTA 3P4RA 2YEVC 1MIYA 2YINA 5IYZE 3TLTA 4XBFB 1OEDA 1J5ET 4AQYT 4G2AA 1I6ZA 2XY8B 4U31A 5L2LA 4O4JE 2XASB 4QX8B 5HYAA 4B3RT 2NOXA 3FZFB 3OBVE 4KP3C 2E5LT 2IIUA 2C0SA 5HXRA 5LXTE 3DJBA 2MBGA 4O4HE 2UUCT 2A72A 1KK7A 1J1JA 3LSVA 3LK2B 5J2TE 2N1GA 5L3FB 3Q5WA 4I55E 2BDEA 2W2UA 2YN6A 4IDZA 3PUVG 5AQMB 3AE6A 2E9XD 3UU3A 3SFEA 4E7ZA 5LG4A 3NKZA 4B3MT 3QB5K 5H6RB 2BG9A 4AXPA 3PV0F 2K48A 3ESLA 1VOMA 3N9MA 2H89A 3RLFF 1HX1B 2VL8A 2ZM6T 4ZI2D 5HEJA 4DV5T 4YTPA 4NUVA 3CPZA 1EZ3A 3MZKB 4YJ2E 1B7TA 4JLEA 3ZT5A 4A5XA 4YMSC 2WM9A 5FY7A 3E0ZA 2UXCT 3EUHA 5FP3A 4EEBA 2PFVA 1UGOA 2H7VC 4EB6E 3F57A 3IBPA 4ZS3A 1N32T 4H9RC 4DV0T 4UIGA 2JMKA 4X20E 3RQUA 3RIFA 2B76A 2W4XA 3OYZA 3PU3A 3EVYA 5ABGA 4XAXB 4HKAA 3ZSSA 4F6RC 4BJNA 2WDVA 3LBXB 2ZM2A 4NXMT 2V7KA 3AVRA 4DV4T 2C5JA 2V7IA 2LKGA 1L0VA 1BR1A 4YSZA 3PUSA 2BKPA 4V1Av 5LGTB 3KV9A 5L3DB 2NW9A 3FZMB 4DUZT 1D1BA 1OXZA 2N2NA 2WWVA 3P4SA 4ZI3C 2X66A 4YMVC 2FJEA 2WSSV 3MJXA 2B1EA 1LVFA 4CXYA 4YY3T 3UFGA 1FEWA 4IDPA 3VKGA 4EYUA 1OEDC 5F5WA 2CRBA 3O4XE 4P1NA 4DIDB 2YU2A 4HN9A 4U72A 3U78A 5AQVB 4HEAA 4H63H 3C50A 2HPJA 4KUMB 3O1HA 2BVLA 3RC3A 3ONLC 2K3WA 3T8OA 4UV8B 1FMVA 2ODUA 5AQPB 5FVKA 2UXXB 3ZC1A 5FMNA 5JTGA 5F3JA 2L3LA 4IGUA 2LT3A 3FHNA 5LP6E 4MALA 3BK9A 5DJQC 4QH4A 4ZZBA 4KI0G 2Y6XA 2CLYC 2HH7A 1W0BA 3KFWX 5LOVE 3S4UA 2VVSA 2R6GG 2CXDA 3AAIA 2W67A 3E08A 4JI1T 2J1DG 1IBLT 2XSBA 2OA5A 4IIJE 3F31A 4LF9T 2ZM0A 2VL0A 2W63A 2CHOA 2J62A 3RQWA 2NP9A 2YDQA 4TUYE 3MK7C 3TLWA 3ZMZB 1S94A 2EHOC 4I4TE 5L4HA 1MMDA 3DHWA 2ZMAA 4JI2T 5HXCA 3UULA 4BAYB 2C5KT 5HEOA 5EK3A 4GYRA 4MFRA 3FXDB 4UELA 5CJ5A 1E1HB 3AXJB 4DMVA 1HF8A 1X79A 4ANJA 4Z90A 3SWHA 2BKOA 3N2OA 3WAKA 3KV5A 4JEUB 5HWYA 5LBQB 3J7Yq 1ZP0A 2XPKA 4KHZG 2IDOB 2NTXA 2WZHA 5JRCB 1XZYA 3RIAA 2OLTA 3UUBA 4P0AA 3T1HT 3ZT6A 2IMLA 4X1YE 3Q9DA 5AQJB 4DVDA 5HEHA 5KXJA 1VRBA 2CWOA 4C91A 1LKXA 3IA3A 3N9NA 4WYVA 4QXCB 3RIUA 4CXWA 1BR4A 4JI8T 2VWAA 1O3XA 3GN5A 3Q5XA 4GYSA 1W9RA 3UQ7A 5FVLA 2JQ9A 4TWDA 4LF8T 3ZKRA 4PK5A 4DR6T 3ONXA 3IHRA 5LHHB 3PUWF 3AA7B 