1YHPA

Solution structure of ca2+-free ddcad-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
212
structure length
212
Chain Sequence
SVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords Calcium-dependent cell adhesion molecule-1
total genus 33
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08964 Crystall_3 Beta/Gamma crystallin
A PF14564 Membrane_bind Membrane binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.20.10 Mainly Beta Sandwich Gamma-B Crystallin; domain 1 Crystallins 1yhpA01
2.60.40.1720 Mainly Beta Sandwich Immunoglobulin-like Calcium-dependent cell adhesion molecule-1 1yhpA02
3SNYA 2K1WA 1ZIRA 1ZIQA 2JDGA 3CW3A 3ENTA 3HZ2A 1PRRA 1M8UA 2M3TA 2KFBA 2JDFA 4IAUA 4W9AA 1PRSA 4JGFA 1ZWOA 2DADA 5HT8A 1A45A 1AG4A 2B1OA 3QK3A 1HA4A 2V2UA 2G98A 1GAMA 1ZWMA 4FD9A 3SO1A 2A5MA 1I5IA 3ENUA 1AMMA 1A5DA 4AKAA 1ZIEA 2BB2A 4NI3A 4GR7A 1GCSA 3SO0A 1ELPA 3I9HA 4PSPA 2M3CA 2K1XA 1BD7A 2NBRA 1A7HA 1HDFA 1H4AX 1ZGTA 1YTQA 3HZBA 3SNZA 1HK0X 1E7NA 1YHPA 4EL6A 4W9BA 1NPSA 1DSLA 1OKIA 2M3UA 4PSRA 5HT9A 4GCRA 1BLBA 3LWKA 3IAJA 2KP5A 2BV2A
chains in the Genus database with same CATH superfamily
2ZXDA 1G7QB 5HHQA 4HJJL 3UDWC 1XIWC 3K6OA 4YSUA 1A6VH 3BGAA 1MLCB 1NEZG 2OULB 2WKOF 1PDKA 1TVDA 2WTRB 3FO1B 1FIGL 5DTFB 2IAMA 3ARED 4OLWH 3ZPDA 1WFJA 2HT2D 4DOHE 4LCWA 3KDPB 4Z7AA 1TDQA 4K5PA 4FD0A 1FYTD 1PG7X 4WDIA 2V7HA 3W0WA 1KDJA 1ZOXA 4OT1H 3PWUB 1NICA 2BZ7A 2BPBA 4ODVL 1DVQA 4HUVA 3RI5F 4FXKC 4CUCA 3KPPB 2AZUA 1C5DA 4WV1C 4V1DA 4NERA 1KIUA 3HG2A 1CGSH 5I1LB 2JKXA 4JS7A 5ITBH 3CFBA 3RAJH 2DLHA 1CI3M 4RRPG 4XAWH 4KY2A 4HIIA 4P4RB 4NGHL 4JAMA 2J8UF 4GOSA 3DX3A 5K9KB 4NZRL 5I76A 4TXVB 4PRIA 3KLAA 5DYOA 1Y6NR 3E2HC 3GHEL 3HAEB 5CILH 3MI6A 4PS8A 4A2EA 4KKLC 3DURB 2O61A 2WGNB 4JFEB 2R9HD 5E4EC 1EJOH 5HYQA 4G7QB 2WLLB 1EFXB 4I7ZC 5DF0A 3KVPA 2NQ3A 3P4MA 4XOCA 1XBDA 3TVMB 4N5UA 1C7SA 5FDYA 4OD3H 1QBML 3STZB 3PWPD 4C4UA 2CGZA 3IDMB 4LT7A 4Y5YB 3RWGB 2QQLH 3SE3A 3ZTNH 4ANXA 2R2EA 4XNZB 4CGUB 1KGUA 2CCWA 5HHOD 1JNLL 1KLGA 1X5AA 4IIQB 4QHMB 5JDSA 3V0AC 5JPNB 4KJPC 4Z95L 4NCDA 3AFLA 1MLBB 1PLBA 1AZCA 3OMZA 5EEZA 1QUPA 3RNQB 3K81A 4OF3A 2NY0D 1M6UA 5ISZB 1CL7I 5B7FA 5FGCE 2XETA 5D1QD 3VXME 3HG1A 4OGXL 1MJ8L 4WUUE 3KLSA 3QIUB 3OLDA 4GIAA 3WDJA 5E6ZA 2QLYA 3DO4A 5GRZA 4YZWA 3VXRD 2CALA 2XQBL 5KVGE 5I73C 3Q1EA 3VVVA 3WJJA 4XMLL 1T7YA 3CLWA 4P4KA 2GB2A 3CZJA 4M6MH 4Z7VA 1S4IA 2YWYA 4OD3L 3KXFE 4KRPD 1FFTB 5I9QB 5AW3B 3ZDXE 4BKSC 3MRLB 4IRJD 3RVXD 1Y18B 2R29L 3UAJC 4YDJB 5I1HH 1Q9WA 1WEJH 2W0LA 3GJFK 1YUHB 1I9RL 3T8XA 1FNFA 4OFQA 3GEWB 5C09E 1R5VB 2DWEA 2VLJB 1VB9A 1XF5B 2QELA 3RWCA 3CZLA 3FYEB 1JZFA 4W81A 1OHQA 1YN7B 3CVHB 4IK6A 3DTDA 2GCYB 3LEVH 3CFEB 3ATFA 3B9DA 3LXAA 3KLKA 1ZLSL 4WI7A 4EKXA 1BOGB 4GY4A 4PJXF 4PS3A 4J39A 4HIEB 3VI4B 4JN2B 2R2HA 4JANB 5MI0B 4MB4A 3ZO9A 4LDCA 3D8MA 3HC3H 3SHSA 1KCRH 1ZS2A 1ITBB 3QRGL 1LGVA 4B9CA 4L4TE 3HVNA 1HESA 4N68A 2WSPA 5TGBA 3D9AL 4R0LA 2YXWA 2I26N 3HN5A 3VGAB 2YJQA 3IGFA 4LU5L 3EDKA 3TBWA 4HWEL 1IZKA 1JHLL 3RDTC 3BIBX 3CVIL 4FFWD 4AEHH 4PY8I 3Q1SL 5BXFB 5AW6B 1AYRA 4W9JC 4F2MB 4AKQA 4FI6A 2DMGA 4DW2H 2GG1A 3STBA 5J89A 1S9XA 3K2KA 1TZHA 4IMKC 4G8IB 1RAMA 1YLBB 1BVOA 1N6VA 3O8XD 3LB6D 4P3CH 3U2IA 3V0HA 4I0PA 4E9VA 2EVGA 2DLFL 4PVBA 3T0WA 2VDKB 1B0RA 2ZF9A 1BFOA 2ZSVB 5F89B 3ZT5A 2YEZB 2KI6A 1KJVA 4JCWA 4PJHE 2ATAA 4FRWA 3IJ8A 1RZKL 2XU9A 2ADJA 4HZ1A 2X4SB 4OCYH 4UUJB 3ZU8A 5L7XH 1P4LA 2YA1A 4RMWA 3TEYA 4QF1A 5FYKL 2YSSB 4XMLH 5M7QA 1MHHA 2DMCA 1DQDL 5T33H 5DWUL 4RBPH 2R2HB 5FK9B 3KXFB 4QTHA 3VO0A 3ARWA 4QNPE 5KVDE 2HTLC 5I19L 1IE4A 1PNCA 3OLEA 1RFDL 4ZMLA 5ACZA 3SJVA 3IJYA 3SD2A 4ZAKD 4ODSL 4JJ5B 2F58H 2R8SL 2FO4B 2H5UA 3JYBA 2FYYB 1U8MB 3MLTA 2CGRH 3MRFA 4X6EB 2VIRA 3DGGB 12E8H 1DVXA 2WBWB 1KPRA 3DSNA 5DEGB 4JVWA 4P5KA 4JQXA 3V55A 5JW4M 5IFAL 