3RLFF

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 147
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3rlfF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3rlfF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3rlfF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3rlfF02
2R6GF 4XIGN 3PUVG 4XTCN 4YMVC 4TQUM 2ONKC 3TUZA 3PUVF 3PUYG 4KHZG 3PUZG 3PUYF 3PUWG 3PUZF 3PV0G 3PUWF 4YMUC 4KHZF 3PV0F 3RLFG 3RLFF 4XTCM 4XIGM 4YMTB 3D31C 4YMSC 3DHWA 3TUJA 4YMWC 4JBWG 4TQUN 4KI0G 3TUIA 3PUXG 4JBWF 4KI0F 3PUXF 2R6GG
chains in the Genus database with same CATH superfamily
5CA1E 2ZM0A 4QXBB 5LOVE 4HKAA 3PV0F 5CA0E 5AQHB 1WCRA 1MNEA 4ZZBA 5HEJA 2E2AA 3ZSSA 2DLRA 5JDNA 3O4XE 4DMWA 3OYZA 5CGMA 4TWHA 3A8YC 3CK6A 1YKEB 2Z6EA 2UXBT 2NW8A 2IW5B 3S4UA 4AKRB 3AXJA 3KFWX 5AQVB 3ZN1B 1XDPA 2V7MA 2NR4A 4IL4A 5L47A 3F57A 5L3EB 4ERRA 2VVNA 1D0ZA 2N2NA 4EZHA 5LGUB 2X68A 3UU3A 1HTJF 3R6NA 3SOLA 4YFSA 2PJQA 3LK3B 5HYAA 2KXPB 5GONE 5L2LA 3OVUA 3ZCIA 2KWHA 5LMNT 1IJ6A 2CBIA 2MPKA 4UR9A 3I0OA 5AQUB 4XBFB 1BR2A 5LYJE 3H37A 2JIWA 5LCYA 3ZC1A 5L3FB 4XZCA 3EAMA 2W62A 3EDUA 2V26A 1VCTA 2BS2A 1US7B 3GWHA 3P4WA 4UVAB 3AA6B 4U7YA 1QUUA 4KMCA 2IUBA 1SHZC 4ZZCA 3KBUA 5KDMC 4YMVC 5TAOA 2XZEA 4GKJT 5HAXA 3I1AA 1IBMT 2VKJA 5AQQB 4ILUA 3ANWA 3OYXA 4PJNA 1XMQT 1LKXA 1OEDC 2W66A 3F31A 1KK7A 1YXRA 2VQET 2VKDA 4HEAA 3ZMUB 4NUVA 3L09A 4TQUM 3IEEA 2HN2A 3M65A 5A1LA 2XAHB 2X66A 4IT4A 4AQFA 2ACXA 2D5UA 3PTRB 3HKBE 5KX5E 2BG9A 5IWAT 4QXCB 4TNVA 4QHOA 4X1IE 4IE5A 4ZS2A 4IE4A 4WBOA 4YSXA 2N9DA 3ONXA 3J9X1 4KX6A 3PE0A 5AQPB 3CQXC 2LSKA 5LB7B 2XQ9A 4G63A 2JJ9A 3QB5A 1T8BA 2XM2A 2CE7A 4PK6A 4JI7T 3PV0G 1ZHCA 3I0QA 2FUPA 1WFDA 2WZHA 4U3CA 4KBMB 1UK5A 2J1DG 4DR4T 2LRLA 1HR0T 4DV2T 1AJ3A 2CXDA 3GN5B 2RP4A 4UVBB 4AQFC 3BQKA 1JNRA 3D31C 1W9RA 5LG3A 1E1HB 5J0ZA 2BG9C 2I6HA 1KNZA 2F4VT 2E5VA 1ZOYA 4JBWF 1N32T 5FXVA 5AFUL 3QNUA 4E7ZA 5L3DB 1W0AA 2QVAA 1D0YA 3MZKB 4YLHA 4AKLA 2BG9E 3ZT6A 4DV1T 3RH3A 3Q5EA 4U2YA 4HFIA 1N34T 2NWBA 2XASB 3ZT5A 3W15B 2BDEA 3ZCJA 2WAUA 4CXWA 3B57A 2AXDS 3KVAA 3DTOA 3IF8B 4P09A 4YMSC 4F8HA 4TV8E 4A56A 1X79A 1IAPA 3Q5DA 4DV5T 2D0UA 3NVOA 3RGLA 4IREA 3PUQA 4OFZA 2IIUA 5FXXA 4YMUC 1FEWA 3RYHE 5CFBA 4Z8XA 2VQFT 2L9QA 3A7MA 5HCJA 2PFVA 5L3BB 5F3JA 4DV4T 4EIWA 1HX1B 5LG4A 4XTCM 5IYZE 2V8SV 4IDNA 2WWVA 5ABFA 3AE9A 3RC8A 3MJXA 2W63A 3JCFA 2JQHA 5FY7A 3MK7C 5HEGA 2G0UA 5AQLB 5J2TE 4JI6T 2Y6XA 2DWKA 2HHHT 3ONLC 5AQTB 2XM1A 3UU6A 2YDRA 3ZJ1A 3RKOA 2EHOA 3FXDB 3L3PA 3BK9A 4LF5T 3RX6A 2KINB 4I4TE 4ISSA 4HGAA 3LK42 4PFPA 2X9WA 3QC9A 2LOPA 2YDSA 5H6QB 3FBZA 3AAIA 4LFBT 4Z91A 1HNWT 3AE6A 1D0XA 4TWFA 3HKEE 3KV9A 4DR7T 3RRWA 3FBLA 4NUUA 3WI3A 4DR5T 3RIUA 4N78D 5EK4A 5FVLA 3PUAA 4JI2T 3NRXA 1Y64B 3QOFA 1UUSA 1MMAA 3ZN0B 4LFCT 4CI3B 1CHUA 3AEAA 3MKDA 2P9BA 1M62A 3AA0B 3EI0A 5JVDE 1EZ3A 2LHNA 3P4PA 4IDQA 4HFVA 2JQQA 