3VRAA 2WWUA 4XTCN 4ILUA 3B13A 4AQGA 4DR2T 5ADXL 1YKEB 2I59A 4WW0A 4GKKT 5KMGP 2V1DB 5LA6E 5LJNA 4JI6T 3I0OA 5LG3A 3UT5E 1HG5A 3NWIA 5JDGA 2QA7A 3AB3B 3AE4A 2JMHA 1VCSA 2K5BB 2UXBT 4PJNA 2WB5A 5HXSA 2SPCA 3SFDA 5LGUB 1Y01A 4L5GA 3O1IA 5FY1A 5LHIB 3RHWA 3HL6A 4QXHB 1J5WA 4GIWA 2M67A 1U5PA 2IHR1 2CPTA 3PE0A 4YJ3E 3VR8A 4TNVA 1XWMA 3GWHA 2Q9QD 3RC8A 3FBZA 5AQRB 3QK6A 4U3CA
chains in the Genus database with same CATH topology
4YMUC 3RLFG 3PUZF 3PUXG 4TQUN 2ONKC 4KHZF 3D31C 4KI0G 4YMSC 4XTCM 4YMWC 3TUIA 3PV0F 4YMVC 3TUJA 3PUWF 4XIGM 3PUYF 4JBWG 3RLFF 2R6GG 3PUVG 4XTCN 3PUXF 3PUZG 3TUZA 4KI0F 4KHZG 4TQUM 4XIGN 3PV0G 3DHWA 4YMTB 3PUWG 4JBWF 3PUYG 2R6GF 3PUVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMU C;  3RLF G;  3PUZ F;  3PUX G;  4TQU N;  2ONK C;  4KHZ F;  3D31 C;  4KI0 G;  4YMS C;  4XTC M;  4YMW C;  3TUI A;  3PV0 F;  4YMV C;  3TUJ A;  3PUW F;  4XIG M;  3PUY F;  4JBW G;  3RLF F;  2R6G G;  3PUV G;  4XTC N;  3PUX F;  3PUZ G;  3TUZ A;  4KI0 F;  4KHZ G;  4TQU M;  4XIG N;  3PV0 G;  3DHW A;  4YMT B;  3PUW G;  4JBW F;  3PUY G;  2R6G F;  3PUV F; 
#chains in the Genus database with same CATH topology
 3EAM A;  4UXN B;  4H9Q C;  4PAG A;  4ILB A;  3PUA A;  2M6B A;  4EOZ B;  2L9Q A;  2XM1 A;  1IBM T;  4DMW A;  4WZX A;  1M62 A;  3AE3 A;  1SHZ C;  3ZEF B;  3JC6 D;  3N9L A;  2XAH B;  3UU5 A;  4DUY T;  3P4P A;  4AKI A;  2LRK A;  3C64 A;  1OED B;  3ZN1 B;  5AQK B;  1QUU A;  1MNE A;  2W66 A;  4G63 A;  1T98 A;  3EI0 A;  2V8S V;  2V5C A;  5JRE A;  4TWH A;  3H3A A;  5HEU A;  4I50 E;  5FL0 A;  2LM9 A;  2YKS A;  3L3P A;  3SRZ A;  3KV4 A;  2X9W A;  5C3J A;  1HTJ F;  3A8Y C;  2IUB A;  4K0K T;  2K9A A;  5LYJ E;  1CUN A;  1IBK T;  3AE5 A;  3GA8 A;  3HI2 A;  3QOF A;  3SS1 A;  4KHP T;  1HNZ T;  1IZN B;  3LJC A;  3RKO A;  1KF6 A;  2WU5 A;  1ZOY A;  1IJ5 A;  1FIO A;  1GQE A;  3JAF A;  4PK4 A;  3ZCI A;  3AEA A;  3RIU C;  1WR6 A;  2E9X A;  4C90 A;  3P4W A;  3ZMV B;  4U7Y A;  1WFD A;  2CLY B;  4QXB B;  5JDQ A;  3H3M A;  4YSX A;  4QX7 B;  