3VU1A 4OLZH 3F7VB 4XO5A 3VD7A 4BELD 3FPYA 4AC2A 3BVNB 1FDLL 3X3GL 1PD1A 4FQQB 2UYLB 4M9OA 1MHEA 2QTVA 2YKKA 3ZO0A 3UGEA 3L4YA 5C7XL 3UTZB 2EEAA 3WS3B 5IQ7L 3QYMA 3FB7A 4OJCA 3GBNH 3KBEA 2JCCA 3Q01A 1J5DA 2PYED 5C6TL 2V4LA 2CO6A 1LEGA 3CW3A 2C7FA 1HILA 2VZ1A 4GS7C 2LVEA 3OKEB 4R4NC 2HLFD 5EN3A 5DMKB 3SQBB 5KN5A 5TK2A 3QAZC 2BFGA 5DJYA 1CFTB 1Z9MA 3NSJA 1CFBA 4FP8L 2YSSA 1F6AB 3QJVB 1G43A 1I9EA 3O3BA 4P57B 5FYKH 1EHLL 2XSKA 4GP8B 4NN6B 5IFJA 3GTTA 4NJ9L 3BAJA 4OCYL 2PR4L 1UWGL 3BXNA 3DX9A 3Q6GL 2GYSA 1QWUA 3VXTA 4XGZB 4LNVA 2NY0B 1NOAA 2F2HA 5ISZD 5FYLL 3ZZLA 3QEUA 1QO3B 1JXKA 2R69L 2VDML 1IBZA 5HYSB 3SDDA 4M1CC 4AQ8C 4XMWA 4JPVH 2IXQA 4PJFF 3TBVA 1KCKA 3MJ9H 3WIIH 1LXMA 1JWSB 1CE1L 3QIUD 4LASH 5F7DB 3T4AA 4Y5XA 5IROA 5HHXH 3CVIH 3V9EA 3TVMA 3L3OC 3MV9B 4RMTA 5FV2A 2BWDA 3OR6A 3CX5J 4MJHA 3RQ3A 2FX9H 2FUTA 2VLLA 3H85A 4MZ3A 2ISDA 2I5YH 4PJGF 3GUFA 1XGYL 4ZPTB 1CF8H 3ASOB 3FQRA 2JCCB 3BAWA 3VFRB 1X6NA 2VZVA 3IS0X 1G6RL 4FYQA 1X6LA 3BKJL 3QEGH 2BNRA 3INUH 3DX0A 2P48B 4LVOC 4JY6A 2ARJB 4GQRA 5JXED 5DJYB 2I24N 2W8CA 3RVUD 3B2UC 1UWEH 1KYDA 1S3KL 2DY2A 3VXRA 3BSZA 5BV7B 2QADC 4JY4A 3WY1A 4ZS6C 3SY6A 3QK0A 5B1JA 2IQAB 3C8DA 1AMXA 3HZVA 2BCKA 3EJTA 1TJIH 1QACA 3V6FB 3QIUA 1QOKA 1I7UA 2IALB 1NGPH 1BAWA 3I3BA 3QR0A 4Y0GA 1FYHB 5IUSA 5F6IC 4D3CL 3E0GA 1RH8A 4KK5D 4MVBD 2QV2A 2J72A 2YGPA 2J44A 1PQZB 5A3ID 3ZX1A 3OKDB 3FFCA 4H26B 4YWGL 1CD9B 4QXUL 4UT9L 3G6JF 5I1AA 1N6QL 3GS4A 1OF2A 4JM4H 3MRNA 4IKLA 5LG6A 4HV8B 4OV6F 1QFPA 1AACA 4MDIB 2OJEA 5TE7H 1T0NA 1K4DA 2XVLA 2QR0A 1PY4A 4NHCL 2V17H 3MV9A 4GSUA 1OPOA 5B4MC 6FABL 1MREH 3BPOC 4I77L 5IV2B 3PABB 3MBWA 4FKKA 4K71B 4JM0A 1KJ2A 1IM9A 1AKJA 1JTPA 3DX2A 4WI8A 1I8LA 3O9WA 3RPBA 2G3MA 5JZ7C 4IBZA 1AZRA 4D2NA 4IW4C 1F42A 1OWWA 1MDAA 3GXPA 4UOQA 3WE6B 3CN1A 1BREA 4HIEA 2H47C 2FEDD 1J7VR 4Y1SA 4XMPL 1MVYA 3VXMB 3MSPA 3KHQA 4FE9A 4KXBA 1IJ9A 4NQEE 1CFSA 1KN4H 5TDOA 3O0LA 3QWNA 4L5FL 1CFVH 3LEXA 4LSQH 4NZUL 1CT8A 4YSEA 1FZKA 5K5YA 2J1WA 3MODL 3NTCH 3QRFM 4M7JH 3M1BA 4FADA 2EDEA 4Z7OB 1DUYA 2OJZL 2E3VA 3WOVA 2GK0B 5FCSH 2Z1KA 1U4EA 3MRDA 4OZHB 1GJUA 1E9QA 3T2NH 5LAXA 1D6VH 1WBZB 1HWHB 5ESQA 2ODHA 4Q9RH 3M07A 1FNLA 2JF1A 2V6HA 3QJXA 1CTNA 5D2LA 2Q6WB 3UO1L 3CN4A 5HJ3A 4BUHA 4MS8D 1BJ8A 4KQ4H 5I82A 4DGWC 2G3NA 3S48A 5DEFA 2C1OA 5EV7A 3CNKA 2YKLH 5TDOB 1ITCA 3HNVL 3C08H 3OGCA 3IBOA 1M7IA 2QZQA 3DO3A 2Z9TA 4O2FA 1U36A 4YDVB 5B4MD 1KMGA 3PWLA 2K9FB 2XICA 3QUXA 1FJ1B 4KNSA 4LDLB 1XSIA 3VB9A 3SKJL 1FNHA 3O9WB 4CBPA 4G5ZL 2OI9C 4JRYE 2NUPB 2EVHA 1QLRB 2KPNA 3KPMA 1I5IA 4MJ5A 4MJJA 1YQVH 2Q6WA 5K69A 3EADA 5M94B 1UB5A 3V7MA 3P4OB 5CJ5A 3NFSL 5DHVH 5J6GB 3NQIA 2KZKA 4LVNC 2W5PA 3MRQA 3O0RL 4PJEA 3GNML 5AWNL 2DQTH 1E9PA 3IDIA 3Q2LA 1AGCB 4TUKH 3VI3B 25C8H 3OQ3B 2BJMH 2AW2A 3OAZK 4G8GA 3MGTB 3WN6A 4HEMA 1WWCA 1YQVL 3L3IB 1JI1A 3AM8C 1OSYA 5T1MA 1SF5A 4JCLA 1HHGB 1UH3A 2JKTM 5IMKB 1V5JA 4MD5A 3CG8A 5KYYB 2ZXCA 1RPQA 1VGKB 3MLRL 4UM9A 4JKMA 5T1LA 2RGSA 5HDBF 1J8HE 4K5NA 3W37A 3MROB 2W60B 2RA1A 4CU7A 3K2IA 3MLYH 1IBFA 2J56A 3G6JE 5JPNC 5GJSH 43C9A 1FG2A 2XG4A 4WSJA 3AWFA 3CX5K 4TTDC 1KJ3L 3UO1H 4C56E 3H9SB 1FVDB 2WP3T 4JFQB 1AP2A 4XNAA 2BY3A 3KXFD 4AKOA 4WTXA 3QIUC 3BVTA 3UP6A 5DGQA 4AV5A 5KANI 1FZOA 1ED3A 1UXWB 4FFZA 2DI8A 4WVRA 4JHBA 5A3IC 3HTLX 1BD2A 1WTGT 4AIZA 1T6VN 2P47B 4OIAA 4HUCA 3X12B 1E67A 1WRFA 1ZXKA 2JELL 4JM2F 4D8OA 4YX2H 2D4FA 3W39A 3OWEA 1IX2A 4M93B 4LSRL 4LLYB 4JQVC 1CN4A 2R0ZH 3KYKH 5IP4A 3G6AB 2F8XC 1JYNA 1JUFB 4F7KA 1C8PA 3ATDA 2AP2A 5F96H 1MJJB 3BX7C 1FORL 3D4YA 4WWKD 1B2WL 2HA1A 4POUB 1DEEA 2W9EL 2HLFC 3OVUB 4PJ5E 3KGTA 5HHOE 5I16A 1JGEB 1AY1L 3HMXL 1JFHA 5F9DC 5BZXA 1BV8A 2HPTA 2NT0A 2VWEE 4OH2A 4JFOA 4WHDA 4NS0A 1X9UA 1E5AA 3N1MC 4U31A 3HS0B 5GGTL 1RUPL 5JXEA 4M02A 3C6SB 3OJVC 5FUOL 4YLCA 3PP4L 1ZHKB 5IM7B 5EZJB 3AXLA 4IOFD 3VGEA 2OL3L 