1KNPA 1MMDA 3AE7A 3KV5A 4F6RC 3OJAA 5BR8T 1MMGA 4E7SA 5JDQA 4QXHB 5HWXA 1MIVA 4I0UA 4U72A 2B76A 1V9DA 3ZYKA 1HG2A 4WZXA 2LLYA 5HEUA 2MYSA 4P1NA 3C4XA 4ZXLA 2NTYA 2KZ7B 2K24A 2K9AA 4HFDA 3A5XA 4PAGA 4UV8B 5LBQB 4EZ4A 3DJBA 5JDGA 2WB5A 2I59A 4PJMA 4UVCB 4X62T 3RHWA 1D1CA 5FY0A 3PUZF 2LKGA 2XHEB 4JUYA 3AXJB 3AEGA 2A3DA 4TQUN 2DCFA 3C50A 1J5ET 3LBXA 4OYJA 3HR0A 3QB5K 3LFMA 1OEDB 3Q2MA 1XNQT 2E9XC 4AKHA 1MMNA 5FXWA 1IBKT 2NW9A 4ADZA 4ANJA 2YDQA 3CQCB 2V7IA 4B3TT 2WU2A 1T72A 2WDVA 2UU9T 2BKPA 4YY3T 2W4XA 4H9OC 1NWMX 2KSRA 2BS4A 5FKYA 2VASA 4B6XA 1Z0PA 5F8PA 3ZPOA 5JTGA 4TV9E 4DBRA 3GMIA 4EYYR 4OX9T 2X0YA 4Q25A 2ES0A 3ANWB 3U3IA 5HXRA 3TUJA 3MACA 4IDPA 2BBJA 2CM0A 5EZYE 2N1GA 2YINA 3H3MA 3QUJA 1HF8A 2HH7A 4A97A 4KP3C 2ZM6T 4M1PA 1J5WA 3HKCE 2LM9A 5JDLA 3LJCA 4JLEA 2WWUA 4MFRA 5LBMA 5DQVA 2LKHA 3BQLA 2D9DA 2UUCT 1VRBA 5AQJB 4X66T 2BG9B 3PUVF 3MXZA 4X1KE 1VOMA 5ABGA 2LRKA 3FZKB 2XQ4A 1W09A 2IC9A 2X0LB 4DIDB 4EOZB 1WRDA 2DWGA 4BA9A 2BZBA 2HPLA 3B13A 5AQGB 4KHZG 4QX7B 5LP6E 3KV6A 3RLFF 1UURA 3VR8A 2K3WA 4DUZT 5L3GB 3T8OA 4H9RC 4MHCA 3HA4A 1D1BA 4G2AA 3O1HA 4YSYA 2VB6A 3F2EA 4GKKT 4JYAT 3ZT7A 4CI2B 3PUZG 4GOUA 1W0BA 4ZS3A 1T98A 1BR1A 3FZMB 4PK4A 2MTQA 3C4ZA 2I0MA 4TWDA 4DR6T 5H6RB 2RPAA 2PTFA 5JH7E 2C5IT 4YTNA 3PUGA 3PU3A 2WZIA 4XTCN 3AE1A 4LMKA 2IAKA 2M67A 5AQNB 3ESLA 5KXJA 4TUYE 1NEKA 3E0ZA 1YW0A 2YOEA 3KVBA 2CBJA 4JI3T 4KI0F 2YN6A 3AECA 4JI5T 4X64T 4H63H 3UUMA 2V5DA 2W61A 4ZI2C 2J47A 2WQYA 5AQFB 2ZMAA 3N2GE 3AE4A 3B5MA 2Y48B 1LRZA 3E08A 2ZM2A 5HXCA 4MBQA 3EABA 4YSZA 2X9YA 2BKNA 2WU5A 4J2CA 3RC3A 5DABA 5HXHA 1FJGT 3HKDE 2WS3A 4LF7T 3JAFA 1WYBA 4NPPA 3AEBA 4IE6A 4CN6A 3RF1A 2M6IA 3TLSA 2E5LT 5CB4E 4OK0A 2M6BA 3ZMVB 2R6GG 4BJNA 5FL1A 4IL9A 1S94A 3UFEA 5JRCA 3VKHA 4DUYT 5IUXA 3AE3A 5C3JA 3TLVA 3ONJA 4HFHA 4CQIA 4O4IE 4NIQA 4TX5A 1Z8UA 2E8IA 3L8RA 4GYSA 1SE7A 5ABFB 4EEDA 3UUXB 3TLTA 5LHGB 4CN1A 3EUHA 2K48A 4UF0A 3PUVG 3CIRA 1XWMA 3NBXX 1SA0E 3M3ZB 4A5XA 4A98A 3D0TA 3SS1A 2BVLA 4DV0T 2LHRA 5LMUT 3FXEB 4X65T 2QGSA 4PNIA 2W67A 4ZI3D 3O1JA 2WDQA 3K3NA 3K8PC 5AQIB 3UU5A 4K0KT 3RLFG 2KT9A 1BR4A 2OV9A 2B1EA 1X9BA 2XY8B 3TUIA 3VU7H 2PG8A 2KMFA 1HX8A 3V5UA 2CRBA 1LVFA 3X1DA 2ODUA 5LGNB 1H7CA 4CN4A 2WMOA 2XSAA 1E7PA 1NAFA 1I6ZA 3Q5WA 2GK9A 1U5PA 3EHZA 2UXCT 1OXZA 4O4LE 2V7JA 1KNRA 3QK6A 4XIGM 4JI0T 3O9XA 4KI0G 3N5LA 3ZYLA 2LE8A 3UTKA 5CJ5A 3ZKRA 2JPFA 4HFCA 4UV9B 2KNDA 1FMVA 3SFEA 5F5WA 3ZC0A 4YJ2E 3K1SA 3KBTA 3JC6C 4QX8B 4HWIB 1IJ5A 2BVMA 2E9XB 3KDSE 4B3ST 2VKOA 4DR1T 4UIGA 2ONKC 3NZQA 1HNXT 3AA7B 2XPKA 5C2TA 4O4HE 2ZLYA 4ISTA 4DNDA 2LSGA 2JMKA 2E9XD 2FJEA 2YKSA 2LOSA 1N36T 4LF9T 3EVYA 4EXTA 3P4RA 4ZI3C 4QH5A 4QWNB 1QLBA 1N33T 2WCAA 2YK0A 4QKNA 3OPCA 3PDYA 1U4QA 2QA7A 2EHOC 5M4YA 2WDRA 2CMRA 3UUBA 2MOZA 4HFEA 2WM9A 2ACZA 2CHNA 5JR9A 5LHHB 1JNZA 4U2ZA 1HNZT 2V5CA 5LNKA 2A2FX 3WAKA 3N2KE 2HPJA 4YMTB 4JV5T 