3ZMT B;  1S35 A;  3B5M A;  5BR8 T;  5DQV A;  3SOL A;  5LMU T;  3UUX B;  4EGW A;  3D0T A;  3GMI A;  2VQF T;  2VAS A;  2WCA A;  1KFY A;  3UTK A;  3CX8 B;  2QGS A;  4ISS A;  2XAJ B;  2LHN A;  5J2U E;  2JQK A;  5J1G A;  5IWA T;  2KWI B;  4XTC M;  3ZJ2 A;  3UU4 A;  4P0B A;  5FKY A;  3Q2M A;  1G8X A;  5FXV A;  2EHO B;  4OK0 A;  3AA1 B;  2BS2 A;  2J47 A;  2XM2 A;  5AQI B;  1MMN A;  2I0M A;  4ASK A;  3AEF A;  2NW7 A;  3R6N A;  1W09 A;  4KBM B;  3PUR A;  3PUX F;  3PUZ G;  3ZMS B;  2LSK A;  1HNX T;  4KMC A;  4QH1 A;  4NUU A;  3C98 B;  5JR9 A;  3K1S A;  2Z6E A;  4LFC T;  2EHO D;  2VB6 A;  5LCY A;  5AFU L;  2WP9 A;  4DO0 A;  2F4V T;  3K3O A;  4YHH T;  3NBX X;  5F8P A;  4JBW F;  2DLR A;  1MND A;  3PUV F;  3UQ4 A;  2L8K A;  1WYC A;  5LMN T;  5A1L A;  4DND A;  4EYY R;  5FNV E;  4E7S A;  5HWX A;  4AIU A;  2ES0 A;  4U2Z A;  2CMR A;  2LM2 A;  3JAE A;  5JVD E;  3LBX A;  1VCT A;  3FB2 A;  5E0O A;  1HG2 A;  2VKD A;  4ADZ A;  1MIV A;  4EXT A;  4JI7 T;  4L0R A;  4TV9 E;  4ZOL E;  4XIG N;  5L3G B;  5BMV E;  2XAG B;  2XQ5 A;  5CB4 E;  4IL9 A;  2WMO A;  3AE9 A;  2ZM8 A;  1HS7 A;  3TLV A;  3PJA J;  3H37 A;  4H9P C;  2D9D A;  3VRB A;  2DWK A;  3N9Q A;  4EV6 A;  2LSI A;  4A98 A;  4LML A;  2MYS A;  2X9X A;  3ZN0 B;  2V6Y A;  4H9O C;  5JDF A;  3I1A A;  4DV7 T;  4JV5 T;  4O4L E;  2V7J A;  2E9X C;  1YXR A;  5AQG B;  1V9D A;  2X51 A;  2BKN A;  3I9W A;  4YT0 A;  4HFH A;  5CGM A;  2GK9 A;  4CI1 B;  3CK6 A;  4TNW A;  4WBN E;  2MAW A;  1ZV4 X;  3RRW A;  2CXL A;  2FBW A;  3X1D A;  2BG9 C;  2PG8 A;  4YSY A;  3L39 A;  3LK3 B;  3RRC A;  1KNR A;  4HFE A;  4ZI2 C;  5AQL B;  1HX8 A;  4IE6 A;  4GOU A;  2G0U A;  3CKD A;  2WBL A;  3RX6 A;  3Q5D A;  1X9B A;  3W15 B;  1WCR A;  4I0U A;  3JCF A;  1SE7 A;  2BZB A;  5JDN A;  1WYB A;  4CI3 B;  4QHO A;  2KLQ A;  5ABF A;  2LRL A;  2MPK A;  2V7L A;  1YD8 G;  3ZPO A;  4HFC A;  3PUY G;  4JUY A;  2D0U A;  3I9Y A;  1KNZ A;  3ANW A;  5C8Y E;  5IHY A;  2KWH A;  3L8R A;  5CA0 E;  1XDO A;  3VU7 H;  2RA1 A;  3MA9 A;  3K8P C;  