1QLFB 4LKCA 3BFQG 3BHBB 4MRCA 5E6RB 2Y2WA 1BEYL 1SOSA 4L1DA 1AD9A 2IH3B 5HPOA 1SXBA 2ZWSA 4L4VD 5AKVA 3TN0D 2VR9A 3OKLA 2YPLB 2LU7A 4WK2B 3TONA 5GISL 4PD4J 3NA9L 4AQZA 3CBJB 4DVBA 4KKBC 1RZ7H 1SXSA 4QRSB 2QVKA 1OGTB 5FO9B 4N28A 3HUJB 3EAKA 4N4YB 4XTRC 4PJCF 4ZO7A 1C01A 4AENA 3BKMH 3TNMB 2BIPA 3RRQA 4GCRA 4F92B 2VDMB 1UZ8B 2NX5A 3ALPA 2F61A 1ZHNA 1E9OB 1T0PB 3E6FA 1ZIQA 4ATTA 4I3RL 4MNQA 4X7DC 5AUMB 1H15B 1ES0B 2MNWA 4Y9GA 1R5WB 1FYTE 4K3EL 3ROOB 4R96A 5HYJE 1WZMA 5D1ZD 5J56B 5DQDL 2XT1B 5ILTH 3EO9H 1MFEH 2YPLA 3HN8A 3KEDA 3LIZH 4MAYC 1AKJD 5BS0A 1CE6A 1U3YA 4E9QA 4J3OD 4A6YA 3FONB 1Z2KA 3BDYH 1IKOP 1SDDB 4NZFA 4NOBA 1DFBH 1NGQH 4M5SA 3QNFA 2FHFA 2EDMA 3MTXA 1T66D 2OXGA 4BRJA 5F3FA 2ED6A 4MXWL 3GMNA 4ELMB 2BHZA 2CUAA 3QEUB 3VFTB 3IJEB 1E9OA 4Z77A 3GT6A 4OGAD 1A3LH 4DN3H 4LLVB 3QQ9D 4JE0A 4KKQA 5I24A 5D2NA 3CN2A 3BGMB 3HRZC 5TDPB 4APQA 3UPAA 1BCIA 3HC4L 4MNQD 1RU9H 1UB6B 1XBRA 1T2JA 2IANA 3RVWC 1FGVH 5D1ZA 3BN3B 3T6XA 1NWOA 4IYKA 3V7AE 3ULVL 5DFWH 3H6AA 4LIQH 5CZRA 3GZKA 3GZQA 5F6HI 2CWRA 2EH8H 2ODIA 5E2WL 5LAXB 2A9AA 3GKWH 3HN3A 3JWDL 4QHUA 2VR7A 2K4WA 5E24E 3QJQB 4GBXA 5CUSH 5DDHB 2OSYA 5J06A 4EI5C 4YZFF 2AJSL 3VH8B 2ZYIA 2BCKB 4MS6A 3B9KD 4WSKA 4GMTL 4OGYH 1YECL 3HPJA 4LSPH 3UO8B 4NWUH 1RIHH 1TKWB 4YVUA 2CBOA 4HXBH 1GCYA 2PMZA 1A6WL 1H5BC 3VXMD 5C2UB 3BAXA 3HZ2A 3TEXA 1YN6B 1ZLUH 4J2XA 3GSNL 1CGXA 1NAMA 1RUMH 3HHSA 1ONQA 1R3IL 1KTDA 1OGAD 2DDQL 4X5RA 4LASL 3CFTA 3SY0B 1MF2H 1JPST 2JKJA 1T7WA 1D9KD 2Q3XA 5L2JA 2EIBA 4AW7A 1E42A 4QAMB 4LGSB 5DJCB 5TF0A 3RFZB 1DSLA 5FDWB 4O5LL 1KLFB 2BS71 4PJ7B 2PO6B 1JNLH 3E6HB 4HGWA 4V33A 1ORQB 1TVHA 5EORH 1IC4L 1SOKA 1TTUA 4XHJC 1FH5L 3L48A 4TL4A 2WIMA 4HXAL 2AXFB 1QLEB 4PJIE 1X4YA 4OB5L 2XVBA 3TYFB 2R7EA 3FSVA 4YDIL 1ZWMA 4DKAA 1M05A 1FAIH 3LMJL 2KMWA 3IVKB 3ZDXF 3JV6A 3IAGC 2UY7B 2R0WH 4PRPD 4PWGA 3V52H 1X5FA 5JMOC 2WZPA 5J1AA 3QCUL 2Y69B 1IAOA 5CJQH 3H9SA 5CBAB 3FC8A 1A7PH 4XH2A 4PVMA 4EIGB 3OZKA 3MAWA 4N0CC 4HLZH 3QZLA 1XZ0A 4S1DD 2VDRL 5FOBA 1N0XL 3PU7A 3RTQA 1QKZL 1XGUA 4RFOH 3F6IA 2NSQA 4U1MA 1VACA 2VL4A 1QRKA 5IF0A 1A1MB 3R0NA 4IRSD 2ADFL 5EUOA 1OK8A 3TN0B 5EZIL 3MFFA 1FIGH 1SJEA 3UTSA 2X5PA 3ARSA 2Q76A 2UXGA 4LLMA 5IHBA 2QADD 4CN4A 5FHAH 5E70A 3CWGA 3CHSA 4XP1H 1JS4A 4MNHA 4JFPA 2FBOJ 1CFMA 2WGXA 3PQYD 2ZP0T 3KJ6L 3PL6A 2VM9A 5KUMA 4FJYA 3A0OA 2YOAA 4EBQL 2DM4A 4OCXL 2VKWA 3I6LD 5IB4B 4Z7QF 1P1VA 3ZDYB 4YHOL 1BMZA 1TQVA 1KYFA 3FN3A 4HKZB 3UROR 1P69B 2AEOA 4N9GB 4PGDB 3KWUA 3HI6H 2R1WB 3BO8B 4YSAA 1N64L 4M6ML 3H2WA 1HHJA 2FSEA 3PDOA 4L1BA 5AZEH 2JSFA 2ZUSA 3NEOA 3P40A 5E8NA 4QY8B 1JXDA 1NBYA 1T22B 5C97A 2HJLB 3BLPX 2NY2B 2R4SL 1U41A 1ZGLA 5GQBA 1JCKA 4JRYD 2JTDA 4K8RD 2NXZD 2WVUA 2YAMA 4K9EL 1X4ZA 2K6WA 4MHHI 2EEFA 1ZA3A 2WZ0A 4MQTB 3ZN6A 3VW3L 1S7VA 3WFDH 5EC1A 3UDWA 2BRRL 2Q76B 2ZD0A 1LL1A 2N7BA 4XNQB 5E2VL 5E95B 1HAWA 3WTUA 4TQEL 3VRIB 2YBRB 4HEME 1K2DA 2XNAA 4GUQA 1R9FA 4WO0A 4A6YB 1BG9A 2Y07L 3GMPB 3K8KA 5DHYA 1JERA 4HPOH 4HALA 3KPSE 1SFDA 2B4CH 4QGTA 1U3JA 4RRPM 1DQLL 3FPXA 2OI9B 1KB9K 4XNYL 4JREB 2F08A 4PBVC 3S3DB 3H55A 3P9WB 4L8SB 1QMUA 5IEHA 4F7TA 2HFGH 1IEAA 1K2DB 5GZOA 5KTEH 1QFUH 3GYRA 4XP1L 3NSFA 1EV2E 3HAEA 4I0PC 3NPSB 3T1FA 1G7PB 2DQIL 2ITCB 1J1PL 4P46B 2P28B 5D7LA 1H3PL 1Q0YH 2AJUH 2XJKA 3M17A 1MOEA 2I9LB 2WUCH 5F97E 2DM2A 4UTAH 1NCBL 4FLQA 4NLHA 5CLZA 4U3SA 3S5YA 2NSMA 1I8AA 1XSKA 2H2SC 5K93A 1C1EL 3J27A 1NUGA 2PP8A 3B9KA 3V4UL 4DP9X 4GS7B 4MCMA 1P84K 1D9KB 4PGBB 3UADA 1YEKL 2XWTA 3X1FA 1XWVA 3VG9C 2F5AH 1UOKA 2QQKH 1ETA1 2X44D 5F1IA 3BMVA 2ZOOA 5HVHB 2PO6D 4LARL 5I1KH 4WW2A 1OO2A 1GGCL 1YG9A 5FLUA 4H4NA 5HVWA 4R7DB 1NSNH 3NJFA 1LDPL 4YBQC 2FB4H 2E6QA 2J88L 2L7QA 2AQNA 1S8DB 4XCCH 4HFUL 5CBEA 3RNKB 4MXQC 3D5OF 3FTSA 4L9LA 4R8WL 4YK4C 5DR5L 3WN5B 2XN2A 2CNZA 1RI8A 5F71A 4GAGH 4N9OB 2HUHA 3T3MF 3CVBA 1D9KA 2WLJA 