3RLFF

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
494
structure length
490
Chain Sequence
WQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 147
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 3rlfF04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 3rlfF01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 3rlfF03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 3rlfF02
3PUXF 4JBWF 3PUXG 4JBWG 4XIGN 3PUVF 4KHZF 4TQUN 3PUYF 4KHZG 4YMVC 3PUVG 3TUJA 3PUYG 3TUIA 4YMSC 4KI0F 4XTCN 4KI0G 2ONKC 3PUZF 3PUZG 2R6GF 4YMWC 2R6GG 3TUZA 4XIGM 4TQUM 3PUWF 4YMTB 3RLFF 3DHWA 3PUWG 3PV0F 4YMUC 3RLFG 4XTCM 3D31C 3PV0G
chains in the Genus database with same CATH superfamily
1UX4A 1O3XA 2XAGB 3C4WA 3A8YC 3RHWA 4DV4T 1IJ5A 3PJAA 1H7CA 4U2ZA 2WQYA 5AQKB 2LJLA 4H63V 3AA0B 4YTMA 4LFBT 1HG5A 2IC9A 3FZFB 3ZJ1A 4ZZBA 4ILUA 3QB5K 5L3EB 2BS2A 2CBJA 4P09A 3VHLA 2B76A 2XQ3A 4TQUM 4EGWA 1VCSA 4UF0A 5JQGE 3F57A 4X1KE 3ABVA 4O4HE 5FXWA 4TUYE 4UXNB 4JEHB 2I0MA 3Q5XA 2QA7A 2A9UA 3AE8A 3UFEA 2LHNA 4IT4A 5JDGA 3VU7H 1WR6A 3WAKA 2HPJA 4I4TE 2XZEA 3MKDA 3MJXA 3ZEFB 3LJCA 2B1EA 3CQXC 5E0OA 2LM2A 5JDMA 3ESLA 1XWMA 3C4XA 5LHIB 2X67A 3JCFA 2MOZA 4B3MT 1BR1A 4LF7T 5FY1A 2BVMA 2H88A 4IE6A 1X9BA 3N9PA 5FL0A 4JI2T 2D0TA 1FJGT 1M62A 5CA0E 3TKLB 1DU2A 4N78D 5IHYA 1MNEA 2JPFA 1G73A 5HWXA 4AQFA 4GYSA 2KT9A 2XASB 1D0XA 2D9DA 1J5WA 3KV4A 4NXMT 3N9LA 3BK9A 4EIWA 3ZJ2A 1UUSA 4EYYR 2KWHA 4LF5T 2JQHA 3RYCE 5LJMA 4HFEA 3ZYLA 3RKGA 4WZXA 3N2GE 5HCMA 4YJ2E 2VKJA 2FBWA 3CQGB 2CWYA 5AQSB 3ZC1A 1FMWA 5J2UE 4CXYA 2CBIA 2SPCA 4AKLA 5HEOA 2K3WA 1BR4A 3ETUA 4MLKA 3ZT5A 1HG2A 3LK3B 3PU3A 4PJJA 2KSRA 2Z6EA 2N2NA 2W00A 3H3MA 3M65A 5DABA 2R6GG 5HXEA 4DV5T 4H9OC 3ZMTB 1VOMA 1W09A 2XM2A 4DUYT 2FJAA 2X0HA 4ILAA 3N9QA 4TWHA 4G63A 5A1LA 4TV9E 2M67A 2JIWA 4MFRA 3TLTA 3RKOA 2Q9QD 2M6BA 3GMIA 3KV9A 3DJBA 4IE5A 3EDVA 3G06A 4X62T 3KBUA 1U4QA 2XQ8A 1Z8UA 2JMHA 5CB4E 5C2TA 2LEHA 2XQ9A 2X0YA 5IUXA 3P4RA 3OJAA 5LNKA 3L8RA 3NBXX 3F31A 2YKSA 2WMNA 1S94A 2ZM2A 4JI0T 3GN5B 2WMOA 2CLYB 2X9WA 2AXDS 2VL0A 5DQWA 4V1Av 2VQET 4PJLA 3KINB 3B5MA 2QRXA 2IDOB 4AISA 1NENA 5FXVA 3UTKA 5HEGA 2E5VA 5JH7E 2NR4A 2K9AA 5LJNA 4X1IE 5FXXA 4X20E 4O4LE 5FL1A 3E0ZA 2NP9A 1L0VA 2V6YB 4PK6A 3ZMSB 4JBWF 2XM1A 4FJOA 4AQGA 3QK6A 3GWHA 4H9RC 4ERRA 2W66A 5LB7B 4LF6T 5AQMB 4J2CA 5JDNA 1T72A 4H9SE 3AE9A 3RIUA 2Q9QA 4YMTB 4AKRB 2MPKA 2LOPA 4TN7B 4MALA 3SS1A 2RP4A 2CLYC 5HEJA 1YW0A 3MACA 4HKAA 3RX6A 2VVNA 1HR0T 4PNIA 2W63A 3EVYA 1XNRT 5H6RB 1XZYA 3FZKB 5J2TE 4YMVC 4YSYA 3CMLA 3A7MA 1SUMB 3C98B 3AEFA 4LF9T 4PJNA 3N9MA 3PUWF 3BQKA 4I55E 1HNWT 3N9OA 4ZZCA 3UU4A 4BAYB 2IUBA 3UUXB 4O4IE 4DR3T 2ACXA 3T8OA 4I43B 1QLBA 2H7OA 3KBTA 3N2KE 5L4HA 3HL6A 1D1BA 2V5CA 3HR0A 2N9DA 4UV8B 5AQPB 5HAXA 5J1GA 3RI5A 1I94T 4UV9B 1HNXT 2QGSA 2BKPA 3C51A 2YINA 2LHRA 5HXCA 2NW9A 2W2UA 2Y48B 2IC6A 3ZKRA 2LM9A 