5ETWA 4YTPA 2H3RA 3LSVA 1VCSA 5ABHA 3CKDA 2Q9QA 4O2AE 4K0UA 4B3MT 3N2OA 5FMNA 1WR0A 3AVSA 2QYWA 3RIUC 4X1YE 5FP3A 3L39A 4KHZF 2FJDA 1KEYA 2QRXA 4C91A 2Y8DA 3I9YA 3HI2A 5HWYA 2UUBT 1T7SA 2XQ8A 3PJAJ 4KUMB 3FZLB 5JQGE 4PJJA 5AQOB 3TKLB 1I94T 1CUNA 5JR9C 3P7IA 5LA6E 3UT5E 2V1DB 1ZP0A 3N9MA 1YKHB 2ODVA 4ILCA 3CX6B 5FYMA 5L4HA 3RIFA 5LJNA 2Q9QC 4AKGA 5J2UE 5HEHA 4IGUA 4I43B 4HFBA 4L5GA 1WR6A 2CEAA 1M7KA 1YQ3A 1L0VA 4AQYT 2VL0A 2VKHA 2CHOA 3J7Yq 4L9IA 2WY2A 4H9SE 1FIOA 2LEHA 2IHR1 3VHLA 3Q9DA 4LF8T 2NP9A 3CPZA 3IBPA 2XAJB 4TZ4C 1HG5A 5AQRB 2XTLA 2VURA 4COFA 4WNKA 1R8IA 2X9HA 2NOXA 5JREA 1QSDA 4MALA 2XQ3A 2V6XA 3R84B 3RPUA 2R6GF 2V6YA 2AE9A 3AE5A 4GYRA 4U31A 1HFAA 3JAEA 4ZI2D 2IC6A 3N9LA 3ZLIA 2UXNB 4UELA 4QH1A 3NKZA 3SRZA 4LFAT 3UFGA 3ETUA 2XAQB 3NWIA 2NW7A 3AA1B 4PK5A 2V7LA 4TNWA 3RKGA 3N9PA 1OEDA 1SUMB 4IDOA 5L3CB 2UXXB 4LMJA 2CWOA 2XQYA 4EYUA 5BMVE 3OTOT 5AQSB 4MLKA 5HXEA 4PFOA 3GA8A 4WW0A 1HCIA 1E2AA 1WYCA 3C51A 4AQGA 4P0BA 3VKGA 2CLYB 3AE2A 3SWHA 3TUZA 3U78A 5ABEA 3N9QA 4YJ3E 2JQKA 3RYCE 4X5TA 3RI5A 3CQGB 4DMVA 1OWAA 3NZPA 1IBLT 5L4EA 2LSYA 2C0SA 1XZYA 3SFDA 1DU2A 2PBIA 4AIUA 2DHRA 2V7KA 3PUYF 3ZYMA 5DQWA 1MIYA 3UUNA 3RQUA 1MNDA 2XUEA 4LF4T 4PW8A 5E0OA 2FJBA 3AVRA 3G06A 5J1GA 1J1JA 1D1AA 4HTEA 1G73A 2BBHA 5AQKB 5JRCB 2CXFA 4CXYA 2ZM8A 1OEDE 2FJAA 2LSIA 3N9OA 4ILAA 1UX4A 2OA5A 2W0GA 4Z90A 4DV7T 4ZEYA 4HWDA 4GK5E 4YT0A 4XIGN 3P4QA 2W2UA 4WYVA 4UF0B 2CPTA 2MAWA 3VR9A 4HWCA 1WLXA 2VK9A 1MIWA 3LK2B 5EK3A 4IE7A 5IHYA 3ZMTB 4ZI7E 4IIJE 2WBLA 1XMOT 3AEEA 5AQMB 3UULA 4ZHQE 5FY1A 2CWYA 4I55E 3UU4A 3FHNA 1ZKEA 3ZMZB 2HN1A 4YXDA 2D2SA 2BKOA 3IA3A 1ZV4X 3CWZB 2CLYC 4V1Av 3I9WA 5HEOA 2LSJA 4FI5A 1LVKA 2C5JA 3OBVE 1YD8G 3PUXF 3JC6D 4C90A 3CVRA 4QH4A 2C5KT 3NRYA 4CZZB 1KF6A 1HS7A 5DJQC 2JRKA 2XAFB 3H3AA 3IHRA 4DVDA 3T1YT 4IHJE 3UQ7A 1NENA 2EHOB 2H7OA 2KWIB 4GIWA 2YU1A 4AKIA 3K3QC 4HWHA 4U7IA 2MBGA 1KFYA 3FB2A 3ZMSB 3KV4A 4OHFA 4BJMA 2EHOD 2X9XA 2X51A 5FVKA 4HN9A 5HCMA 1GQEA 2H89A 3GN5A 3RQWA 3PUYG 1UX5A 4YHJA 3RYFE 4H9QC 2BS3A 2CXLA 3AEDA 5JDFA 4DV3T 4KHPT 5JDHA 1YQ4A 2LJLA 3RIAA 2UUAT 3HL6A 4EV6A 2XQ7A 4ASKA 4ILBA 3FZHB 1UCUA 2CA5A 4JI8T 3C4WA 2JMHA 2L8KA 2YEVC 3PUWF 3K3OA 4CI1B 2VL8A 3E22E 2X0HA 4L0RA 3VRAA 4UXNB 4AI6A 2DI4A 4YHHT 3EDVA 4U33A 2NTXA 4AXPA 5JR9B 2XQ6A 4YTMA 5LGTB 3C64A 3KINB 3VRBA 3C98B 2IMLA 3O1IA 2CCQA 1S35A 4NXNT 2X67A 3TLUA 3AAEB 4H63V 2Q9QB 4LMLA 4B3RT 2LM2A 2DNXA 4XAXB 4ZOLE 3PU8A 2FBWA 3FZFB 3UU8A 2W00A 4LF6T 4BAYB 4HE8A 4DV6T 5LXTE 2XJ7A 4EB6E 4H9PC 4YMWC 1FMWA 1G8XA 2Q9QD 3RRCA 4IE0A 5KMGP 4U74A 3UQ4A 2XQ5A 4AISA 4H9NC 3V5SA 3PURA 2LT3A 3JADA 1ZEEA 5HXSA 3CX8B 4JBWG 4DBQA 3PUXG 2WMNA 3LBXB 3ABVA 3P50A 2J4GA 3ZJ2A 4DR2T 2WP9A 4CXXA 3ZSTA 5JDMA 2YU2A 4O2BE 4GK0E 4O4JE 2A72A 5FXZA 3DP7A 2JQ9A 4PJLA 3CX7B 3LDQB 5FL0A 2K5BB 3N9NA 1XNRT 5ADXL 5LHIB 2J62A 3AEFA 3P4SA 2OLTA 3ETVA 