4DQAA 2Y7LA 4PR5A 1AYOA 3PQYE 3VI3E 4LL9A 4QPEA 4HK0A 2NY1D 2QVTA 3B4NA 2N0MA 3SY0A 4FD9A 1PZSA 2G75B 1GC1L 3NVQA 5L2JB 5FA4B 4KZ0A 1F4YH 1CXKA 5BVPH 2WXKA 4KDTC 3DPDA 1BX2B 3ZKMD 5I18H 1F6LL 3GSNB 4LSTH 1RK0A 2C26A 5C9KA 4N1CA 4YEFA 2RHEA 1FO0A 1UA6L 5AOLA 1XQ4A 4AITA 1PKQB 2XHNA 1WUNT 4CNIB 3FFCE 4BIKA 1BEYH 3AUVA 3QCVL 3PGDB 4OI7A 4K8RC 2H1PH 3DI3B 3JSSA 2GCYA 3U7AA 3K5SA 1FN4A 1HOEA 1WIPA 3O4OC 1NFDA 1V8HA 4NIKB 3GB7B 3U4BL 2QADB 3QHZH 2EDJA 4GW1A 5T1DH 3RB7A 3DJTA 3HRPA 1H3PH 4FXGC 5FA3A 4MQXD 1I7TB 4JBSA 5SWZA 3NCMA 3BH9A 3B3IA 5H8DA 3US1A 5F0JB 3L7EA 4GNKB 3L3DA 3H3KA 1Z9PA 5J7CC 1XGUB 2DJUA 3BVUA 3V6OC 3CSTA 3ZKQD 1Q9OA 4RQQB 3ARBB 4OFVA 1JIBA 3IRZA 2OTWA 1DANT 1BVKA 3MUJA 3P3RA 1MWOA 4XBEH 2FJHA 1UXSB 1KY7A 2A0LC 4TULL 4AI7A 2ENQA 4P2RE 3Q7JA 4G7RB 2BNQD 3FU7A 1QTSA 1OPGL 4KJWD 1WAAF 2WXIA 4WW2F 5LBSL 2LTQB 3PQYA 4OLUH 3T8MA 4LVEA 2P52A 3O3EA 3RBSA 1W6WA 5HYEA 3ZSTA 3OKKB 4FYRA 1L9QA 1SVBA 1TYEB 4V2CB 4N1HB 4UTBH 2W91A 2NXZC 2NXZB 5F7HA 1JGLL 1JSYA 4HIXH 5HI5C 2YAEA 3D12B 3FO1A 3A6OA 5A16A 4KGJA 1JCVA 1EAJA 3UC0L 2APFA 4WKZA 4PWHA 4ONGL 3VFWB 1ZTXE 4NN6C 1X5ZA 3EO0B 3V0JA 3R18A 5A2KH 1QQDA 1HCZA 1S9VB 4MMYA 4AQAB 1S7RB 3TJEH 2DEXX 1EO7A 4W4OC 5IZ7A 3CSYB 3MRGB 1YEHL 5FUZH 4R90L 1IM3B 1D3CA 1MFCL 5FR3A 2WKOA 1A7RL 3OXRA 4AVHA 5AG9A 1J10A 1YNKH 3UPRA 4MA8L 2B59A 4KY1L 2YHGA 1BPLB 2XPYA 1ZHNB 1ZLEA 1EZVY 4QRRE 4JQVA 5EOQL 3ZUCA 4GO9A 4JLRA 3W82A 1KF9B 5EFIB 2ZYHA 1I8KA 3BD3A 3NYKA 2BERA 2YUWA 4NKIL 2FEEL 1BAGA 4OCWL 2YD8A 4FTVB 4NT6B 3B2VH 2YD9A 4WU5A 4HIHB 3TIEA 5DLLA 3T2PA 1EJOL 1AZUA 3EYSH 2M2DA 3I02B 4NO5B 5T3ZL 6CGTA 4WWKA 1P5UB 1WYJA 5F7EH 3RWEA 1JOIA 3FQ2A 3TO2A 4R7NB 4AGQA 3ULUD 3ECBB 1I8UA 2WINA 3U6XA 1ZT4B 1IAMA 3GLDA 2C9VA 2Y9RT 3TJPA 3TT1H 5LUMA 3AB0B 2NQDA 4QHKJ 1TZAA 1UT1A 3DX8B 4CVWA 1M1XA 2GJRA 3NCWA 5FYKU 2MHAB 4HGKC 2ESVB 3KWTA 5EU4B 3NCFB 3ZDYE 4UTBA 2UY6A 4IS6A 2A9NH 2PPEA 2IFGA 3CFMA 3E2HB 3FCSA 5I1AB 3K8LA 2ATPB 2G4GA 4Q6IC 3NMEA 3UYOD 1BZEA 1NANI 5IEKA 1BJ1H 4YXHH 4G43A 1INQA 2WWKO 2H3NA 4HJ0C 3KLHC 5E9DB 2OTUA 4JRYB 2WKGA 2DI9A 4DIXA 4PRHE 2DWXA 2RCSL 5I1IH 1AZZC 4KFMA 4JLRB 1P6WA 3ZQ9A 5J1TC 2QSVA 5DD5H 1AD0B 1A7PL 3JTTB 4PTUB 1CL7H 4KZDH 4KK6C 2BFVL 4FQIH 5HDWA 2E7DA 1MAJA 1G7MB 3D48R 4B0MB 1HNGA 4HJGB 3TS8A 1ETZA 3RDTB 3TJEL 3RY6C 3VFNA 3BESR 3CK0L 4KNUA 5F1OB 5CEXA 4OJEH 4C83B 3W11D 1CBVH 5IMOA 4XCYA 1TCMA 1INDH 4HEPG 4URTB 5HI4C 3MFGB 1FFOB 5CZXD 1MZZA 4LHUA 3QIBA 5ICYB 4PUBL 3UEQA 3HZMB 4L4TA 4ZOBA 4DH2A 1FIEA 4GJTB 2C1OB 2FCBA 4LP5A 1AXSB 3P4LA 4TUUA 4ZDHA 5AVUB 1YJDL 4XN1A 3NN8A 2CO3A 4P2OC 4IKKA 3C08L 4ONHB 3PFUA 1QRNA 3MRIB 1YY9C 3O2VL 5DJ8B 3UTSE 1HL4A 1CG9A 5TQ0L 2ED7A 4AG4H 1HU8A 5J3HC 4KV5F 4ENED 5D1QE 5D2NC 3OLIA 4J3OC 4J23A 1I3RA 1I85C 3F7PC 4IHOA 1X7TA 1PFCA 2DJMA 2ZUUA 1IGFH 3DMMA 4AVKA 5HP5A 1W8OA 5D1ZC 2Z7WA 4RETB 4L8CB 3I6LE 2XOTA 5IGXH 3TEWA 3N91A 2FBJH 4HUUB 1B4JL 2EC8A 4XP5H 5F96L 2JXMA 1GXEA 4LOFA 1XR8A 1KIPB 4JEGB 4J6IA 4NKIH 1X9LA 2G9HB 5DA0B 3INUL 4J3UA 5E5UB 3QDJB 3D4GA 3LQZB 4ZS7L 4FDWA 3HZKB 2PABA 1TT6A 3C60C 2ADJB 1HDMA 1NEUA 1OARH 3ARFB 4QTFA 3VXMA 3G9AB 2CO7A 4LGRB 3D39D 1MZYA 4EOWH 3C5SA 1BF5A 1TUPA 1FVCA 5JW3L 3HLKA 3IFPB 4JJHA 3ZGHA 4Z3HA 3FUMA 3R7QA 3KYMB 4OIFA 3QDME 1XR8B 2BSTB 4RMVA 3M1BB 4JFFB 1HC1A 1Y0LA 2ZPKH 3G6DH 3ILQD 1LO0L 3DC0A 2H32A 3RTLA 1JK8B 1IL1B 1P6FA 5TPWL 3QWRA 3OAYK 4JKWA 4M56A 3TZVD 2D7TL 3OKMB 1JI2A 4YOKA 4NKMB 4LPTA 4MAYD 4XC1H 3WFEL 2EE2A 3WKMH 2FECI 1H9DA 3GXTA 2X70B 4FQ2L 3E9UA 4OZHE 1LK2B 2P80A 2Z0BA 2FIRT 2RQEA 2E86A 1NBCA 4QGYA 5E2TL 4FABH 4X6CB 3VNZA 4K7FB 2J55A 4QHNB 1I1AC 2CHZA 1HEJC 1VHPA 2NY2C 1CICC 5HHVL 4PRPA 3UZVB 3U7YL 2SEBB 2NUPA 5TE4L 4BBWA 3SGDH 2OSXA 4JGFA 1B4JH 3HR5B 1DVUA 2FJSA 5FAAA 3BZ4B 1I3UA 1NBZA 3QWRD 2EVFA 3TVMC 5JOPE 5AVVB 3LN4A 1ZLDA 1BLNB 2J4WL 3ABKB 