2XHE B;  2LSY A;  1HR0 T;  2NW8 A;  4NIQ A;  4LF4 T;  1UK5 A;  4ILC A;  2DHR A;  5L4E A;  4DV6 T;  4ZXL A;  2WAU A;  2W61 A;  4AKL A;  2KT9 A;  3KVB A;  2WU2 A;  5JR9 C;  4AKG A;  3CQC B;  4CN6 A;  1FJG T;  4JYA T;  3M3Z B;  1OED E;  3QC9 A;  2VQE T;  5FXX A;  2DL1 A;  4HWC A;  3A5X A;  4ILA A;  4I43 B;  3CX7 B;  4X5T A;  3N5L A;  3RYC E;  1D0Y A;  3UU6 A;  3LDQ B;  2LHR A;  2VKO A;  4LF5 T;  2XAF B;  3ZJ1 A;  2PBI A;  2DI4 A;  4EAH A;  4HFV A;  4KI0 F;  3FBL A;  5LJM A;  3O9X A;  2LKH A;  2WDR A;  4YMT B;  3JAD A;  2R6G F;  1SA0 E;  4JEH B;  3U3I A;  4MBQ A;  2CHN A;  4YXD A;  2ONK C;  1UCU A;  3KBT A;  3NRX A;  4A97 A;  2A9U A;  2LE8 A;  4UF0 A;  4F8H A;  2D2S A;  2CCQ A;  2Y8D A;  3C4X A;  4HWD A;  3C4W A;  3ZC0 A;  3AE8 A;  1Y64 B;  3CWZ B;  1WRD A;  4O8S A;  2KND A;  4Z8X A;  3TLS A;  4XIG M;  4LFB T;  4PNI A;  1NEN A;  4OHF A;  1UUR A;  3ZYL A;  2X9Y A;  4YFS A;  4ZHQ E;  2E8I A;  3ZCJ A;  4DR5 T;  2ACX A;  3LG7 A;  4OX9 T;  4YLH A;  3FZH B;  4X1I E;  1UX5 A;  2RP4 A;  2YK0 A;  4U7I A;  4LFA T;  2XQ4 A;  3CML A;  2CE7 A;  1I94 T;  4U33 A;  3RF1 A;  1BR2 A;  3UU8 A;  5LNK A;  5J0Z A;  5EZY E;  3MXZ A;  4Z91 A;  4UVA B;  3A7M A;  4YTN A;  2CBJ A;  5H6Q B;  4NXN T;  4AIS A;  1CHU A;  3N9O A;  4DV3 T;  4LF6 T;  2XQ8 A;  4H9N C;  3QNU A;  2ACZ A;  1U4Q A;  1XMO T;  2A3D A;  4OFZ A;  3Q5E A;  5DAB A;  2V5D A;  1D1C A;  3V5S A;  2XQY A;  4XZC A;  2QYW A;  4ZEY A;  3AEC A;  2XJ7 A;  3BQI A;  3CVR A;  4X66 T;  3HKE E;  2Q9Q A;  4IHJ E;  3I0Q A;  3C4Z A;  1Z8U A;  3J9X 1;  3P8C D;  2LSG A;  4N78 D;  2IW5 B;  3CIR A;  4O2B E;  4EZH A;  1QSD A;  4IDN A;  4MLK A;  3TUI A;  4UVC B;  4CQI A;  3RH3 A;  4WBO A;  1MMA A;  3LFM A;  2BBJ A;  3OVU A;  5JH7 E;  1OWA A;  2V26 A;  5AQQ B;  1HNW T;  1E2A A;  2X0L B;  1HFA A;  3PV0 G;  3AAA B;  1LVK A;  3RLF G;  4HTE A;  1E7P A;  5JDH A;  4MHC A;  4U74 A;  3F2E A;  4HFB A;  4IDQ A;  4CN4 A;  2DWG A;  4DR7 T;  3K3Q C;  3PUQ A;  4TX5 A;  3HKB E;  3K3N A;  4ZI3 D;  3D31 C;  5L3B