4P0AA 2VWAA 2A9UA 3LG7A 5FNVE 4I50E 3Q5XA 3T1HT 2E9XA 1B7TA 4IDZA 4EAHA 2WSSV 4OYKA 2IDOB 4FJOA 5C8YE 3ZEFB 2L3LA 1Y01A 5EK2A 2SPCA 3DHWA 3PUSA 2RA1A 3PJAA 3WAJA 3BQIA 4TN7B 1O3XA 3TLWA 4JI4T 1XDOA 4JI1T 3MA9A 3PUWG 1BR0A 2V6YB 2UXDT 2XSBA 4NXMT 4DO0A 3AAAB 5LJMA 4DR3T 4EEBA 2KLQA 4EGWA 2DL1A 4O8SA 4UEMA 4JEHB 2H7VC 3RYIE 2XAGB 3CMLA 4X20E 4JEUB 1IZNB 3P8CD 3AE8A 2VVSA 2XQAA 2H88A 3AB3B 4HWFA 4WBNE 2D0TA 3OKQA 1UGOA
chains in the Genus database with same CATH topology
2R6GF 4XIGN 3PUVG 4XTCN 4YMVC 4TQUM 2ONKC 3TUZA 3PUVF 3PUYG 4KHZG 3PUZG 3PUYF 3PUWG 3PUZF 3PV0G 3PUWF 4YMUC 4KHZF 3PV0F 3RLFG 3RLFF 4XTCM 4XIGM 4YMTB 3D31C 4YMSC 3DHWA 3TUJA 4YMWC 4JBWG 4TQUN 4KI0G 3TUIA 3PUXG 4JBWF 4KI0F 3PUXF 2R6GG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G F;  4XIG N;  3PUV G;  4XTC N;  4YMV C;  4TQU M;  2ONK C;  3TUZ A;  3PUV F;  3PUY G;  4KHZ G;  3PUZ G;  3PUY F;  3PUW G;  3PUZ F;  3PV0 G;  3PUW F;  4YMU C;  4KHZ F;  3PV0 F;  3RLF G;  3RLF F;  4XTC M;  4XIG M;  4YMT B;  3D31 C;  4YMS C;  3DHW A;  3TUJ A;  4YMW C;  4JBW G;  4TQU N;  4KI0 G;  3TUI A;  3PUX G;  4JBW F;  4KI0 F;  3PUX F;  2R6G G; 
#chains in the Genus database with same CATH topology
 5CA1 E;  2ZM0 A;  4QXB B;  5LOV E;  4HKA A;  3PV0 F;  5CA0 E;  5AQH B;  1WCR A;  1MNE A;  4ZZB A;  5HEJ A;  2E2A A;  3ZSS A;  2DLR A;  5JDN A;  3O4X E;  4DMW A;  3OYZ A;  5CGM A;  4TWH A;  3A8Y C;  3CK6 A;  1YKE B;  2Z6E A;  2UXB T;  2NW8 A;  2IW5 B;  3S4U A;  4AKR B;  3AXJ A;  3KFW X;  5AQV B;  3ZN1 B;  1XDP A;  2V7M A;  2NR4 A;  4IL4 A;  5L47 A;  3F57 A;  5L3E B;  4ERR A;  2VVN A;  1D0Z A;  2N2N A;  4EZH A;  5LGU B;  2X68 A;  3UU3 A;  1HTJ F;  3R6N A;  3SOL A;  4YFS A;  2PJQ A;  3LK3 B;  5HYA A;  2KXP B;  5GON E;  5L2L A;  3OVU A;  3ZCI A;  2KWH A;  5LMN T;  1IJ6 A;  2CBI A;  2MPK A;  4UR9 A;  3I0O A;  5AQU B;  4XBF B;  1BR2 A;  5LYJ E;  3H37 A;  2JIW A;  5LCY A;  3ZC1 A;  5L3F B;  4XZC A;  3EAM A;  2W62 A;  3EDU A;  2V26 A;  1VCT A;  2BS2 A;  1US7 B;  3GWH A;  3P4W A;  4UVA B;  3AA6 B;  4U7Y A;  1QUU A;  4KMC A;  2IUB A;  1SHZ C;  4ZZC A;  3KBU A;  5KDM C;  4YMV C;  5TAO A;  2XZE A;  4GKJ T;  5HAX A;  3I1A A;  1IBM T;  2VKJ A;  5AQQ B;  4ILU A;  3ANW A;  3OYX A;  4PJN A;  1XMQ T;  1LKX A;  1OED C;  2W66 A;  3F31 A;  1KK7 A;  1YXR A;  2VQE T;  2VKD A;  4HEA A;  3ZMU B;  4NUV A;  3L09 A;  4TQU M;  3IEE A;  2HN2 A;  3M65 A;  5A1L A;  2XAH B;  2X66 A;  4IT4 A;  4AQF A;  2ACX A;  2D5U A;  3PTR B;  3HKB E;  5KX5 E;  2BG9 A;  5IWA T;  4QXC B;  4TNV A;  4QHO A;  4X1I E;  4IE5 A;  4ZS2 A;  4IE4 A;  4WBO A;  4YSX A;  2N9D A;  3ONX A;  3J9X 1;  4KX6 A;  3PE0 A;  5AQP B;  3CQX C;  2LSK A;  5LB7 B;  2XQ9 A;  4G63 A;  2JJ9 A;  3QB5 A;  1T8B A;  2XM2 A;  2CE7 A;  4PK6 A;  4JI7 T;  3PV0 G;  1ZHC A;  3I0Q A;  2FUP A;  1WFD A;  2WZH A;  4U3C A;  4KBM B;  