2X88A 1DEEB 4V1DD 1ZHKA 3FTVA 1QBLH 2NCEA 1J0ZA 1KBGL 1NAMH 2AANA 2MQ0A 3W0WE 4PQXA 5DJDB 2Y36L 3MNZA 4AMKL 5J13C 2GSIA 1MY7A 3CU1A 2P80D 3EGDB 1KGXA 3UEZA 4ZTEA 4F24A 1NIAA 2NCMA 1R0AH 2K4AA 1KFAL 1QBBA 1T7VA 4AGOA 2XIBA 5KSUA 1Q72H 4M00A 3RVVC 5KJRL 1NDGA 3EJZD 3OX8A 4KKRA 3WGVB 3GKZA 4DESA 5FW8A 3PWNB 1Q8MA 4PAZA 4R0LB 2PPCA 3B5TA 5CJOL 2WPGA 3BE1H 2WUCL 2EYSB 3LKNB 4X0KA 3ZBMA 1XVSA 4CJ0A 1NIBA 3S5ZA 3SKNA 4AXWA 1W80A 4AMXA 1N5AA 2VJ0A 5EPMB 1N6UA 3BRGC 1E4KA 3BZFA 3O2DA 4JZOB 2CLZA 3O81A 3FDWA 2LU4A 1NPNA 3DOIA 1TZIA 2WYIA 4N0YL 4ZMOA 5I1CL 3MU3A 2X09A 4I2XE 1CXIA 2VMDA 2VMFA 4TQEH 3ELAT 2BVPB 4YFDB 4F1ZA 3RIFF 3TCLB 1BBDL 1R46A 1A45A 3RGHA 4IEFB 4GLRI 1J9SA 3FU7B 3TURA 4ATWA 1PSKL 1IAKB 2DH3A 2P9RA 4QLWA 3FT0A 4N0UE 3RILA 3N44B 4M6NL 1E3XA 1FZMB 4UUJA 2QGDA 5I0ZA 2ZWYA 4G8EA 1V7ML 4MNQE 4ZFOA 3MCKB 4EL6A 3ILPA 4AE0A 3OD3A 5JOPD 4F7CA 3T3PE 2WCSA 3PPEA 4ETQB 5C0ND 3L3JB 1F0LA 1KGWA 1M1SA 3AM8A 5JHDB 1IRAY 4D94A 4RGND 1ID2A 4WKZB 4ZSOB 2D7TH 4XNMA 4H8PA 2LV4A 2VN7A 1VFAB 2BHUA 3C6LB 1KCRL 5CN2A 4H8WH 4A67A 1ZA6B 2V5MA 4ANVA 5AB2A 2CNYA 4LF3B 5AZ2H 3SBWA 3MLYL 2D7QA 4P3DB 5EBMA 1AO7B 5CZXC 3DSNB 4P5KB 4JG1H 2APWA 5D71L 4A2DA 4JM2B 3SOBL 1F6FB 1X44A 1E8ZA 1JJUA 2B59B 5DUJA 4EI5B 1I1FA 4JVPA 1YY8B 2BDNH 3DSFL 4PFEA 4ZUVA 3BT2L 4ESKA 5BRZB 3QG7L 2EIDA 2H2SD 1DUZA 1B2YA 1J11A 4M1GH 1F4YL 2W95A 1KJMA 3GZOA 4TF4A 4YE4L 5BVPL 5IREA 2ZWLT 3Q05A 4KAQL 4G2AA 1MHPH 2FECL 3DV6B 3S8FB 1QRND 2C9AA 1HQ4A 1V7NL 3T77A 4HC1A 2V2TA 1VGEL 1JNNL 5JA9A 2P4AB 4Z8FH 3DYPA 3QJHA 2VLRA 5B3JF 1F3RB 3P9LA 3HNSL 1C8QA 1GY2A 3AG3B 2IC2A 4P3DA 4HHGA 3CPLA 5HGGS 3ZQXA 5C0AD 2KLTA 3WO4C 5GZOD 3QZWA 1IQWL 5J3HD 1G5AA 3AWEA 3IWVA 3DGDA 3P3YA 5D7LD 5IR1A 1QYGH 1P5VA 2L7JA 4UB0L 3HHSB 3OB0H 1OCZB 3RZCB 2YQ2A 3IPBA 3VGFA 4DAGL 5I5RA 5J6HA 3CVHL 2O6CA 3D3VE 1OAZH 5IG7A 1MW2A 3C6LA 3HBQA 1BBJB 2LU3A 4QKXB 4LSSH 2EE3A 4ODSH 5A7BA 1AANA 2DN7A 4MAYB 1KLFA 4PJ7A 4BSVB 4ELMA 3IEAA 4C56A 1QP1A 3T4AB 2J5LC 4NSKB 2B2XH 1N7ML 2XXMB 3IMUA 3L2LA 3WEAA 3IETA 5I30H 2XV2A 5DRNB 4PGEA 2X6BA 1E50A 1CI5A 1WFTA 2E6JA 4OB5H 1J8HA 3T77B 2HZHA 4C47A 3FULA 1GJIA 1EEYB 1PDKB 4NO0A 3DTUB 4O9HH 2Q7YA 3LRGA 3M46A 2OK0L 3MBXL 2G9KA 4R97B 1SDYA 2ITDA 4L5FE 3KYAA 4GSRA 5CBAA 2HYMA 2R83A 4DGYL 3UCQA 5EHFA 4AEEA 4D7BA 4K8RH 1DQLH 2Z64C 2AV7B 1JN6A 3KLLA 2OR9H 1IILE 2ZAHA 5E6ID 2BVEA 2EZ0D 2Y7MA 1I7UB 4XX1E 4CL7A 4GBXB 1G7LB 1HHIB 4TM9A 2DLIA 3W9DB 2ROXA 1LEGB 1CXLA 3QRBA 3ZIMA 4HU2A 1U8CB 2MCPL 2VXTH 3O6FD 2O5ZL 1VGKA 1OE3A 4M7KH 3U0TA 5FO8B 1TKWA 1FNEA 2PYEA 5DLMH 3V5DB 4L3EA 3MJ7A 5IVXF 1UA7A 3Q6FB 3KYNB 3NAAH 4P57A 2XVGA 4ZUTA 5HGBB 2IOOA 1I3RB 2UUDK 4ZO6A 1RURL 1JD9A 4LGPB 1YPZE 3I3DA 4UB0H 1NCJA 5DWUH 4KAQH 5SWZD 1NBZB 2EABA 3TFBA 1JTTA 1Q9LB 4FQJH 4WEEA 5AZEL 2WB1A 3CN0A 2HT2C 1ZD6A 4M8UA 1NGPL 3FTGA 3L3OA 4UAOC 7FABL 5IJCC 3QG7H 1S6NA 3QJRB 3HG1D 4CDGC 2F5BH 3TBVB 2M3CA 1PVHA 1PNDA 1WK0A 1HYSC 4TS6A 5E8OB 5G5DA 1DQTA 5D4JA 4F80A 3LQZA 1CCZA 3GXUB 4Z8FL 3RVTC 1KYOJ 4ZX4A 2VE6B 4LLQA 4MQXC 5L9DL 3NABL 1BVZA 4B9JA 4BKTC 5GGTA 3EOTH 3D4ZA 4DEPC 1JRHI 1NKRA 4I1RA 4IQHA 3VWJB 2EDOA 1X7QB 1QNZL 1EAPB 2VMJA 3BT2H 1H5BB 2NZIA 4X6CE 3BH8A 3S4SB 4LRNH 3MUUA 5I76B 1O6VA 2EXWD 3IWUA 4IRZA 1RURH 3W0WB 4R90H 1FO0H 5K39A 3FRPG 1MIML 3WO4B 1QBAA 1Q38A 2HX9A 3SDCB 4OZFG 5EU3B 5EN2B 1JV5B 5E00A 3WIIL 3HHMA 4X8XA 4F5CE 4V1DB 1KIUB 4P9HC 2P5WD 1M7IB 5FEBA 2DQUL 1Z0NA 1OZUA 3OZ9H 2AI0H 5D6DA 1N12A 5E9DE 1NCBH 3MLXL 3ARGD 1N68A 2XZAH 1NKGA 2G5UA 5MP6H 1VKXA 3G04B 3MLWL 2VUYA 3S37L 4GO8A 2EXSA 4R4ND 4HD9A 1C08B 4U3HA 4P5TD 4Y5VC 5F7YC 3HS9A 1S7UA 4RH4A 2GBTA 3V8CA 2XPZA 3ZZSA 1QSVA 2YR3A 4MKMA 5IBLC 1FL5A 3QHTC 2YD0A 1JXJA 3IFNH 4M8VA 2FX8H 4OZFH 2O6EA 3ZE0F 4JFSA 4AK2A 1OAXL 3BW9A 4I87A 3FHAA 2CJUH 4YGVB 4HWNA 4Y4FB 2BY0A 1MFMA 4KI1A 4ZXBC 1ZVNA 