4DV6T 5L2LA 3FXEB 3NVOA 3E08A 3MK7C 4IL9A 2RPAA 3RIUC 2Q9QC 3RH3A 5AQIB 1IBLT 5KXJA 1N34T 3TLVA 3HI2A 4LMLA 5H6QB 1S35A 1SE7A 3L39A 2DI4A 3KDSE 4YY3T 5CGMA 4OFZA 3Q5WA 2G0UA 5F5WA 5JDHA 2HN1A 5AQUB 5LGTB 4QXBB 3ZT7A 3AE6A 4MHCA 4TX5A 4ZI7E 5HXSA 3ZN1B 4Q25A 2WS3A 4QKNA 5ABFA 3TLWA 4QH4A 3EAMA 1IZNB 2E9XD 4X65T 2UXBT 4U33A 1IBMT 3AE2A 3QB5A 2QVAA 1YKHB 4KX6A 2BVLA 1E1HB 2JJ9A 1SA0E 4IL4A 4AKHA 4ILCA 3CPZA 2H3RA 4JYAT 3PUWG 2LE8A 2IAKA 5ABFB 2XUEA 1YKEB 2CEAA 3WI3A 2BDEA 4ISTA 1XMQT 2C5IT 3FXDB 4JUYA 4LMKA 5AQLB 3HKEE 4IE0A 2UU9T 3NZQA 4M1PA 3UFGA 2DWGA 4C90A 2XPKA 1WYCA 1US7B 2H89A 3ZYMA 2CCQA 2ES0A 2CM0A 4CN4A 2HPLA 2YDQA 4IHJE 4EZ4A 4LFCT 3QUJA 4DMVA 3OKQA 3P4SA 3ZCJA 2CPTA 3ZN0B 1D1CA 3F2EA 4H9QC 4O4JE 3AE4A 1ZV4X 5BR8T 1XDPA 3ETVA 2LRLA 4PFOA 2XTLA 3W15B 1VRBA 4ZHQE 3ZSTA 4JLEA 3I0OA 4EAHA 2DL1A 5GONE 4OYJA 3JAEA 4UEMA 4CN6A 2M6IA 5HYAA 2D5UA 3T1YT 3V5SA 2E9XA 5FVLA 4PK5A 3K1SA 2NW7A 1I6ZA 2WB5A 2WWVA 3NRYA 4UF0B 3K3OA 2J1DG 5LGUB 3ANWA 4XTCN 4PAGA 3UU3A 1HX1B 2ODVA 2R6GF 2BKOA 2FUPA 1CUNA 2OA5A 5TAOA 2E9XB 3CX7B 2A72A 1D0YA 2BKNA 2LRKA 3R84B 2UXCT 2WDQA 3KV6A 4BA9A 3AXJA 3ANWB 3AB3B 3CX8B 3AA6B 3H3AA 4GK5E 3SFDA 1D0ZA 3UQ7A 5LG4A 1N36T 1WLXA 4OYKA 5AQQB 4XIGN 3PU8A 1XMOT 5AQGB 3AXJB 1MMAA 5IYZE 4GIWA 5LOVE 3U3IA 5LGNB 3WAJA 2XHEB 3AAAB 5JRCA 4CN1A 3AEDA 5HCJA 5AQRB 4X5TA 3PUVF 1MMDA 3I0QA 3IBPA 3PUYF 4YXDA 2E9XC 1WYBA 4P0BA 2GK9A 4GKJT 4IE7A 3ZPOA 4ILBA 3PDYA 1UK5A 2WCAA 2KZ7B 2CMRA 2BG9E 3RIFA 5AFUL 1SHZC 2YOEA 5LYJE 3SOLA 1MIWA 4MBQA 2D0UA 2VL8A 4LMJA 4PFPA 2LSKA 2V7KA 5FVKA 1KK7A 1BR2A 2LKHA 2E8IA 2WU2A 4OX9T 2FJBA 3ZCIA 4HN9A 4WBNE 2ZLYA 4K0KT 4YSZA 4UELA 4PK4A 1UCUA 2MAWA 4Z90A 3MA9A 1Y01A 4DO0A 4TWFA 3PUXG 2JQQA 4KUMB 4HFBA 2V5DA 2Y6XA 1U5PA 2A3DA 2K5BB 1UGOA 1V9DA 1X79A 4F8HA 2A2FX 2YU1A 2OLTA 4WYVA 4CXXA 4ZI3D 2J62A 4JI5T 5CJ5A 4JI7T 2EHOD 4EB6E 2WY2A 2WBLA 4XAXB 1AJ3A 5LG3A 1T7SA 1OEDE 3HKBE 3LK42 2PFVA 1QSDA 2N1GA 3PURA 2YK0A 4QXHB 3PUVG 3PUYG 2XQ4A 1VCTA 4IDNA 4GOUA 1HX8A 2YDRA 2AE9A 3KFWX 2XY8B 2VB6A 2XQ5A 3I1AA 3TLUA 3N9NA 5J0ZA 1ZKEA 1WFDA 2K24A 3UU8A 5FKYA 4HFDA 1T98A 4H9NC 3EHZA 2ZM8A 4OK0A 4HWFA 2KXPB 3AVSA 4AQYT 3PUAA 4NXNT 3P50A 4TV8E 1IBKT 1BR0A 2X51A 2ZM0A 3AE3A 4P1NA 3NWIA 4KBMB 4LF8T 4IDOA 1HNZT 3QOFA 4DIDB 3AVRA 3ONLC 3UT5E 3HA4A 5ABHA 2IHR1 5AQTB 1KNZA 3FBLA 3UUNA 2UXDT 3SFEA 5JDLA 4ISSA 2HHHT 1M7KA 3KVBA 2BS3A 2EHOA 4DR6T 2CXLA 2XQ6A 2C0SA 4EV6A 4LFAT 4NUUA 1J5ET 1KF6A 4L5GA 2Q9QB 1UURA 2NTYA 3PUSA 4DR4T 4B6XA 5ABEA 3H37A 2EHOB 2C5JA 2V6XA 1MIYA 4Z8XA 4E7SA 2LSYA 3K3NA 1EZ3A 1HFAA 5FP3A 4AI6A 4B3ST 4ZXLA 4HEAA 4NPPA 1D1AA 4X1YE 4DV0T 5LXTE 4P0AA 2ACZA 1NWMX 5CFBA 3VR9A 2BZBA 4UVCB 1NAFA 4ADZA 3VRBA 4U74A 4QX7B 3PUZF 1IAPA 3BQIA 4IDQA 4AKGA 1YQ4A 4TNVA 5ETWA 3CX6B 3RLFF 4IDZA 3AE1A 4H9PC 1ZP0A 2CXFA 3IEEA 2CXDA 4YHHT 4B3TT 2WM9A 4EEDA 3ZT6A 4DR5T 4GYRA 3ONXA 1UX5A 