1UK5 A;  2J1D G;  4DR4 T;  2LRL A;  1HR0 T;  4DV2 T;  1AJ3 A;  2CXD A;  3GN5 B;  2RP4 A;  4UVB B;  4AQF C;  3BQK A;  1JNR A;  3D31 C;  1W9R A;  5LG3 A;  1E1H B;  5J0Z A;  2BG9 C;  2I6H A;  1KNZ A;  2F4V T;  2E5V A;  1ZOY A;  4JBW F;  1N32 T;  5FXV A;  5AFU L;  3QNU A;  4E7Z A;  5L3D B;  1W0A A;  2QVA A;  1D0Y A;  3MZK B;  4YLH A;  4AKL A;  2BG9 E;  3ZT6 A;  4DV1 T;  3RH3 A;  3Q5E A;  4U2Y A;  4HFI A;  1N34 T;  2NWB A;  2XAS B;  3ZT5 A;  3W15 B;  2BDE A;  3ZCJ A;  2WAU A;  4CXW A;  3B57 A;  2AXD S;  3KVA A;  3DTO A;  3IF8 B;  4P09 A;  4YMS C;  4F8H A;  4TV8 E;  4A56 A;  1X79 A;  1IAP A;  3Q5D A;  4DV5 T;  2D0U A;  3NVO A;  3RGL A;  4IRE A;  3PUQ A;  4OFZ A;  2IIU A;  5FXX A;  4YMU C;  1FEW A;  3RYH E;  5CFB A;  4Z8X A;  2VQF T;  2L9Q A;  3A7M A;  5HCJ A;  2PFV A;  5L3B B;  5F3J A;  4DV4 T;  4EIW A;  1HX1 B;  5LG4 A;  4XTC M;  5IYZ E;  2V8S V;  4IDN A;  2WWV A;  5ABF A;  3AE9 A;  3RC8 A;  3MJX A;  2W63 A;  3JCF A;  2JQH A;  5FY7 A;  3MK7 C;  5HEG A;  2G0U A;  5AQL B;  5J2T E;  4JI6 T;  2Y6X A;  2DWK A;  2HHH T;  3ONL C;  5AQT B;  2XM1 A;  3UU6 A;  2YDR A;  3ZJ1 A;  3RKO A;  2EHO A;  3FXD B;  3L3P A;  3BK9 A;  4LF5 T;  3RX6 A;  2KIN B;  4I4T E;  4ISS A;  4HGA A;  3LK4 2;  4PFP A;  2X9W A;  3QC9 A;  2LOP A;  2YDS A;  5H6Q B;  3FBZ A;  3AAI A;  4LFB T;  4Z91 A;  1HNW T;  3AE6 A;  1D0X A;  4TWF A;  3HKE E;  3KV9 A;  4DR7 T;  3RRW A;  3FBL A;  4NUU A;  3WI3 A;  4DR5 T;  3RIU A;  4N78 D;  5EK4 A;  5FVL A;  3PUA A;  4JI2 T;  3NRX A;  1Y64 B;  3QOF A;  1UUS A;  1MMA A;  3ZN0 B;  4LFC T;  4CI3 B;  1CHU A;  3AEA A;  3MKD A;  2P9B A;  1M62 A;  3AA0 B;  3EI0 A;  5JVD E;  1EZ3 A;  2LHN A;  3P4P A;  4IDQ A;  4HFV A;  2JQQ A;  1KNP A;  1MMD A;  3AE7 A;  3KV5 A;  4F6R C;  3OJA A;  5BR8 T;  1MMG A;  4E7S A;  5JDQ A;  4QXH B;  5HWX A;  1MIV A;  4I0U A;  4U72 A;  2B76 A;  1V9D A;  3ZYK A;  1HG2 A;  4WZX A;  2LLY A;  5HEU A;  2MYS A;  4P1N A;  3C4X A;  4ZXL A;  2NTY A;  2KZ7 B;  2K24 A;  2K9A A;  4HFD A;  3A5X A;  4PAG A;  4UV8 B;  5LBQ B;  4EZ4 A;  3DJB A;  5JDG A;  2WB5 A;  2I59 A;  4PJM A;  4UVC B;  4X62 T;  3RHW A;  1D1C A;  5FY0 A;  3PUZ F;  2LKG A;  2XHE B;  4JUY A;  3AXJ B;  3AEG A;  2A3D A;  4TQU N;  2DCF A;  3C50 A;  1J5E T;  3LBX A;  4OYJ A;  3HR0 A;  3QB5 K;  3LFM A;  1OED B;  3Q2M A;  1XNQ T;  2E9X C;  4AKH A;  1MMN A;  5FXW A;  1IBK T;  2NW9 A;  4ADZ A;  4ANJ A;  2YDQ A;  3CQC B;  2V7I A;  4B3T T;  2WU2 A;  1T72 A;  2WDV A;  2UU9 T;  2BKP A;  4YY3 T;  2W4X A;  4H9O C;  1NWM X;  2KSR A;  2BS4 A;  5FKY A;  2VAS A;  4B6X A;  1Z0P A;  5F8P A;  3ZPO A;  5JTG A;  4TV9 E;  4DBR A;  3GMI A;  4EYY R;  4OX9 T;  2X0Y A;  4Q25 A;  2ES0 A;  3ANW B;  3U3I A;  5HXR A;  3TUJ A;  3MAC A;  4IDP A;  2BBJ A;  2CM0 A;  5EZY E;  2N1G A;  2YIN A;  3H3M A;  3QUJ A;  1HF8 A;  2HH7 A;  4A97 A;  4KP3 C;  2ZM6 T;  4M1P