3S96A 3OB8A 3EYUH 4HHWA 1K4CA 4PP1D 4WENB 4IRZL 4F3FB 1II4E 3J07A 2BC4A 2WP3O 4IMKA 4KKAD 1MFAH 2IWKA 4LCCC 1NGYB 2Z31C 1E4HA 3FH8A 2RD0A 2Z4QA 4JDVB 1PLCA 1TTGA 3CIAA 3HMWL 2AI0L 3EJSA 5CINL 4K94L 4PJGA 2ZCLH 1WGOA 4PBDA 4PRBB 3QDMA 4NZDA 5ICXA 3LKOA 1CBVL 1MQKL 4S0SD 1JZ5A 1A3LL 5JQ6L 5FCUL 5ITFB 1D5XB 4X50A 3ETBF 4E0RB 3HLAB 5I1GL 1BM3H 3W3BA 3WNMA 1TPXB 3NPZB 3RNKA 4FAAB 5CBEB 35C8H 4HCFA 5JPMB 4FERA 5B21A 3AROA 4G80B 2X3AA 4FABL 1N59A 4WI3A 2X2IA 5IBTL 2R1XB 1RJCA 4NX0A 2VUOA 2OMVB 1Y18A 4P23D 1N9PA 1JZDC 2CIIB 4PR5B 3MRCB 1AE6L 2ICES 4GMTH 4LPYA 4OGYL 4L3CB 3IXAB 2ICEC 5TF1H 3RE0A 1SEBB 4GAFB 5BO1L 5BRZD 4NNYB 1T5XB 1ZV2A 1N4XH 1HDMB 4ALAC 3S4SG 2ZAGA 4DPRA 4UOW1 4WFFE 2P1YA 5BRQA 2VDNL 3X14A 1L4IA 3ILEA 4NQXA 3LKPA 2I60L 1MVUA 3LS5L 4G1EB 4NO0D 3MJ8B 1WBYB 4BEIA 4JANA 3DBXA 3QQ3B 3HI1A 1GYAA 1JZHA 4KKZA 1FC2D 1E5BA 1NMCC 3VXTB 3K80A 1EEYA 4M8RA 1FO0B 1BMWA 2J73A 1DP0A 2YXVA 5IB1B 3NCYP 5GJSL 3L3IA 3TBCA 1JWSA 1L0PA 1PBYA 1NMAL 1NAKL 2H6PB 3RZCD 1LJMA 1T3FB 3KWWB 2JK5B 1JN6B 1QKZH 3A6CL 2ZWKA 4BUGA 4XC3L 4MJID 5GIRA 4K7FA 4Z7NB 5FDWA 2X28A 5C0CB 5LN4A 3O45A 5IBTH 3ULVF 2FNBA 1MFDH 4ODWA 2W0FB 3NCJH 5MENA 1DSYA 3B7UX 3EZJB 1ZMYA 4KDWA 3VGBA 4KKPA 4YHYC 2R2BB 1LO4L 4P5TC 5TTRA 1KTKE 4N22A 1U6AL 5FUCC 3U9WA 4CW1A 5KS9B 4AV0A 1ZRUA 3F7VA 3IGAB 2H6PA 3SO3C 5L2KD 5F7DA 3CZUB 1PX8A 3LH8A 5CD5D 4B6ZA 1REIA 4R7XA 4OF6A 5C07B 3TA3B 4ZUTB 3KPLB 4BH8A 5HGBA 1OB1B 5K9QG 5B39G 5IESH 1D5ZB 4WFHD 5AZUA 2IAMD 3AREA 4HK0B 4ZFGL 5IVXE 3IJYB 3QI9C 4FFTA 4LCWD 4G83A 1VSCA 2F53A 3ZMNA 1BBJA 4H2CA 5CGMA 2OR8A 5D7KE 1T04A 4J4PA 2OAAA 2JQZA 4YDKL 5F70A 1P7BA 4MYWB 3WBDA 2ZICA 1CVRA 1FL3B 4O2EB 5C7ZA 3OG4B 2X42A 4O2CA 4WTZA 2VQ4A 4U1SA 3Q9QA 1OAXH 1KWGA 3PGCA 4WI0A 4NSKA 5BMFH 3KPSD 1SYVB 1KB5B 2G60H 4JY4B 4LVNB 2UYLA 3BCDA 3ZL2A 4Y8DC 2X4NA 2GK2A 4XVSL 2A4CA 3MGAA 3N1QC 3REWB 2BIHA 4PUBH 1TTCA 3FFCD 4Z6AT 5L2KA 2FAUA 5SWSD 4RA3A 1EA9C 4FC3E 4Z7UB 3QUHA 1INDL 1TTAA 1NFDB 1NLBL 2YMOA 2PNDA 4XB8A 4ZO9A 2MCMA 2WTPA 5KAQG 1T04B 2NZ9C 5FECA 1WBXA 3FTUA 3APFA 3TH4T 2HB0A 4NQQA 1A14H 5I17B 3RPIB 2W80C 3FB5B 3MOQA 4QRRA 5C0BB 2LTQC 3FO9A 1MCNA 1SHWA 1MVFA 4C54A 3C09B 4Z7OE 4N2IA 3AITA 5LCVL 3FCGA 4AQEA 1E7VA 3LHAA 4QRSA 3VWKB 2XPGA 3P54A 1G7QA 5HHQB 1F4WH 1MH5B 4HCRH 4P5TA 4HS8L 2C3GA 1ZKAA 5CSBA 4EVNB 3O41B 3IT8D 1WAPA 1UOVA 2JKNA 2Y5EA 2VLKA 4KVNL 4Q52A 4JVUA 4QRQA 2YEQA 4RAVA 2I60H 4KI5C 1U0QA 3U0TB 4XX5A 5FO8A 4QXTA 1ES0A 4X7EC 3MJWA 1A5DA 5L6YH 3NJKA 1GSKA 1KGYE 1SMAA 4L8BB 2BH0A 3HBZA 3VA2C 1Z6JT 2EZ0C 4JM2A 3X2QB 2W9DH 3ESUF 1YAZA 2X4NB 5A2BA 1UVQA 3FONA 4DK3A 3KJ4B 1ET8A 2Z8SA 4MSWA 4QHLB 4A1RA 1MNNA 3U1QA 1KJMB 1AE6H 4G43B 1N8ZA 4FL4B 4PTUA 3UG3A 1ZSHA 4W9AA 2ORBL 2OMTB 5DFVD 4H26A 5KG9A 1KELL 3VQ2C 3NZSA 3HR6A 5BZDB 5LCVH 3UTTE 4N2BA 3WNPA 4LSVL 5D2LB 3FHEA 2P7TB 4QRFA 2E7LA 3UJJH 3L3GB 4OCRL 4UINH 4NN7B 3WI9A 3BPCB 5HGHB 3OR7B 3II1A 5E8EA 4X9BA 2EYTB 4JFYA 5BMFL 1TVBB 4U6VL 2YOCA 2YAFA 4GG6A 3QARA 2WWOA 1A8ZA 2M3UA 3O0RH 5LBGA 5I8EB 1MAKA 1MH5A 4P5TB 3QNYA 3BP5B 1JWMA 1EK3A 3QUXB 4APQD 5DD1H 3QIBC 3EG9B 4P23A 5E4OA 4WUKL 1M6OB 4HOZA 3NIGB 2F6AA 5F6IB 1NFDE 5KVEH 3SODB 1HH6B 3VD0A 3MKGA 1G7PA 2A9BA 4G8GD 2WINB 3B2XA 1DZBA 2VLKE 3JWDC 4QOKD 2QKIB 3EFFA 4PCSA 5DMGD 3U0PB 2Z91B 4C56B 4PJEF 3MUGB 1Q72L 4G1MA 4HJ0D 4G82A 3QNZA 3QUZB 1S7WB 4GW4A 1OP3K 1J18A 4N5EC 5JIIA 3JV4A 3PABA 4LVOB 1AJ7H 4PGEB 4AK1A 3QDHA 4Y16C 1TG8A 2HKAA 4JKPH 3U25A 5T1MB 5C0CD 2DKUA 1JYWA 4E41A 5CGTA 2MRYA 2P43B 1YN6A 4JGUA 1Z32X 4E5XA 4XE0A 3QUYD 1WFIA 4JFZL 2WXRA 5E23A 4WFGE 3NTCL 2ZYSA 1KGCD 4BXVA 2RFXA 1MCWM 2J8UA 1DL7H 4YUEL 5C8JB 1BAFL 4AY0A 1JPFA 1R3LB 3NPSC 3PWLB 3QB7C 2DM3A 3A4FA 2X4RB 4YL4A 1MAMH 3ARFA 1JP5A 1C12A 1XGTB 2ZXWB 4Q9QL 1UTDA 5IOPB 3WNJA 3QXDB 5GSRA 2WLZA 4PRHB 1HIML 2FSEB 2QGEA 4J27A 4H7VA 5I19H 