B;  2QRX A;  4PJL A;  5HXE A;  4KX6 A;  4UEM A;  3TUJ A;  2IC6 A;  2IC9 A;  2JQH A;  1NAF A;  2HN1 A;  1HCI A;  1WLX A;  2E5V A;  4HWF A;  4ZZC A;  4JI3 T;  4CZZ B;  2CBI A;  3PUX G;  4TQU N;  1US7 B;  4PFP A;  5EK4 A;  1UX4 A;  1T7S A;  2XTL A;  4WNK A;  2E9X B;  1T8B A;  4TV8 E;  3EDV A;  1ZKE A;  3WAJ A;  1DU2 A;  5KX5 E;  3CQX C;  4PJJ A;  2BG9 B;  3M65 A;  4TZ4 C;  3KBU A;  2H7O A;  3PU8 A;  4IDO A;  1JNZ A;  4JBW G;  2CWY A;  3T1Y T;  5AQF B;  3RYH E;  3HA4 A;  4EED A;  4UR9 A;  2KZ7 B;  1AJ3 A;  4L9I A;  4PJM A;  5L3E B;  4OYJ A;  3R84 B;  2FJB A;  3OPC A;  3BQK A;  2XSA A;  5AQT B;  4UVB B;  1IAP A;  2W0G A;  3N2G E;  3TUZ A;  4DR4 T;  3AA6 B;  1YW0 A;  3UFE A;  3ZMU B;  3P50 A;  1W0A A;  3G06 A;  1D0X A;  4JI5 T;  3P4Q A;  3E22 E;  4HFD A;  3PJA A;  2BVM A;  4EZ4 A;  3P7I A;  1G73 A;  3FXE B;  5FYM A;  4GK5 E;  5JR9 B;  2Q9Q C;  2EHO A;  1QLB A;  4DV1 T;  4DBQ A;  3ETV A;  2YDS A;  2ZLY A;  2HHH T;  2JRK A;  4IE0 A;  3AAE B;  4O4I E;  2NR4 A;  1LRZ A;  2JQQ A;  3EHZ A;  3PUG A;  3JC6 C;  3N9P A;  2UXN B;  3ZYM A;  3WI3 A;  4NPP A;  5L47 A;  2XQ9 A;  4AKR B;  2M6I A;  2YOE A;  4IE5 A;  1JNR A;  1WR0 A;  2X0H A;  4B6X A;  1D0Z A;  4J2C A;  2AE9 A;  2WDQ A;  2CM0 A;  2X0Y A;  5GON E;  3KV6 A;  2KMF A;  3AA0 B;  5LHG B;  4LF7 T;  2LSJ A;  3V5U A;  2BBH A;  3UUM A;  2Y48 B;  3EAB A;  5HCJ A;  5CA1 E;  4BA9 A;  1ZHC A;  4UV9 B;  4EIW A;  4YTM A;  4B3S T;  2ODV A;  2NWB A;  4QKN A;  3AE2 A;  1IJ6 A;  4GKJ T;  4BJM A;  3FZL B;  2V6Y B;  1UUS A;  3TLU A;  4DR1 T;  4PW8 A;  4TQU M;  3IEE A;  1N36 T;  1XNR T;  2MOZ A;  3LK4 2;  4IRE A;  3PUZ F;  3VHL A;  1H7C A;  3ETU A;  4IL4 A;  4X62 T;  1YQ4 A;  2X67 A;  3PDY A;  2K24 A;  5TAO A;  3RPU A;  2W62 A;  2UUB T;  3MAC A;  1M7K A;  4AQF A;  4FJO A;  5FXZ A;  4X64 T;  4HFI A;  3ABV A;  2DCF A;  1R8I A;  3DP7 A;  3HR0 A;  5M4Y A;  5ABF B;  3EDU A;  5AQS B;  1XMQ T;  3AE1 A;  1MMG A;  4OYK A;  5CFB A;  3DTO A;  5HAX A;  5HXH A;  3ANW B;  4YMU C;  4LMK A;  4ZS2 A;  4P09 