3CIRA 3IA3A 2W4XA 3RRCA 2E5LT 4ZI3C 5EZYE 5L3FB 5HXRA 4U7IA 4I0UA 3O1IA 4I50E 3PV0F 4FI5A 2EHOC 1FIOA 4G2AA 2ZM6T 4TQUN 5KX5E 3CWZB 2E2AA 1QUUA 4WBOA 4F6RC 1Z0PA 4X66T 5L47A 3PUQA 5DJQC 2VKDA 3MXZA 3N5LA 2MYSA 2J47A 1NEKA 2NWBA 4YMSC 2JRKA 3OVUA 3FB2A 4HGAA 1LVKA 4U31A 4U7YA 4EEBA 4QH1A 5JR9A 3AEGA 3PE0A 2VKOA 4DR1T 2YEVC 3B57A 2L3LA 5LHHB 2WZIA 4XBFB 3HKCE 4UVAB 3ZMZB 5F3JA 5EK3A 4TZ4C 2XQ7A 4O8SA 5EK2A 4ZEYA 3CKDA 3L09A 4BJNA 5JR9B 5C8YE 4IE4A 5L3GB 4IREA 3C4ZA 4HWDA 3FHNA 3O1JA 4YSXA 3PUZG 2KINB 4AKIA 3NRXA 4QH5A 2KNDA 3ONJA 3AEAA 3S4UA 2QYWA 4HWCA 4QX8B 4O2AE 3RLFG 3RRWA 3OBVE 3PUGA 2Y8DA 2PG8A 1LVFA 3FZHB 4U3CA 5L4EA 3P7IA 4HFVA 3LSVA 5AQNB 3DHWA 3K3QC 5EK4A 1WR0A 3PV0G 3FZMB 4KP3C 3O4XE 3PJAJ 2DWKA 5ABGA 3DTOA 3N2OA 2J4GA 2KWIB 5JR9C 2ONKC 5HXHA 3KV5A 1FEWA 4JI6T 1OEDC 3AEEA 2LSJA 1HCIA 3AA7B 4JI8T 4DUZT 3P4PA 2V26A 4CI2B 2V7MA 2JMKA 5FNVE 2VKHA 5AQJB 2DNXA 4CQIA 3BQLA 2CRBA 2H7VC 3L3PA 4KHPT 3QC9A 3ZMVB 3PUXF 1T8BA 4KHZG 4E7ZA 4DV7T 3QNUA 4JI4T 3I9WA 3A5XA 1W0BA 1OWAA 1MIVA 2WDVA 5LP6E 1KEYA 5DQVA 4BJMA 4ZI2D 4JV5T 1CHUA 2UUAT 3D0TA 1WCRA 3P8CD 3UQ4A 4CI1B 2CA5A 2XSBA 4QHOA 2WAUA 3O1HA 2LKGA 5LHGB 4X64T 5LBMA 3SRZA 4EYUA 4U2YA 3ZLIA 2L9QA 4EZHA 4CI3B 1N32T 4ANJA 3TUJA 4DR7T 3RQUA 3Q9DA 1MMGA 4YT0A 3T1HT 2HH7A 4HFHA 5AQFB 2YU2A 4HTEA 4UIGA 2PJQA 5JDQA 4YLHA 5JRCB 1YD8G 3ZSSA 4TNWA 3O9XA 3LBXA 2ODUA 3CQCB 2VASA 2X9XA 4JEUB 5LBQB 4WW0A 3K8PC 5F8PA 2L8KA 4HE8A 3LG7A 1J1JA 1R8IA 2VURA 2WSSV 4LF4T 4A98A 3LBXB 3M3ZB 4YTPA 4KI0F 1KNRA 3X1DA 2F4VT 3C50A 3HKDE 4YJ3E 2LSIA 4HWHA 1ZOYA 3R6NA 4H63H 2NOXA 3J9X1 4XTCM 1HS7A 4ZS3A 4IDPA 3AECA 1MMNA 4WNKA 3UULA 3NKZA 3MZKB 2I6HA 1IJ6A 1FMVA 2V7JA 2X9YA 5FYMA 3E22E 3CVRA 4YHJA 5HWYA 2FJEA 2FJDA 1MNDA 2IW5B 4NIQA 3RF1A 5AQOB 3RYIE 3J7Yq 2V8SV 5FY0A 2BBJA 3LK2B 3OYZA 4AQFC 4XIGM 3UUBA 2OV9A 2VQFT 4Z91A 3AAEB 2WZHA 2X68A 4COFA 4ASKA 3RPUA 4HFCA 2MTQA 4ZOLE 3UU5A 1GQEA 2XSAA 4XZCA 3GN5A 2XJ7A 1KNPA 3ZYKA 2JQKA 5JTGA 1JNRA 1W9RA 4DV2T 4QWNB 3V5UA 4IIJE 4KMCA 4IGUA 3VRAA 2LSGA 5IWAT 2W61A 4GK0E 3LDQB 4ZI2C 4ZS2A 2NTXA 5KMGP 4JI1T 4EXTA 4JI3T 1E2AA 2UUCT 3JC6D 2V6YA 4A56A 5AQHB 3D31C 2XQAA 3OYXA 5LA6E 5LCYA 2LOSA 4U72A 1YXRA 3JADA 4KI0G 1WRDA 4OHFA 3TUZA 5KDMC 3TLSA 4CXWA 4TWDA 2CHNA 2UXNB 3IF8B 1HF8A 5LMNT 3GA8A 5FY7A 5AQVB 2PTFA 4NUVA 3JAFA 3UUMA 5JVDE 1OXZA 4O2BE 4GKKT 3RGLA 3U78A 1W0AA 4L0RA 4PJMA 4DR2T 2WWUA 5JDFA 1XNQT 2X0LB 3AA1B 2V7LA 5HEUA 4DNDA 3RQWA 3IHRA 3RIAA 2XAHB 3LFMA 2VVSA 1LRZA 2V1DB 4YTNA 3VKGA 1LKXA 4DBQA 5LMUT 2CE7A 1G8XA 2KLQA 4C91A 2DCFA 2XQYA 2RA1A 3C64A 4QXCB 5ADXL 3VR8A 3RC8A 4AXPA 4YMWC 2LLYA 2BG9A 3KVAA 3Q5DA 1HTJF 4K0UA 5FMNA 3UU6A 4L9IA 2V7IA 4HFIA 4DVDA 4UVBB 4YFSA 5L3DB 5HEHA 3ZMUB 3DP7A 2VK9A 2W62A 5CA1E 1N33T 4DV1T 4UR9A 2CWOA 4B3RT 2XAJB 2BG9B 1YQ3A 3CK6A 5L3BB 2DLRA 2NW8A 1E7PA 1ZEEA 3TUIA 2IIUA 3AEBA 2C5KT 3PTRB 3Q2MA 2DHRA 