The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
66
|
structure length |
66
|
Chain Sequence |
ANQASVVANQLIPINTALNLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Quantitative and qualitative analysis of type III antifreeze protein structure and function.
pubmed doi rcsb |
molecule tags |
Antifreeze protein
|
source organism |
Macrozoarces americanus
|
molecule keywords |
PROTEIN (ANTIFREEZE PROTEIN TYPE III)
|
total genus |
15
|
structure length |
66
|
sequence length |
66
|
ec nomenclature | |
pdb deposition date | 1999-01-24 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Type Iii Antifreeze Protein Isoform Hplc 12 | Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain |
#chains in the Genus database with same CATH superfamily 6MSI A; 1MSJ A; 2MSI A; 1B7K A; 4IPI A; 1UCS A; 1XUU A; 1GZI A; 4NY6 A; 4IPJ A; 4MSI A; 1C8A A; 1EKL A; 7MSI A; 1B7J A; 8MSI A; 1C89 A; 9MSI A; 1KDF A; 1OPS A; 1HG7 A; 1MSI A; 1XUZ A; 2SPG A; 3QF6 A; 2LX2 A; 9AME A; 3CM4 A; 3FRN A; 2WQP A; 3AME A; 1AME A; 1B7I A; 1JAB A; 2LX3 A; 4AME A; 7AME A; 3MSI A; 2ZDR A; 5MSI A; 2JIA A; 2AME A; 2MSJ A; 3G8R A; 3NLA A; 4UR6 A; 3RDN A; 6AME A; 8AME A; 1KDE A; 1WVO A; 1VLI A; 4UR4 A; #chains in the Genus database with same CATH topology 6MSI A; 1MSJ A; 2MSI A; 1B7K A; 4IPI A; 1UCS A; 1XUU A; 1GZI A; 4NY6 A; 4IPJ A; 4MSI A; 1C8A A; 1EKL A; 7MSI A; 1B7J A; 8MSI A; 1C89 A; 9MSI A; 1KDF A; 3LAZ A; 1OPS A; 1HG7 A; 1MSI A; 1XUZ A; 2SPG A; 3QF6 A; 2LX2 A; 9AME A; 3CM4 A; 3FRN A; 2WQP A; 3AME A; 1AME A; 1B7I A; 1JAB A; 2LX3 A; 3K3S A; 4AME A; 7AME A; 3MSI A; 2ZDR A; 5MSI A; 2JIA A; 2AME A; 2MSJ A; 3G8R A; 3NLA A; 4UR6 A; 3RDN A; 6AME A; 8AME A; 1KDE A; 1WVO A; 1VLI A; 4UR4 A; #chains in the Genus database with same CATH homology 6MSI A; 1MSJ A; 2MSI A; 1B7K A; 4IPI A; 1UCS A; 1XUU A; 1GZI A; 4NY6 A; 4IPJ A; 4MSI A; 1C8A A; 1EKL A; 7MSI A; 1B7J A; 8MSI A; 1C89 A; 9MSI A; 1KDF A; 1OPS A; 1HG7 A; 1MSI A; 1XUZ A; 2SPG A; 3QF6 A; 2LX2 A; 9AME A; 3CM4 A; 3FRN A; 2WQP A; 3AME A; 1AME A; 1B7I A; 1JAB A; 2LX3 A; 4AME A; 7AME A; 3MSI A; 2ZDR A; 5MSI A; 2JIA A; 2AME A; 2MSJ A; 3G8R A; 3NLA A; 4UR6 A; 3RDN A; 6AME A; 8AME A; 1KDE A; 1WVO A; 1VLI A; 4UR4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...