A;  4HE8 A;  4AKH A;  3PTR B;  3OTO T;  5JDL A;  4HWH A;  3O1J A;  2JJ9 A;  4Q25 A;  1D1A A;  3QB5 A;  5IUX A;  2I6H A;  1Z0P A;  1T72 A;  3UUN A;  3CQG B;  2W00 A;  1NEK A;  1ZEE A;  2XQ7 A;  4U2Y A;  2WS3 A;  3KIN B;  2FJD A;  2IAK A;  2LEH A;  3PUW G;  3RGL A;  3B57 A;  3NRY A;  3HKD E;  1XDP A;  4HWI B;  2QVA A;  2WQY A;  5AQH B;  4ERR A;  2CEA A;  3ZLI A;  2FJA A;  2YU1 A;  2MTQ A;  2C5I T;  2JPF A;  3VKH A;  4IE4 A;  4YHJ A;  4X65 T;  2X9H A;  3ONJ A;  2KSR A;  2CXF A;  2VVN A;  4M1P A;  2UU9 T;  3AXJ A;  3KDS E;  2XQA A;  5HEG A;  4UF0 B;  4B3T T;  3AEE A;  2HPL A;  3OKQ A;  3IF8 B;  2P9B A;  2XUE A;  4X1K E;  5L3C B;  4TN7 B;  2HN2 A;  2LLY A;  3N2K E;  2RPA A;  5AQO B;  3AED A;  2LOP A;  4O2A E;  1YQ3 A;  5JRC A;  3HKC E;  4K0U A;  5FXW A;  3GN5 B;  5HCM A;  4YMW C;  2DNX A;  1FMW A;  2BG9 E;  2PJQ A;  3PUY F;  3RYF E;  2WMN A;  3AEG A;  2UUA T;  2A2F X;  4DBR A;  4DR3 T;  2FUP A;  3ZYK A;  2LOS A;  2WZI A;  5AQU B;  3NZP A;  4PFO A;  3RYI E;  4GK0 E;  2AXD S;  3FZK B;  2VK9 A;  3QUJ A;  2KIN B;  3TKL B;  4CI2 B;  2NTY A;  1NWM X;  2H3R A;  5ABE A;  5ETW A;  4JI4 T;  4IST A;  4ZI7 E;  1XNQ T;  2XQ6 A;  4AQF C;  5LB7 B;  2XQ3 A;  3AVS A;  1YKH B;  3NZQ A;  2JIW A;  2BS4 A;  3L09 A;  2N9D A;  2Q9Q B;  3RI5 A;  4KHZ F;  2UXD T;  5AQN B;  4FI5 A;  2D0T A;  5FL1 A;  3AE7 A;  4HGA A;  4H9S E;  5DQW A;  4IE7 A;  4COF A;  5EK2 A;  2H88 A;  2YDR A;  2E2A A;  2CA5 A;  3ZT7 A;  2VKH A;  5JQG E;  3MKD A;  4QH5 A;  2V7M A;  5LBM A;  5JDM A;  1BR0 A;  4DV2 T;  1SUM B;  2V6X A;  2VKJ A;  3OJA A;  2X68 A;  4AI6 A;  4LMJ A;  2BS3 A;  4QWN B;  5FY0 A;  2PTF A;  3KVA A;  2VUR A;  3CX6 B;  4CN1 A;  4H63 V;  3VR9 A;  3OYX A;  4TWF A;  3NVO A;  4JI0 T;  2D5U A;  3C51 A;  1KEY A;  4PK6 A;  3BQL A;  4CXX A;  5ABH A;  1N33 T;  2LJL A;  1KNP A;  3AEB A;  2J4G A;  3RKG A;  1MIW A;  2WY2 A;  5LGN B;  2XZE A;  5C2T A;  4IT4 A;  2XAQ B;  1N34 T;  5KDM C;  2OV9 A;  4A56 A;  2KXP B;  3ZST A;  3P4R A;  2YEV C;  1MIY A;  2YIN A;  