4HWIB 5C3JA 5M4YA 4A5XA 2X66A 2MBGA 2BBHA 1ZHCA 2PBIA 2D2SA 2W67A 3FBZA 2VWAA 4AIUA 5FXZA 3RC3A 4JBWG 3OPCA 3NZPA 1KFYA 4DBRA 2BS4A 3FZLB 3RYHE 1JNZA 2HN2A 2UUBT 4DV3T 2ZMAA 1OEDA 2YN6A 4KHZF 3EABA 3JC6C 2WDRA 2BG9C 1Y64B 2CHOA 2WU5A 3EUHA 2XAQB 5L3CB 3EDUA 3EI0A 4CZZB 2LT3A 3ZC0A 2P9BA 4A97A 3B13A 3AE5A 4PW8A 2I59A 1OEDB 2X9HA 2XAFB 4DMWA 2KMFA 2YDSA 3AAIA 3I9YA 1B7TA 3P4WA 2K48A 5BMVE 2WP9A 3Q5EA 4EOZB 2IMLA 3AE7A 2JQ9A 3VKHA 2W0GA 2UXXB 3OTOT 4YMUC 1XDOA 5JREA 3SWHA 3RYFE 3P4QA
chains in the Genus database with same CATH topology
3PUXF 4JBWF 3PUXG 4JBWG 4XIGN 3PUVF 4KHZF 4TQUN 3PUYF 4KHZG 4YMVC 3PUVG 3TUJA 3PUYG 3TUIA 4YMSC 4KI0F 4XTCN 4KI0G 2ONKC 3PUZF 3PUZG 2R6GF 4YMWC 2R6GG 3TUZA 4XIGM 4TQUM 3PUWF 4YMTB 3RLFF 3DHWA 3PUWG 3PV0F 4YMUC 3RLFG 4XTCM 3D31C 3PV0G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX F;  4JBW F;  3PUX G;  4JBW G;  4XIG N;  3PUV F;  4KHZ F;  4TQU N;  3PUY F;  4KHZ G;  4YMV C;  3PUV G;  3TUJ A;  3PUY G;  3TUI A;  4YMS C;  4KI0 F;  4XTC N;  4KI0 G;  2ONK C;  3PUZ F;  3PUZ G;  2R6G F;  4YMW C;  2R6G G;  3TUZ A;  4XIG M;  4TQU M;  3PUW F;  4YMT B;  3RLF F;  3DHW A;  3PUW G;  3PV0 F;  4YMU C;  3RLF G;  4XTC M;  3D31 C;  3PV0 G; 
#chains in the Genus database with same CATH topology
 1UX4 A;  1O3X A;  2XAG B;  3C4W A;  3A8Y C;  3RHW A;  4DV4 T;  1IJ5 A;  3PJA A;  1H7C A;  4U2Z A;  2WQY A;  5AQK B;  2LJL A;  4H63 V;  3AA0 B;  4YTM A;  4LFB T;  1HG5 A;  2IC9 A;  3FZF B;  3ZJ1 A;  4ZZB A;  4ILU A;  3QB5 K;  5L3E B;  2BS2 A;  2CBJ A;  4P09 A;  3VHL A;  2B76 A;  2XQ3 A;  4TQU M;  4EGW A;  1VCS A;  4UF0 A;  5JQG E;  3F57 A;  4X1K E;  3ABV A;  4O4H E;  5FXW A;  4TUY E;  4UXN B;  4JEH B;  2I0M A;  3Q5X A;  2QA7 A;  2A9U A;  3AE8 A;  3UFE A;  2LHN A;  4IT4 A;  5JDG A;  3VU7 H;  1WR6 A;  3WAK A;  2HPJ A;  4I4T E;  2XZE A;  3MKD A;  3MJX A;  3ZEF B;  3LJC A;  2B1E A;  3CQX C;  5E0O A;  2LM2 A;  5JDM A;  3ESL A;  1XWM A;  3C4X A;  5LHI B;  2X67 A;  3JCF A;  2MOZ A;  4B3M T;  1BR1 A;  4LF7 T;  5FY1 A;  2BVM A;  2H88 A;  4IE6 A;  1X9B A;  3N9P A;  5FL0 A;  4JI2 T;  2D0T A;  1FJG T;  1M62 A;  5CA0 E;  3TKL B;  1DU2 A;  4N78 D;  5IHY A;  1MNE A;  2JPF A;  1G73 A;  5HWX A;  4AQF A;  4GYS A;  2KT9 A;  2XAS B;  1D0X A;  2D9D A;  1J5W A;  3KV4 A;  4NXM T;  3N9L A;  3BK9 A;  4EIW A;  3ZJ2 A;  1UUS A;  4EYY R;  2KWH A;  4LF5 T;  2JQH A;  3RYC E;  5LJM A;  4HFE A;  3ZYL A;  3RKG A;  4WZX A;  3N2G E;  5HCM A;  4YJ2 E;  2VKJ A;  2FBW A;  3CQG B;  2CWY A;  5AQS B;  3ZC1 A;  1FMW A;  5J2U E;  4CXY A;  2CBI A;  2SPC A;  4AKL A;  5HEO A;  2K3W A;  1BR4 A;  3ETU A;  4MLK A;  3ZT5 A;  1HG2 A;  3LK3 B;  3PU3 A;  4PJJ A;  2KSR A;  2Z6E A;  2N2N A;  2W00 A;  3H3M A;  3M65 A;  5DAB A;  2R6G G;  5HXE A;  4DV5 T;  4H9O C;  3ZMT B;  1VOM A;  1W09 A;  2XM2 A;  4DUY T;  2FJA A;  2X0H A;  4ILA A;  3N9Q A;  