A;  1J5W A;  3HKC E;  2LM9 A;  5JDL A;  3LJC A;  4JLE A;  2WWU A;  4MFR A;  5LBM A;  5DQV A;  2LKH A;  3BQL A;  2D9D A;  2UUC T;  1VRB A;  5AQJ B;  4X66 T;  2BG9 B;  3PUV F;  3MXZ A;  4X1K E;  1VOM A;  5ABG A;  2LRK A;  3FZK B;  2XQ4 A;  1W09 A;  2IC9 A;  2X0L B;  4DID B;  4EOZ B;  1WRD A;  2DWG A;  4BA9 A;  2BZB A;  2HPL A;  3B13 A;  5AQG B;  4KHZ G;  4QX7 B;  5LP6 E;  3KV6 A;  3RLF F;  1UUR A;  3VR8 A;  2K3W A;  4DUZ T;  5L3G B;  3T8O A;  4H9R C;  4MHC A;  3HA4 A;  1D1B A;  4G2A A;  3O1H A;  4YSY A;  2VB6 A;  3F2E A;  4GKK T;  4JYA T;  3ZT7 A;  4CI2 B;  3PUZ G;  4GOU A;  1W0B A;  4ZS3 A;  1T98 A;  1BR1 A;  3FZM B;  4PK4 A;  2MTQ A;  3C4Z A;  2I0M A;  4TWD A;  4DR6 T;  5H6R B;  2RPA A;  2PTF A;  5JH7 E;  2C5I T;  4YTN A;  3PUG A;  3PU3 A;  2WZI A;  4XTC N;  3AE1 A;  4LMK A;  2IAK A;  2M67 A;  5AQN B;  3ESL A;  5KXJ A;  4TUY E;  1NEK A;  3E0Z A;  1YW0 A;  2YOE A;  3KVB A;  2CBJ A;  4JI3 T;  4KI0 F;  2YN6 A;  3AEC A;  4JI5 T;  4X64 T;  4H63 H;  3UUM A;  2V5D A;  2W61 A;  4ZI2 C;  2J47 A;  2WQY A;  5AQF B;  2ZMA A;  3N2G E;  3AE4 A;  3B5M A;  2Y48 B;  1LRZ A;  3E08 A;  2ZM2 A;  5HXC A;  4MBQ A;  3EAB A;  4YSZ A;  2X9Y A;  2BKN A;  2WU5 A;  4J2C A;  3RC3 A;  5DAB A;  5HXH A;  1FJG T;  3HKD E;  2WS3 A;  4LF7 T;  3JAF A;  1WYB A;  4NPP A;  3AEB A;  4IE6 A;  4CN6 A;  3RF1 A;  2M6I A;  3TLS A;  2E5L T;  5CB4 E;  4OK0 A;  2M6B A;  3ZMV B;  2R6G G;  4BJN A;  5FL1 A;  4IL9 A;  1S94 A;  3UFE A;  5JRC A;  3VKH A;  4DUY T;  5IUX A;  3AE3 A;  5C3J A;  3TLV A;  3ONJ A;  4HFH A;  4CQI A;  4O4I E;  4NIQ A;  4TX5 A;  1Z8U A;  2E8I A;  3L8R A;  4GYS A;  1SE7 A;  5ABF B;  4EED A;  3UUX B;  3TLT A;  5LHG B;  4CN1 A;  3EUH A;  2K48 A;  4UF0 A;  3PUV G;  3CIR A;  1XWM A;  3NBX X;  1SA0 E;  3M3Z B;  4A5X A;  4A98 A;  3D0T A;  3SS1 A;  2BVL A;  4DV0 T;  2LHR A;  5LMU T;  3FXE B;  4X65 T;  2QGS A;  4PNI A;  2W67 A;  4ZI3 D;  3O1J A;  2WDQ A;  3K3N A;  3K8P C;  5AQI B;  3UU5 A;  4K0K T;  3RLF G;  2KT9 A;  1BR4 A;  2OV9 A;  2B1E A;  1X9B A;  2XY8 B;  3TUI A;  3VU7 H;  2PG8 A;  2KMF A;  1HX8 A;  3V5U A;  2CRB A;  1LVF A;  3X1D A;  2ODU A;  5LGN B;  1H7C A;  4CN4 A;  2WMO A;  2XSA A;  1E7P A;  1NAF A;  1I6Z A;  3Q5W A;  2GK9 A;  1U5P A;  3EHZ A;  2UXC T;  1OXZ A;  4O4L E;  2V7J A;  1KNR A;  3QK6 A;  4XIG M;  4JI0 T;  3O9X A;  4KI0 G;  3N5L A;  3ZYL A;  2LE8 A;  3UTK A;  5CJ5 A;  3ZKR A;  2JPF A;  4HFC A;  4UV9 B;  2KND A;  1FMV A;  3SFE A;  5F5W A;  3ZC0 A;  4YJ2 E;  3K1S A;  3KBT A;  3JC6 C;  4QX8 B;  4HWI B;  1IJ5 A;  2BVM A;  2E9X B;  3KDS E;  4B3S T;  2VKO A;  4DR1 T;  4UIG A;  2ONK C;  3NZQ A;  1HNX T;  3AA7 B;  2XPK A;  5C2T A;  4O4H E;  2ZLY A;  4IST A;  4DND A;  2LSG A;  2JMK A;  2E9X D;  2FJE A;  2YKS A;  2LOS A;  1N36 T;  4LF9 T;  3EVY A;  4EXT A;  3P4R A;  4ZI3 C;  4QH5 A;  4QWN B;  1QLB A;  1N33 