1X5KA 5DC4B 2E8YA 1GAFL 4YNYA 3P4OA 3QQ9C 1PS3A 3DYMA 4RDQG 1U30A 2N3JA 4Z7QE 2HJLA 4Y4KC 1NOLA 2F53E 5EEUA 3ARUA 2EDLA 3AT8A 1OANA 2WANA 4P3WA 3IDIB 5H35A 4DP8X 5IVXA 2QFPA 2A99A 2B08A 2YC1A 2E7MA 2UZYB 1AGFB 1H0DB 3PP3K 4GAYB 5CU5A 4YXKH 3IXTA 5I0XA 2R8SH 1DANU 4Y2OA 5EOCH 4WJ5B 5I8OL 3WHE0 3TBWB 1HNFA 3ZHKA 3DROA 4KVCH 3QXDA 1MIEH 5IT2L 4U1LA 3LX9A 2WZPD 4IDJL 2OCFD 3UYPB 1SJMA 5CWSA 3C5ZC 4XO8A 4M1CD 4E42B 3HE6D 4UQIM 1UWXH 4FXGB 2D3JA 4LCIH 4PPTA 3NSXA 5JW4R 1DBJH 4CC4C 3OMNB 2WYTA 4KO9A 2FB4L 1EFXA 2J1XA 2J88H 4RX4D 1JHLH 1NFDF 3RTQD 1BFOB 5F89A 4ZXBB 2NX5B 1FYTB 3IJ7A 4UOZA 1PYWA 4K7PL 3UTSB 5E6YA 1P4LB 1WZLA 1CXFA 4P5MB 1T03L 2Z3FA 4K2UH 4FFZL 1GAMA 2X1WL 3FSAA 5C7XH 1CVSC 4Z7OF 3DXAB 5C08A 1W0YT 1U9KA 4EO5A 5LDUA 4YNYB 5BS0B 3X3GH 3T3PB 1NC4D 1Z1WA 3G5XB 2WIIB 4NRYB 2XACC 4YHKH 2JB6B 2W94A 5ISZA 1QSEB 3UAEA 5JORA 2P5EB 2XVKA 3HUJA 4YZFE 3WJMB 1DQKA 1KNOA 5H35B 2OMUA 3RUGA 1ZVYA 1HIMH 3L3KB 2GC7C 4UU9B 1EEQA 3LEVL 3T0EC 4GRMB 2FT6A 1MW0A 3D18B 3HE6A 2LGNA 4RGNE 4O02H 4AGLA 4L3ED 3WYRA 4Y4KD 3CLFH 3MPCA 3SDXB 2G3ZA 2IG2H 4ONGH 1EFXD 4RX4A 3T71A 5KEZA 1NQBA 3F7RA 1BBDH 3G5VB 3TVMD 1HHJB 1OM3L 1X5YA 4MB5A 2VDPL 3O6LL 2P8LB 2EAEA 1UM5H 2V33A 1OGAE 3QORA 4JO2L 3VWKA 2DQIH 4F9PC 2AV1B 4RSVA 3NIGF 4TSCL 1NM9A 3SGJC 3RL2A 5C08D 5A2CA 2GUOB 5MENB 2Y07H 2BNRD 4F37F 1UCTA 3JWNG 3WIHL 3WHE1 1QLFA 3SYQA 2CLZB 3U7WL 4EZLA 5DRXB 5EFIA 2VJXA 5EEVA 4PIBA 2VDLB 5AOIA 3FU3A 4HHAB 3X1EA 1MCQA 1IBBA 1T89A 1L3WA 4LSSL 4WI9A 1N67A 2PP9A 1ZE3H 2NY7H 1YQ2A 1DDHB 5I6KA 5DD5L 1P5UA 1IAKA 4CSTA 5I66A 3E7JA 3S35L 1DLFL 3M88A 5HYQB 2EUXA 3ECBA 4XGZA 1QA9B 4FQCL 4MMZA 4YHZH 1TU2A 3VCLA 4MMXB 1AGEB 3PYCA 1YY9D 3GXMA 4UOJA 1SHXA 1S5IL 2BS9A 2GSGB 2KQNA 4BDVB 2JVUA 1B3IA 1A47A 1FHGA 3D2UD 4PB9L 2PR9A 2YGVA 4GYBA 2OSWA 3MKKA 5GRJL 3RDTD 1J1OL 3QUZD 3W81A 2A9NL 4GT7A 4PP2A 5F21B 5IQ9B 1RIVL 1RULH 2AJVL 4HJTA 5JPMA 3DVFA 1ELPA 2A74C 3L9BA 3QUMB 2DW5A 5DJCA 1MG3C 1QA9A 1DBJL 2CBTA 4MMZB 5CKGA 3RWIA 4ABQA 3FKUS 4BZ2A 5TJWK 2J21A 4FFVD 4GBXC 4KX7A 1N0LB 3GDBA 4OZFA 4Y1TA 3HNTH 3WGUB 3NESA 4BH7A 4PIRF 2VXUL 1B0IA 1E40A 2YQBA 3IF1A 4PWIA 5ID1A 1HOCA 1FLTX 25C8L 3ML8A 2GJ6E 3D2UA 3NAAL 5TF1L 2X4OB 2ZKMX 2XXCB 1NOFA 1R5IA 4G6AC 4XXCC 3SDCC 5IW6A 5JHLH 4E41D 2GIYA 4HS6A 4ZJ9A 32C2A 3N42B 1E6JH 3NDYE 2APXA 1NEZA 3TH2T 3AQDA 2X4QB 3QXVA 3HG3A 1S78D 1CLOL 3KBFA 3CMGA 3NACH 4KQ3L 5CGYC 2OZ4H 3T5WA 1Z5HA 2WMPA 4UT6A 3HAEH 4PJXA 4JO3H 1QW8A 4BWUA 4EN3A 2H0FA 1JDCA 1PY0A 2UWEE 3BT0A 2R7EB 3DIDA 3GBML 1OAKL 2J5LB 4PVLA 4XP6H 2WYZA 3ULVE 2YGNA 2DWSA 1PZUB 3T0DA 4OI8A 1G4RA 1ESOA 1F4XH 1YEKH 2X3BA 4L4VE 4XB7A 1UVQB 3SBWC 1KSRA 3ZYOA 2AK4E 3EF7A 2ZT9C 4DK6A 4GKZA 4RRPA 5FKPA 1AG0A 2R4RL 1DJYA 5C0RL 4BSVA 4TUJA 4Z7WA 4PGCB 5C0CE 4HH9A 2IOMA 3GIZL 4X5XA 3UPRB 3JQOB 2Y2YA 4OLUL 3B2UD 4QHUB 4LVHB 5KTEL 3NUKA 4LQFH 3GBLA 1CGVA 3NA9H 3INOA 1FN4B 4OBRA 4U1MB 1NGXB 3JTBA 4BFRA 3CZEA 1AOHA 1WZ1H 2X4OA 4QWWD 3UFIA 3NZUA 4ZUVB 4MCZB 5BRZA 1F2QA 1DDTA 3L5HA 3QO0A 4P5RA 4RGNC 3TZVB 4EUPB 3KPLA 4BH8B 5KSBB 1EHAA 4FNLH 1UGKA 2EDFA 4CSZA 3IU3A 4IKJA 4LLWB 4XP6L 3BO8A 3VTAA 1GR7A 1SLVA 2AV7A 1AGBB 3DDFA 2BP8B 2GJJA 5FB8A 5LXVA 1LE5A 4L4JA 3US0A 4BZ1A 1UWFA 2PYEE 3P9LB 1SUJA 1OQOA 2VZ3A 1A6ZB 2D3LA 5E9AA 1Z5YD 2VZOA 3BEVB 3GJFH 4UDTB 5JW5B 3EOAA 5LO7A 2ZJSL 2XC8A 2YXMA 4ZAKA 4L3EB 3TF4A 4L3AA 4MJIE 3Q0HA 3VFOA 2Z7YA 2ZUYA 3RIKA 5CFHA 2D8KA 3I6KA 3RJDA 5FX3A 4BZYA 4ERSL 4XRCA 5KW9L 1EUTA 1GGYA 2BHFA 1F4XL 4JO8A 4NM4H 4PMEA 2Y7OA 3TP4A 4ODHL 3BUQA 3WSQH 1SEQL 1HL9A 4GUCA 2ZSWA 4R3SA 1JPEA 2QVMA 1DN0A 1RZPA 3PL6C 1TO4A 3B8SA 2ZQKA 3T0AA 3RWJA 1GS6X 2H3NB 1HSBB 1RSFA 3HNTL 1PRSA 2BNQA 3U7WH 3DRQB 3TYFA 3BP4A 3MLSL 5FF6A 1X5GA 2AEPH 3MV7A 1SNRA 3O8XB 4X5WB 2FSDA 4B9FA 5HYJA 3SZKC 4LNRA 2B39A 4DZBA 4R2GC 2G5BB 1Q1JL 5E8DL 5BZZA 4NUJB 1R19A 