4TWH A;  4G63 A;  5A1L A;  4TV9 E;  2M67 A;  2JIW A;  4MFR A;  3TLT A;  3RKO A;  2Q9Q D;  2M6B A;  3GMI A;  3KV9 A;  3DJB A;  4IE5 A;  3EDV A;  3G06 A;  4X62 T;  3KBU A;  1U4Q A;  2XQ8 A;  1Z8U A;  2JMH A;  5CB4 E;  5C2T A;  2LEH A;  2XQ9 A;  2X0Y A;  5IUX A;  3P4R A;  3OJA A;  5LNK A;  3L8R A;  3NBX X;  3F31 A;  2YKS A;  2WMN A;  1S94 A;  2ZM2 A;  4JI0 T;  3GN5 B;  2WMO A;  2CLY B;  2X9W A;  2AXD S;  2VL0 A;  5DQW A;  4V1A v;  2VQE T;  4PJL A;  3KIN B;  3B5M A;  2QRX A;  2IDO B;  4AIS A;  1NEN A;  5FXV A;  3UTK A;  5HEG A;  2E5V A;  5JH7 E;  2NR4 A;  2K9A A;  5LJN A;  4X1I E;  5FXX A;  4X20 E;  4O4L E;  5FL1 A;  3E0Z A;  2NP9 A;  1L0V A;  2V6Y B;  4PK6 A;  3ZMS B;  4JBW F;  2XM1 A;  4FJO A;  4AQG A;  3QK6 A;  3GWH A;  4H9R C;  4ERR A;  2W66 A;  5LB7 B;  4LF6 T;  5AQM B;  4J2C A;  5JDN A;  1T72 A;  4H9S E;  3AE9 A;  3RIU A;  2Q9Q A;  4YMT B;  4AKR B;  2MPK A;  2LOP A;  4TN7 B;  4MAL A;  3SS1 A;  2RP4 A;  2CLY C;  5HEJ A;  1YW0 A;  3MAC A;  4HKA A;  3RX6 A;  2VVN A;  1HR0 T;  4PNI A;  2W63 A;  3EVY A;  1XNR T;  5H6R B;  1XZY A;  3FZK B;  5J2T E;  4YMV C;  4YSY A;  3CML A;  3A7M A;  1SUM B;  3C98 B;  3AEF A;  4LF9 T;  4PJN A;  3N9M A;  3PUW F;  3BQK A;  4I55 E;  1HNW T;  3N9O A;  4ZZC A;  3UU4 A;  4BAY B;  2IUB A;  3UUX B;  4O4I E;  4DR3 T;  2ACX A;  3T8O A;  4I43 B;  1QLB A;  2H7O A;  3KBT A;  3N2K E;  5L4H A;  3HL6 A;  1D1B A;  2V5C A;  3HR0 A;  2N9D A;  4UV8 B;  5AQP B;  5HAX A;  5J1G A;  3RI5 A;  1I94 T;  4UV9 B;  1HNX T;  2QGS A;  2BKP A;  3C51 A;  2YIN A;  2LHR A;  5HXC A;  2NW9 A;  2W2U A;  2Y48 B;  2IC6 A;  3ZKR A;  2LM9 A;  4DV6 T;  5L2L A;  3FXE B;  3NVO A;  3E08 A;  3MK7 C;  4IL9 A;  2RPA A;  3RIU C;  2Q9Q C;  3RH3 A;  5AQI B;  1IBL T;  5KXJ A;  1N34 T;  3TLV A;  3HI2 A;  4LML A;  5H6Q B;  1S35 A;  1SE7 A;  3L39 A;  2DI4 A;  3KDS E;  4YY3 T;  5CGM A;  4OFZ A;  3Q5W A;  2G0U A;  5F5W A;  5JDH A;  2HN1 A;  5AQU B;  5LGT B;  4QXB B;  3ZT7 A;  3AE6 A;  4MHC A;  4TX5 A;  4ZI7 E;  5HXS A;  3ZN1 B;  4Q25 A;  2WS3 A;  4QKN A;  5ABF A;  3TLW A;  4QH4 A;  3EAM A;  1IZN B;  2E9X D;  4X65 T;  2UXB T;  4U33 A;  1IBM T;  3AE2 A;  3QB5 A;  2QVA A;  1YKH B;  4KX6 A;  2BVL A;  1E1H B;  2JJ9 A;  1SA0 E;  4IL4 A;  4AKH A;  4ILC A;  3CPZ A;  2H3R A;  4JYA T;  3PUW G;  2LE8 A;  2IAK A;  5ABF B;  2XUE A;  1YKE B;  2CEA A;  3WI3 A;  2BDE A;  4IST A;  1XMQ T;  2C5I T;  3FXD B;  4JUY A;  4LMK A;  5AQL B;  3HKE E;  4IE0 A;  2UU9 T;  3NZQ A;  4M1P A;  3UFG A;  2DWG A;  4C90 A;  2XPK A;  1WYC A;  1US7 B;  2H89 A;  3ZYM A;  2CCQ A;  2ES0 A;  2CM0 A;  4CN4 A;  2HPL A;  2YDQ A;  4IHJ E;  4EZ4 A;  4LFC T;  3QUJ A;  4DMV A;  3OKQ A;  3P4S A;  3ZCJ A;  2CPT A;  3ZN0 B;  1D1C A;  3F2E A;  4H9Q C;  4O4J E;  3AE4 A;  1ZV4 X;  5BR8 T;  1XDP A;  3ETV A;  2LRL A;  4PFO A;  2XTL A;  3W15 B;  1VRB A;  4ZHQ E;  3ZST A;  4JLE A;  