5IYZ E;  3TLT A;  4XBF B;  1OED A;  1J5E T;  4AQY T;  4G2A A;  1I6Z A;  2XY8 B;  4U31 A;  5L2L A;  4O4J E;  2XAS B;  4QX8 B;  5HYA A;  4B3R T;  2NOX A;  3FZF B;  3OBV E;  4KP3 C;  2E5L T;  2IIU A;  2C0S A;  5HXR A;  5LXT E;  3DJB A;  2MBG A;  4O4H E;  2UUC T;  2A72 A;  1KK7 A;  1J1J A;  3LSV A;  3LK2 B;  5J2T E;  2N1G A;  5L3F B;  3Q5W A;  4I55 E;  2BDE A;  2W2U A;  2YN6 A;  4IDZ A;  3PUV G;  5AQM B;  3AE6 A;  2E9X D;  3UU3 A;  3SFE A;  4E7Z A;  5LG4 A;  3NKZ A;  4B3M T;  3QB5 K;  5H6R B;  2BG9 A;  4AXP A;  3PV0 F;  2K48 A;  3ESL A;  1VOM A;  3N9M A;  2H89 A;  3RLF F;  1HX1 B;  2VL8 A;  2ZM6 T;  4ZI2 D;  5HEJ A;  4DV5 T;  4YTP A;  4NUV A;  3CPZ A;  1EZ3 A;  3MZK B;  4YJ2 E;  1B7T A;  4JLE A;  3ZT5 A;  4A5X A;  4YMS C;  2WM9 A;  5FY7 A;  3E0Z A;  2UXC T;  3EUH A;  5FP3 A;  4EEB A;  2PFV A;  1UGO A;  2H7V C;  4EB6 E;  3F57 A;  3IBP A;  4ZS3 A;  1N32 T;  4H9R C;  4DV0 T;  4UIG A;  2JMK A;  4X20 E;  3RQU A;  3RIF A;  2B76 A;  2W4X A;  3OYZ A;  3PU3 A;  3EVY A;  5ABG A;  4XAX B;  4HKA A;  3ZSS A;  4F6R C;  4BJN A;  2WDV A;  3LBX B;  2ZM2 A;  4NXM T;  2V7K A;  3AVR A;  4DV4 T;  2C5J A;  2V7I A;  2LKG A;  1L0V A;  1BR1 A;  4YSZ A;  3PUS A;  2BKP A;  4V1A v;  5LGT B;  3KV9 A;  5L3D B;  2NW9 A;  3FZM B;  4DUZ T;  1D1B A;  1OXZ A;  2N2N A;  2WWV A;  3P4S A;  4ZI3 C;  2X66 A;  4YMV C;  2FJE A;  2WSS V;  3MJX A;  2B1E A;  1LVF A;  4CXY A;  4YY3 T;  3UFG A;  1FEW A;  4IDP A;  3VKG A;  4EYU A;  1OED C;  5F5W A;  2CRB A;  3O4X E;  4P1N A;  4DID B;  2YU2 A;  4HN9 A;  4U72 A;  3U78 A;  5AQV B;  4HEA A;  4H63 H;  3C50 A;  2HPJ A;  4KUM B;  3O1H A;  2BVL A;  3RC3 A;  3ONL C;  2K3W A;  3T8O A;  4UV8 B;  1FMV A;  2ODU A;  5AQP B;  5FVK A;  2UXX B;  3ZC1 A;  5FMN A;  5JTG A;  5F3J A;  2L3L A;  4IGU A;  2LT3 A;  3FHN A;  5LP6 E;  4MAL A;  3BK9 A;  5DJQ C;  4QH4 A;  4ZZB A;  4KI0 G;  2Y6X A;  2CLY C;  2HH7 A;  1W0B A;  3KFW X;  5LOV E;  3S4U A;  2VVS A;  2R6G G;  2CXD A;  3AAI A;  2W67 A;  3E08 A;  4JI1 T;  2J1D G;  1IBL T;  2XSB A;  