T;  2WCA A;  2YK0 A;  4QKN A;  3OPC A;  3PDY A;  1U4Q A;  2QA7 A;  2EHO C;  5M4Y A;  2WDR A;  2CMR A;  3UUB A;  2MOZ A;  4HFE A;  2WM9 A;  2ACZ A;  2CHN A;  5JR9 A;  5LHH B;  1JNZ A;  4U2Z A;  1HNZ T;  2V5C A;  5LNK A;  2A2F X;  3WAK A;  3N2K E;  2HPJ A;  4YMT B;  4JV5 T;  5ETW A;  4YTP A;  2H3R A;  3LSV A;  1VCS A;  5ABH A;  3CKD A;  2Q9Q A;  4O2A E;  4K0U A;  4B3M T;  3N2O A;  5FMN A;  1WR0 A;  3AVS A;  2QYW A;  3RIU C;  4X1Y E;  5FP3 A;  3L39 A;  4KHZ F;  2FJD A;  1KEY A;  2QRX A;  4C91 A;  2Y8D A;  3I9Y A;  3HI2 A;  5HWY A;  2UUB T;  1T7S A;  2XQ8 A;  3PJA J;  4KUM B;  3FZL B;  5JQG E;  4PJJ A;  5AQO B;  3TKL B;  1I94 T;  1CUN A;  5JR9 C;  3P7I A;  5LA6 E;  3UT5 E;  2V1D B;  1ZP0 A;  3N9M A;  1YKH B;  2ODV A;  4ILC A;  3CX6 B;  5FYM A;  5L4H A;  3RIF A;  5LJN A;  2Q9Q C;  4AKG A;  5J2U E;  5HEH A;  4IGU A;  4I43 B;  4HFB A;  4L5G A;  1WR6 A;  2CEA A;  1M7K A;  1YQ3 A;  1L0V A;  4AQY T;  2VL0 A;  2VKH A;  2CHO A;  3J7Y q;  4L9I A;  2WY2 A;  4H9S E;  1FIO A;  2LEH A;  2IHR 1;  3VHL A;  3Q9D A;  4LF8 T;  2NP9 A;  3CPZ A;  3IBP A;  2XAJ B;  4TZ4 C;  1HG5 A;  5AQR B;  2XTL A;  2VUR A;  4COF A;  4WNK A;  1R8I A;  2X9H A;  2NOX A;  5JRE A;  1QSD A;  4MAL A;  2XQ3 A;  2V6X A;  3R84 B;  3RPU A;  2R6G F;  2V6Y A;  2AE9 A;  3AE5 A;  4GYR A;  4U31 A;  1HFA A;  3JAE A;  4ZI2 D;  2IC6 A;  3N9L A;  3ZLI A;  2UXN B;  4UEL A;  4QH1 A;  3NKZ A;  3SRZ A;  4LFA T;  3UFG A;  3ETU A;  2XAQ B;  3NWI A;  2NW7 A;  3AA1 B;  4PK5 A;  2V7L A;  4TNW A;  3RKG A;  3N9P A;  1OED A;  1SUM B;  4IDO A;  5L3C B;  2UXX B;  4LMJ A;  2CWO A;  2XQY A;  4EYU A;  5BMV E;  3OTO T;  5AQS B;  4MLK A;  5HXE A;  4PFO A;  3GA8 A;  4WW0 A;  1HCI A;  1E2A A;  1WYC A;  3C51 A;  4AQG A;  4P0B A;  3VKG A;  2CLY B;  3AE2 A;  3SWH A;  3TUZ A;  3U78 A;  5ABE A;  3N9Q A;  4YJ3 E;  2JQK A;  3RYC E;  4X5T A;  3RI5 A;  3CQG B;  4DMV A;  1OWA A;  3NZP A;  1IBL T;  5L4E A;  2LSY A;  2C0S A;  1XZY A;  3SFD A;  1DU2 A;  2PBI A;  4AIU A;  2DHR A;  2V7K A;  3PUY F;  3ZYM A;  5DQW A;  1MIY A;  3UUN A;  3RQU A;  1MND A;  2XUE A;  4LF4 T;  4PW8 A;  5E0O A;  2FJB A;  3AVR A;  3G06 A;  5J1G A;  1J1J A;  1D1A A;  4HTE A;  1G73 A;  2BBH A;  5AQK B;  5JRC B;  2CXF A;  4CXY A;  2ZM8 A;  1OED E;  2FJA A;  2LSI A;  3N9O A;  4ILA A;  1UX4 A;  2OA5 A;  2W0G A;  4Z90 A;  4DV7 T;  4ZEY A;  4HWD A;  4GK5 E;  4YT0 A;  4XIG N;  3P4Q A;  2W2U A;  4WYV A;  4UF0 B;  2CPT A;  2MAW A;  3VR9 A;  4HWC A;  1WLX A;  2VK9 A;  1MIW A;  3LK2 B;  5EK3 A;  4IE7 A;  5IHY A;  3ZMT B;  4ZI7 E;  4IIJ E;  2WBL A;  1XMO T;  3AEE A;  5AQM B;  3UUL A;  4ZHQ E;  5FY1 A;  2CWY A;  4I55 E;  3UU4 A;  3FHN A;  1ZKE A;  3ZMZ B;  2HN1 A;  4YXD A;  2D2S A;  2BKO A;  3IA3 A;  1ZV4 X;  3CWZ B;  2CLY C;  4V1A v;  3I9W A;  5HEO A;  2LSJ A;  4FI5 A;  1LVK A;  2C5J A;  3OBV E;  1YD8 G;  3PUX F;  