3I0O A;  4EAH A;  2DL1 A;  5GON E;  4OYJ A;  3JAE A;  4UEM A;  4CN6 A;  2M6I A;  5HYA A;  2D5U A;  3T1Y T;  3V5S A;  2E9X A;  5FVL A;  4PK5 A;  3K1S A;  2NW7 A;  1I6Z A;  2WB5 A;  2WWV A;  3NRY A;  4UF0 B;  3K3O A;  2J1D G;  5LGU B;  3ANW A;  4XTC N;  4PAG A;  3UU3 A;  1HX1 B;  2ODV A;  2R6G F;  2BKO A;  2FUP A;  1CUN A;  2OA5 A;  5TAO A;  2E9X B;  3CX7 B;  2A72 A;  1D0Y A;  2BKN A;  2LRK A;  3R84 B;  2UXC T;  2WDQ A;  3KV6 A;  4BA9 A;  3AXJ A;  3ANW B;  3AB3 B;  3CX8 B;  3AA6 B;  3H3A A;  4GK5 E;  3SFD A;  1D0Z A;  3UQ7 A;  5LG4 A;  1N36 T;  1WLX A;  4OYK A;  5AQQ B;  4XIG N;  3PU8 A;  1XMO T;  5AQG B;  3AXJ B;  1MMA A;  5IYZ E;  4GIW A;  5LOV E;  3U3I A;  5LGN B;  3WAJ A;  2XHE B;  3AAA B;  5JRC A;  4CN1 A;  3AED A;  5HCJ A;  5AQR B;  4X5T A;  3PUV F;  1MMD A;  3I0Q A;  3IBP A;  3PUY F;  4YXD A;  2E9X C;  1WYB A;  4P0B A;  2GK9 A;  4GKJ T;  4IE7 A;  3ZPO A;  4ILB A;  3PDY A;  1UK5 A;  2WCA A;  2KZ7 B;  2CMR A;  2BG9 E;  3RIF A;  5AFU L;  1SHZ C;  2YOE A;  5LYJ E;  3SOL A;  1MIW A;  4MBQ A;  2D0U A;  2VL8 A;  4LMJ A;  4PFP A;  2LSK A;  2V7K A;  5FVK A;  1KK7 A;  1BR2 A;  2LKH A;  2E8I A;  2WU2 A;  4OX9 T;  2FJB A;  3ZCI A;  4HN9 A;  4WBN E;  2ZLY A;  4K0K T;  4YSZ A;  4UEL A;  4PK4 A;  1UCU A;  2MAW A;  4Z90 A;  3MA9 A;  1Y01 A;  4DO0 A;  4TWF A;  3PUX G;  2JQQ A;  4KUM B;  4HFB A;  2V5D A;  2Y6X A;  1U5P A;  2A3D A;  2K5B B;  1UGO A;  1V9D A;  1X79 A;  4F8H A;  2A2F X;  2YU1 A;  2OLT A;  4WYV A;  4CXX A;  4ZI3 D;  2J62 A;  4JI5 T;  5CJ5 A;  4JI7 T;  2EHO D;  4EB6 E;  2WY2 A;  2WBL A;  4XAX B;  1AJ3 A;  5LG3 A;  1T7S A;  1OED E;  3HKB E;  3LK4 2;  2PFV A;  1QSD A;  2N1G A;  3PUR A;  2YK0 A;  4QXH B;  3PUV G;  3PUY G;  2XQ4 A;  1VCT A;  4IDN A;  4GOU A;  1HX8 A;  2YDR A;  2AE9 A;  3KFW X;  2XY8 B;  2VB6 A;  2XQ5 A;  3I1A A;  3TLU A;  3N9N A;  5J0Z A;  1ZKE A;  1WFD A;  2K24 A;  3UU8 A;  5FKY A;  4HFD A;  1T98 A;  4H9N C;  3EHZ A;  2ZM8 A;  4OK0 A;  4HWF A;  2KXP B;  3AVS A;  4AQY T;  3PUA A;  4NXN T;  3P50 A;  4TV8 E;  1IBK T;  1BR0 A;  2X51 A;  2ZM0 A;  3AE3 A;  4P1N A;  3NWI A;  4KBM B;  4LF8 T;  4IDO A;  1HNZ T;  3QOF A;  4DID B;  3AVR A;  3ONL C;  3UT5 E;  3HA4 A;  5ABH A;  2IHR 1;  5AQT B;  1KNZ A;  3FBL A;  3UUN A;  2UXD T;  3SFE A;  5JDL A;  4ISS A;  2HHH T;  1M7K A;  3KVB A;  2BS3 A;  2EHO A;  4DR6 T;  2CXL A;  2XQ6 A;  2C0S A;  4EV6 A;  4LFA T;  4NUU A;  1J5E T;  1KF6 A;  4L5G A;  2Q9Q B;  1UUR A;  2NTY A;  3PUS A;  4DR4 T;  4B6X A;  5ABE A;  3H37 A;  2EHO B;  2C5J A;  2V6X A;  1MIY A;  4Z8X A;  4E7S A;  2LSY A;  3K3N A;  1EZ3 A;  1HFA A;  5FP3 A;  4AI6 A;  4B3S T;  4ZXL A;  4HEA A;  4NPP A;  1D1A A;  4X1Y E;  4DV0 T;  5LXT E;  4P0A A;  2ACZ A;  1NWM X;  5CFB A;  3VR9 A;  2BZB A;  4UVC B;  1NAF A;  4ADZ A;  3VRB A;  4U74 A;  4QX7 B;  3PUZ F;  1IAP A;  3BQI A;  4IDQ A;  4AKG A;  1YQ4 