The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
8
|
sequence length |
102
|
structure length |
102
|
Chain Sequence |
APSCPAGSLCTYSGTGLSGARTVIPASDMEKAGTDGVKLPASARSFANGTHFTLRYGPARKVTCVRFPCYQYATVGKVAPGAQLRSLPSPGATVTVGQDLGD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR structure of the Streptomyces metalloproteinase inhibitor, SMPI, isolated from Streptomyces nigrescens TK-23: another example of an ancestral beta gamma-crystallin precursor structure.
pubmed doi rcsb |
| molecule keywords |
METALLOPROTEINASE INHIBITOR
|
| molecule tags |
Metalloproteinase inhibitor
|
| source organism |
Streptomyces nigrescens
|
| total genus |
8
|
| structure length |
102
|
| sequence length |
102
|
| ec nomenclature | |
| pdb deposition date | 1998-06-10 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Gamma-B Crystallin; domain 1 | Gamma-B Crystallin; domain 1 |
#chains in the Genus database with same CATH superfamily 1C01 A; 1F53 A; 1BHU A; 1GH5 A; 1G6E A; #chains in the Genus database with same CATH topology 2JDG A; 1GH5 A; 3QK3 A; 3ENT A; 3CW3 A; 1OKI A; 1AG4 A; 1ZWO A; 2KFB A; 3SO0 A; 1F53 A; 2A5M A; 1A7H A; 4AKA A; 2BV2 A; 1ZGT A; 1H4A X; 2KP5 A; 1PRR A; 2BB2 A; 1ELP A; 1HK0 X; 3SO1 A; 5HT8 A; 2DAD A; 4IAU A; 3LWK A; 1PRS A; 4JGF A; 2K1X A; 1BD7 A; 1I5I A; 3HZB A; 3I9H A; 2K1W A; 1AMM A; 1NPS A; 1A45 A; 2M3T A; 1YHP A; 2V2U A; 1YTQ A; 1GAM A; 4PSP A; 4W9B A; 3SNY A; 1ZIR A; 1DSL A; 2M3C A; 2B1O A; 2G98 A; 1BHU A; 1BLB A; 4W9A A; 2JDF A; 1ZIQ A; 1M8U A; 3ENU A; 1HDF A; 1G6E A; 4NI3 A; 3SNZ A; 5HT9 A; 4GCR A; 1GCS A; 2M3U A; 4FD9 A; 1C01 A; 4PSR A; 2NBR A; 3UJZ A; 1E7N A; 3HZ2 A; 4EL6 A; 1ZIE A; 1WKT A; 1ZWM A; 1A5D A; 3IAJ A; 4GR7 A; 1HA4 A; #chains in the Genus database with same CATH homology 1WKT A; 1C01 A; 1F53 A; 3UJZ A; 1BHU A; 1GH5 A; 1G6E A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...