2OA5 A;  4IIJ E;  3F31 A;  4LF9 T;  2ZM0 A;  2VL0 A;  2W63 A;  2CHO A;  2J62 A;  3RQW A;  2NP9 A;  2YDQ A;  4TUY E;  3MK7 C;  3TLW A;  3ZMZ B;  1S94 A;  2EHO C;  4I4T E;  5L4H A;  1MMD A;  3DHW A;  2ZMA A;  4JI2 T;  5HXC A;  3UUL A;  4BAY B;  2C5K T;  5HEO A;  5EK3 A;  4GYR A;  4MFR A;  3FXD B;  4UEL A;  5CJ5 A;  1E1H B;  3AXJ B;  4DMV A;  1HF8 A;  1X79 A;  4ANJ A;  4Z90 A;  3SWH A;  2BKO A;  3N2O A;  3WAK A;  3KV5 A;  4JEU B;  5HWY A;  5LBQ B;  3J7Y q;  1ZP0 A;  2XPK A;  4KHZ G;  2IDO B;  2NTX A;  2WZH A;  5JRC B;  1XZY A;  3RIA A;  2OLT A;  3UUB A;  4P0A A;  3T1H T;  3ZT6 A;  2IML A;  4X1Y E;  3Q9D A;  5AQJ B;  4DVD A;  5HEH A;  5KXJ A;  1VRB A;  2CWO A;  4C91 A;  1LKX A;  3IA3 A;  3N9N A;  4WYV A;  4QXC B;  3RIU A;  4CXW A;  1BR4 A;  4JI8 T;  2VWA A;  1O3X A;  3GN5 A;  3Q5X A;  4GYS A;  1W9R A;  3UQ7 A;  5FVL A;  2JQ9 A;  4TWD A;  4LF8 T;  3ZKR A;  4PK5 A;  4DR6 T;  3ONX A;  3IHR A;  5LHH B;  3PUW F;  3AA7 B;  3VRA A;  2WWU A;  4XTC N;  4ILU A;  3B13 A;  4AQG A;  4DR2 T;  5ADX L;  1YKE B;  2I59 A;  4WW0 A;  4GKK T;  5KMG P;  2V1D B;  5LA6 E;  5LJN A;  4JI6 T;  3I0O A;  5LG3 A;  3UT5 E;  1HG5 A;  3NWI A;  5JDG A;  2QA7 A;  3AB3 B;  3AE4 A;  2JMH A;  1VCS A;  2K5B B;  2UXB T;  4PJN A;  2WB5 A;  5HXS A;  2SPC A;  3SFD A;  5LGU B;  1Y01 A;  4L5G A;  3O1I A;  5FY1 A;  5LHI B;  3RHW A;  3HL6 A;  4QXH B;  1J5W A;  4GIW A;  2M67 A;  1U5P A;  2IHR 1;  2CPT A;  3PE0 A;  4YJ3 E;  3VR8 A;  4TNV A;  1XWM A;  3GWH A;  2Q9Q D;  3RC8 A;  3FBZ A;  5AQR B;  3QK6 A;  4U3C A; 
#chains in the Genus database with same CATH homology
 4YMU C;  3RLF G;  3PUZ F;  3PUX G;  4TQU N;  2ONK C;  4KHZ F;  3D31 C;  4KI0 G;  4YMS C;  4XTC M;  4YMW C;  3TUI A;  3PV0 F;  4YMV C;  3TUJ A;  3PUW F;  4XIG M;  3PUY F;  4JBW G;  3RLF F;  2R6G G;  3PUV G;  4XTC N;  3PUX F;  3PUZ G;  3TUZ A;  4KI0 F;  4KHZ G;  4TQU M;  4XIG N;  3PV0 G;  3DHW A;  4YMT B;  3PUW G;  4JBW F;  3PUY G;  2R6G F;  3PUV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...