A;  4TNV A;  5ETW A;  3CX6 B;  3RLF F;  4IDZ A;  3AE1 A;  4H9P C;  1ZP0 A;  2CXF A;  3IEE A;  2CXD A;  4YHH T;  4B3T T;  2WM9 A;  4EED A;  3ZT6 A;  4DR5 T;  4GYR A;  3ONX A;  1UX5 A;  3CIR A;  3IA3 A;  2W4X A;  3RRC A;  2E5L T;  4ZI3 C;  5EZY E;  5L3F B;  5HXR A;  4U7I A;  4I0U A;  3O1I A;  4I50 E;  3PV0 F;  4FI5 A;  2EHO C;  1FIO A;  4G2A A;  2ZM6 T;  4TQU N;  5KX5 E;  3CWZ B;  2E2A A;  1QUU A;  4WBO A;  4F6R C;  1Z0P A;  4X66 T;  5L47 A;  3PUQ A;  5DJQ C;  2VKD A;  3MXZ A;  3N5L A;  2MYS A;  2J47 A;  1NEK A;  2NWB A;  4YMS C;  2JRK A;  3OVU A;  3FB2 A;  4HGA A;  1LVK A;  4U31 A;  4U7Y A;  4EEB A;  4QH1 A;  5JR9 A;  3AEG A;  3PE0 A;  2VKO A;  4DR1 T;  2YEV C;  3B57 A;  2L3L A;  5LHH B;  2WZI A;  4XBF B;  3HKC E;  4UVA B;  3ZMZ B;  5F3J A;  5EK3 A;  4TZ4 C;  2XQ7 A;  4O8S A;  5EK2 A;  4ZEY A;  3CKD A;  3L09 A;  4BJN A;  5JR9 B;  5C8Y E;  4IE4 A;  5L3G B;  4IRE A;  3C4Z A;  4HWD A;  3FHN A;  3O1J A;  4YSX A;  3PUZ G;  2KIN B;  4AKI A;  3NRX A;  4QH5 A;  2KND A;  3ONJ A;  3AEA A;  3S4U A;  2QYW A;  4HWC A;  4QX8 B;  4O2A E;  3RLF G;  3RRW A;  3OBV E;  3PUG A;  2Y8D A;  2PG8 A;  1LVF A;  3FZH B;  4U3C A;  5L4E A;  3P7I A;  4HFV A;  3LSV A;  5AQN B;  3DHW A;  3K3Q C;  5EK4 A;  1WR0 A;  3PV0 G;  3FZM B;  4KP3 C;  3O4X E;  3PJA J;  2DWK A;  5ABG A;  3DTO A;  3N2O A;  2J4G A;  2KWI B;  5JR9 C;  2ONK C;  5HXH A;  3KV5 A;  1FEW A;  4JI6 T;  1OED C;  3AEE A;  2LSJ A;  1HCI A;  3AA7 B;  4JI8 T;  4DUZ T;  3P4P A;  2V26 A;  4CI2 B;  2V7M A;  2JMK A;  5FNV E;  2VKH A;  5AQJ B;  2DNX A;  4CQI A;  3BQL A;  2CRB A;  2H7V C;  3L3P A;  4KHP T;  3QC9 A;  3ZMV B;  3PUX F;  1T8B A;  4KHZ G;  4E7Z A;  4DV7 T;  3QNU A;  4JI4 T;  3I9W A;  3A5X A;  1W0B A;  1OWA A;  1MIV A;  2WDV A;  5LP6 E;  1KEY A;  5DQV A;  4BJM A;  4ZI2 D;  4JV5 T;  1CHU A;  2UUA T;  3D0T A;  1WCR A;  3P8C D;  3UQ4 A;  4CI1 B;  2CA5 A;  2XSB A;  4QHO A;  2WAU A;  3O1H A;  2LKG A;  5LHG B;  4X64 T;  5LBM A;  3SRZ A;  4EYU A;  4U2Y A;  3ZLI A;  2L9Q A;  4EZH A;  4CI3 B;  1N32 T;  4ANJ A;  3TUJ A;  4DR7 T;  3RQU A;  3Q9D A;  1MMG A;  4YT0 A;  3T1H T;  2HH7 A;  4HFH A;  5AQF B;  2YU2 A;  4HTE A;  4UIG A;  2PJQ A;  5JDQ A;  4YLH A;  5JRC B;  1YD8 G;  3ZSS A;  4TNW A;  3O9X A;  3LBX A;  2ODU A;  3CQC B;  2VAS A;  2X9X A;  4JEU B;  5LBQ B;  4WW0 A;  3K8P C;  5F8P A;  2L8K A;  4HE8 A;  3LG7 A;  1J1J A;  1R8I A;  2VUR A;  2WSS V;  4LF4 T;  4A98 A;  3LBX B;  3M3Z B;  4YTP A;  4KI0 F;  1KNR A;  3X1D A;  2F4V T;  3C50 A;  3HKD E;  4YJ3 E;  2LSI A;  4HWH A;  1ZOY A;  3R6N A;  4H63 H;  2NOX A;  3J9X 1;  4XTC M;  1HS7 A;  4ZS3 A;  4IDP A;  3AEC A;  1MMN A;  4WNK A;  3UUL A;  3NKZ A;  3MZK B;  2I6H A;  1IJ6 A;  1FMV A;  2V7J A;  2X9Y A;  5FYM A;  3E22 E;  3CVR A;  4YHJ A;  5HWY A;  2FJE A;  2FJD A;  1MND A;  2IW5 B;  4NIQ A;  3RF1 A;  5AQO B;  3RYI E;  3J7Y q;  