3JC6 D;  4C90 A;  3CVR A;  4QH4 A;  2C5K T;  3NRY A;  4CZZ B;  1KF6 A;  1HS7 A;  5DJQ C;  2JRK A;  2XAF B;  3H3A A;  3IHR A;  4DVD A;  3T1Y T;  4IHJ E;  3UQ7 A;  1NEN A;  2EHO B;  2H7O A;  2KWI B;  4GIW A;  2YU1 A;  4AKI A;  3K3Q C;  4HWH A;  4U7I A;  2MBG A;  1KFY A;  3FB2 A;  3ZMS B;  3KV4 A;  4OHF A;  4BJM A;  2EHO D;  2X9X A;  2X51 A;  5FVK A;  4HN9 A;  5HCM A;  1GQE A;  2H89 A;  3GN5 A;  3RQW A;  3PUY G;  1UX5 A;  4YHJ A;  3RYF E;  4H9Q C;  2BS3 A;  2CXL A;  3AED A;  5JDF A;  4DV3 T;  4KHP T;  5JDH A;  1YQ4 A;  2LJL A;  3RIA A;  2UUA T;  3HL6 A;  4EV6 A;  2XQ7 A;  4ASK A;  4ILB A;  3FZH B;  1UCU A;  2CA5 A;  4JI8 T;  3C4W A;  2JMH A;  2L8K A;  2YEV C;  3PUW F;  3K3O A;  4CI1 B;  2VL8 A;  3E22 E;  2X0H A;  4L0R A;  3VRA A;  4UXN B;  4AI6 A;  2DI4 A;  4YHH T;  3EDV A;  4U33 A;  2NTX A;  4AXP A;  5JR9 B;  2XQ6 A;  4YTM A;  5LGT B;  3C64 A;  3KIN B;  3VRB A;  3C98 B;  2IML A;  3O1I A;  2CCQ A;  1S35 A;  4NXN T;  2X67 A;  3TLU A;  3AAE B;  4H63 V;  2Q9Q B;  4LML A;  4B3R T;  2LM2 A;  2DNX A;  4XAX B;  4ZOL E;  3PU8 A;  2FBW A;  3FZF B;  3UU8 A;  2W00 A;  4LF6 T;  4BAY B;  4HE8 A;  4DV6 T;  5LXT E;  2XJ7 A;  4EB6 E;  4H9P C;  4YMW C;  1FMW A;  1G8X A;  2Q9Q D;  3RRC A;  4IE0 A;  5KMG P;  4U74 A;  3UQ4 A;  2XQ5 A;  4AIS A;  4H9N C;  3V5S A;  3PUR A;  2LT3 A;  3JAD A;  1ZEE A;  5HXS A;  3CX8 B;  4JBW G;  4DBQ A;  3PUX G;  2WMN A;  3LBX B;  3ABV A;  3P50 A;  2J4G A;  3ZJ2 A;  4DR2 T;  2WP9 A;  4CXX A;  3ZST A;  5JDM A;  2YU2 A;  4O2B E;  4GK0 E;  4O4J E;  2A72 A;  5FXZ A;  3DP7 A;  2JQ9 A;  4PJL A;  3CX7 B;  3LDQ B;  5FL0 A;  2K5B B;  3N9N A;  1XNR T;  5ADX L;  5LHI B;  2J62 A;  3AEF A;  3P4S A;  2OLT A;  3ETV A;  4P0A A;  2VWA A;  2A9U A;  3LG7 A;  5FNV E;  4I50 E;  3Q5X A;  3T1H T;  2E9X A;  1B7T A;  4IDZ A;  4EAH A;  2WSS V;  4OYK A;  2IDO B;  4FJO A;  5C8Y E;  3ZEF B;  2L3L A;  1Y01 A;  5EK2 A;  2SPC A;  3DHW A;  3PUS A;  2RA1 A;  3PJA A;  3WAJ A;  3BQI A;  4TN7 B;  1O3X A;  3TLW A;  4JI4 T;  1XDO A;  4JI1 T;  3MA9 A;  3PUW G;  1BR0 A;  2V6Y B;  2UXD T;  2XSB A;  4NXM T;  4DO0 A;  3AAA B;  5LJM A;  4DR3 T;  4EEB A;  2KLQ A;  4EGW A;  2DL1 A;  4O8S A;  4UEM A;  4JEH B;  2H7V C;  3RYI E;  2XAG B;  3CML A;  4X20 E;  4JEU B;  1IZN B;  3P8C D;  3AE8 A;  2VVS A;  2XQA A;  2H88 A;  3AB3 B;  4HWF A;  4WBN E;  2D0T A;  3OKQ A;  1UGO A; 
#chains in the Genus database with same CATH homology
 2R6G F;  4XIG N;  3PUV G;  4XTC N;  4YMV C;  4TQU M;  2ONK C;  3TUZ A;  3PUV F;  3PUY G;  4KHZ G;  3PUZ G;  3PUY F;  3PUW G;  3PUZ F;  3PV0 G;  3PUW F;  4YMU C;  4KHZ F;  3PV0 F;  3RLF G;  3RLF F;  4XTC M;  4XIG M;  4YMT B;  3D31 C;  4YMS C;  3DHW A;  3TUJ A;  4YMW C;  4JBW G;  4TQU N;  4KI0 G;  3TUI A;  3PUX G;  4JBW F;  4KI0 F;  3PUX F;  2R6G G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...