2V8S V;  5FY0 A;  2BBJ A;  3LK2 B;  3OYZ A;  4AQF C;  4XIG M;  3UUB A;  2OV9 A;  2VQF T;  4Z91 A;  3AAE B;  2WZH A;  2X68 A;  4COF A;  4ASK A;  3RPU A;  4HFC A;  2MTQ A;  4ZOL E;  3UU5 A;  1GQE A;  2XSA A;  4XZC A;  3GN5 A;  2XJ7 A;  1KNP A;  3ZYK A;  2JQK A;  5JTG A;  1JNR A;  1W9R A;  4DV2 T;  4QWN B;  3V5U A;  4IIJ E;  4KMC A;  4IGU A;  3VRA A;  2LSG A;  5IWA T;  2W61 A;  4GK0 E;  3LDQ B;  4ZI2 C;  4ZS2 A;  2NTX A;  5KMG P;  4JI1 T;  4EXT A;  4JI3 T;  1E2A A;  2UUC T;  3JC6 D;  2V6Y A;  4A56 A;  5AQH B;  3D31 C;  2XQA A;  3OYX A;  5LA6 E;  5LCY A;  2LOS A;  4U72 A;  1YXR A;  3JAD A;  4KI0 G;  1WRD A;  4OHF A;  3TUZ A;  5KDM C;  3TLS A;  4CXW A;  4TWD A;  2CHN A;  2UXN B;  3IF8 B;  1HF8 A;  5LMN T;  3GA8 A;  5FY7 A;  5AQV B;  2PTF A;  4NUV A;  3JAF A;  3UUM A;  5JVD E;  1OXZ A;  4O2B E;  4GKK T;  3RGL A;  3U78 A;  1W0A A;  4L0R A;  4PJM A;  4DR2 T;  2WWU A;  5JDF A;  1XNQ T;  2X0L B;  3AA1 B;  2V7L A;  5HEU A;  4DND A;  3RQW A;  3IHR A;  3RIA A;  2XAH B;  3LFM A;  2VVS A;  1LRZ A;  2V1D B;  4YTN A;  3VKG A;  1LKX A;  4DBQ A;  5LMU T;  2CE7 A;  1G8X A;  2KLQ A;  4C91 A;  2DCF A;  2XQY A;  2RA1 A;  3C64 A;  4QXC B;  5ADX L;  3VR8 A;  3RC8 A;  4AXP A;  4YMW C;  2LLY A;  2BG9 A;  3KVA A;  3Q5D A;  1HTJ F;  4K0U A;  5FMN A;  3UU6 A;  4L9I A;  2V7I A;  4HFI A;  4DVD A;  4UVB B;  4YFS A;  5L3D B;  5HEH A;  3ZMU B;  3DP7 A;  2VK9 A;  2W62 A;  5CA1 E;  1N33 T;  4DV1 T;  4UR9 A;  2CWO A;  4B3R T;  2XAJ B;  2BG9 B;  1YQ3 A;  3CK6 A;  5L3B B;  2DLR A;  2NW8 A;  1E7P A;  1ZEE A;  3TUI A;  2IIU A;  3AEB A;  2C5K T;  3PTR B;  3Q2M A;  2DHR A;  4HWI B;  5C3J A;  5M4Y A;  4A5X A;  2X66 A;  2MBG A;  2BBH A;  1ZHC A;  2PBI A;  2D2S A;  2W67 A;  3FBZ A;  2VWA A;  4AIU A;  5FXZ A;  3RC3 A;  4JBW G;  3OPC A;  3NZP A;  1KFY A;  4DBR A;  2BS4 A;  3FZL B;  3RYH E;  1JNZ A;  2HN2 A;  2UUB T;  4DV3 T;  2ZMA A;  1OED A;  2YN6 A;  4KHZ F;  3EAB A;  3JC6 C;  2WDR A;  2BG9 C;  1Y64 B;  2CHO A;  2WU5 A;  3EUH A;  2XAQ B;  5L3C B;  3EDU A;  3EI0 A;  4CZZ B;  2LT3 A;  3ZC0 A;  2P9B A;  4A97 A;  3B13 A;  3AE5 A;  4PW8 A;  2I59 A;  1OED B;  2X9H A;  2XAF B;  4DMW A;  2KMF A;  2YDS A;  3AAI A;  3I9Y A;  1B7T A;  3P4W A;  2K48 A;  5BMV E;  2WP9 A;  3Q5E A;  4EOZ B;  2IML A;  3AE7 A;  2JQ9 A;  3VKH A;  2W0G A;  2UXX B;  3OTO T;  4YMU C;  1XDO A;  5JRE A;  3SWH A;  3RYF E;  3P4Q A; 
#chains in the Genus database with same CATH homology
 3PUX F;  4JBW F;  3PUX G;  4JBW G;  4XIG N;  3PUV F;  4KHZ F;  4TQU N;  3PUY F;  4KHZ G;  4YMV C;  3PUV G;  3TUJ A;  3PUY G;  3TUI A;  4YMS C;  4KI0 F;  4XTC N;  4KI0 G;  2ONK C;  3PUZ F;  3PUZ G;  2R6G F;  4YMW C;  2R6G G;  3TUZ A;  4XIG M;  4TQU M;  3PUW F;  4YMT B;  3RLF F;  3DHW A;  3PUW G;  3PV0 F;  4YMU C;  3RLF G;  4XTC M;  3D31 C;  3PV0 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...