1VF5C 4UU9A 1GTFA 2F0CA 2X4PB 3HB3D 2NX5E 5HDBE 3OL2A 4JFVA 3ARDB 5ACLA 4F2FA 1IT9H 1WC7A 4PCTA 4Y5YA 1A4JB 1EAQA 1VGEH 2PWFA 1S5HB 2X4UA 4JQIH 1UM6H 3VFNB 5PCYA 5DRWB 4MD5B 1NCUA 2OBGA 5CCGE 3BH8B 3FHQA 3ZE0E 2ZXQA 4AYFA 1W2KT 1CBJA 4KKCD 2WXHA 1RZFL 3MRJB 4XWGL 5CP3A 3RFRA 3WJLC 2FX7L 2GTZA 4ZAKB 2O5YH 2LHAA 3U83A 4LLUB 4BFIA 2EC9T 3PAUA 5JPNA 4UILH 5DO2C 3ZDZB 5EU3A 3MV7D 43C9B 4EXPX 5BNXD 5HDQH 4N2NA 4B3EA 2FD6H 4AEFA 5I1JL 5K1NA 1U91A 5JIKA 3QDAA 3C2AL 1E7UA 2O72A 4DKEH 1THCA 2O5XL 4AM0B 2JI1A 4IBVA 2AQQA 3ZYJA 5DZ9A 5KWYC 3UCRA 2P5ED 3UYPA 4ZD3H 1ADQH 1MELA 3IU4L 4OZIF 1PU0A 1ADQA 1L9RA 1TQSA 3FT3B 3FT4B 4XNBA 1IKFL 1AC6A 2PYEB 3VTTA 5ES4B 1RLWA 1UJ3B 1OAUL 5D7IB 1M1XB 3VXNB 3VI3F 5E5LA 4EUPG 4RGNB 1RUQL 3JWNE 2Z0UA 5EG6C 3G9VA 4AYID 2BIIA 1BZQK 4AL8H 3T3ME 5SX4I 1MFVA 1S7UB 2ZOUA 2DM7A 1XH2A 3N9GL 4F8OA 1WJ3A 4V2BA 3UZQB 2WJ7A 4ZPTA 4F8TA 2Y1YA 3CSBA 2M83A 4I3RH 4LVHC 5JQ6H 4P4RA 1OTSC 4X4XA 2JDFA 2AAVA 3T9WA 1FNSL 1CFNB 4R5TA 2DS4A 2EEBA 5E8NB 3G5XA 4HIXL 4YDMA 4BWWA 1I1AB 1UCBH 4QTIH 3P2TA 1WFMA 1G1KA 1KGJA 4Q9RL 4IBYA 1AFVL 1DJSA 1YNLL 3D06A 4IKNA 4F3FA 3D87B 3L3KA 2WZAA 4WEUD 3BZEB 4XO3A 3JZYA 4DNLA 4PLNC 5LNDA 1MCCA 2G3XA 3G6JA 4NYLB 2BZCA 3SN6N 2Q5BA 4G42B 3DVGA 5AKSA 1IAIH 4A2GA 4PV8A 4BGLA 1I8MB 3APMA 1RIUL 3MV9D 1X7SA 3GHBL 3VRIA 2EKJA 4PRAA 3PP4H 4D9QE 4GO6B 5HI3C 4WRLA 4AL8L 1A7OH 1OTUC 2BFVH 2IPUK 2IH9A 2W59A 1KUMA 4FQIL 4H5SB 4EN3D 4LAJH 1P4UA 1OAUH 3IPEA 4Z23A 1RIHL 3QJZA 1J8RA 1DBML 1E28B 4FX5A 4TSAH 5IK3B 4JKLA 3JUZA 4B9IA 3CFUA 4NXSA 3S37X 2VM4A 1NAKH 4I77H 1TZHB 2WM0A 1ZJAA 2HMIC 1PLGH 3PFQA 5KBMA 5CCJA 2NY4C 4JCMA 5IOKA 3HKFA 4J7RA 2E75C 2YMXH 1DDHA 1F11B 3S2AA 3RL1A 4DFIA 3OMAB 3QXTA 4ZMYA 1BYNA 2H41A 1KTLB 3DMMB 2OMWA 1QWHA 2EKSB 5DT1L 1BQLH 2XZCH 3H9HA 2EINB 2AQPA 1CFSB 1XL6A 5D7SH 4KVNH 1GAFH 4JE4B 1FAKT 1QNZH 5C0AE 5IB5A 1NCHA 3I2CL 4ZFZB 1J9RA 3B2MA 1U93A 4UQAA 4N3TA 1EVTC 3VYOA 4EJ1C 4C57C 3BPNB 1VFOA 1R47A 3L3HB 1RVFL 3VUAA 3IMVA 2VYRE 4LAQH 1SY6L 5D7JC 1BXXA 3ZVVA 1WHOA 4Q9CA 1U3NA 2AMGA 5C0CA 4M6OH 1OTTD 4MJ6A 3L81A 4S0TD 3I9PA 4GAGL 4FG4A 3NIFB 2BLFA 4KZCA 4J3SA 5E08L 2JK5A 2GBVA 4ZTPH 1O9ZA 1PKQA 4NUPA 5EMYA 5F88A 3D3VB 3I50H 3MRMA 4RWYH 1CYGA 3WJLA 3PGDA 1WG3A 3LV3A 3PRZA 3RURA 4X4YB 3TPUB 2LAAA 3S8WA 1QI3A 1HEZB 1M71A 4GRWE 5BXFA 2EDRA 4P99A 4L1TA 1MI5B 1FV1A 3H9SD 4GW1B 4NI3A 2NY6C 3R1GL 2IWFA 4XVJL 1JPSL 5ALBH 2K1XA 4W9FC 1OP9A 3CHQA 5FGBA 4H88L 2HCZX 5BV7C 3H9HB 4R7NA 4EN2A 4XXDB 4NENB 3TA3A 1E4JA 1KB3A 1XCWA 3LXUX 1FH5H 1F4AA 2PETA 4GRMA 1KTJA 1TETL 2VL5B 3B3BA 4R4FH 2XN1A 2B3IA 1JZ8A 2ZCHL 2WBKA 1LDSA 2CUIA 3AAZA 3FCTB 5DT1H 4OZIA 4JJOA 5GS2H 1LNUA 3CGTA 5E5MA 4ZX6A 5SV4A 1E6OH 4HUXB 1JPGA 3SPVB 1OT2A 4PM1A 3IMSA 1UQSB 2BWIA 2JH2A 1KULA 1ROWA 3EH2A 4N0CD 4XZ4A 1RUML 4QRPE 4WWKB 3KYNA 1OY3B 4BM7A 5GGRB 1NAML 1U8KA 5KSVA 2ED9A 1KB5A 3B1UA 4JO4L 1A6TA 1YDPA 1OLZA 1HL8A 2A6IB 4HT1L 2EXYD 3VXRE 5DD1L 1WFOA 4K7PY 4OCNC 4PJ9D 1M05B 3ARBA 5GGVH 3O4LD 4KK8C 4X4YA 5LLIC 1JGUH 2BOBA 2XZQH 1YECH 3DX8A 4MD0B 2Y1ZA 2MQCA 2X87A 3DV6A 4RMUA 3D0VB 3ISRA 4RFEB 4R7VA 2DQUH 4ZT1A 3T6WA 5F7WC 3GEFA 2QVIA 4LAQL 3CQFA 3GSOB 4PS7A 3BUPA 3H2QA 5IMLA 12E8L 3L6FB 2IALA 1ZK5A 4JKNA 3X11A 4U1JB 2F8IA 3T65A 1KYUA 1YA5A 3JWDH 3PP3H 2IAMC 3ARGB 1KELH 3KNBB 1GOHA 3B8YA 4XO9A 4BXSV 1E6OL 3WDHA 1GIGH 3A4AA 4G9FB 1QRNE 4OCLC 4OJFL 3I3EA 2F8OA 5KN5B 3ARDD 1D5IL 2P8MA 4U1GC 3S9DB 4B9YA 2A0LD 4PYGA 2HRGA 1XCTA 3FQUB 2F7IA 3SKMA 1MCKA 1MEXL 2VLKB 3ZIYA 5KUKA 3I6GB 3UTOA 2A5MA 3WTXA 3MA7B 1TOXA 1GHFL 4Y4KA 4M9PA 4TNWF 3HA0A 2DTSA 4YIQA 4Z5RB 2H6UA 4YFLF 2ENPA 1JPSH 5D1ZB 5ALBL 3T65B 3RX9A 2VDKL 3TEZA 1AHKA 4CSSA 2DQCL 5EU5B 3V5KA 1YUKB 3TO4C 5K33A 3WFBL 2B5IC 3RX8A 1UXMA 4LEEA 1CFNA 4XCYB 1RQ5A 4AZ8B 2A1WH 1YEEL 4UT7H 1HHKB 3WXWH 4PJBA 3C8KB 1U8JA 1WE5A 4KROD 3BSGA 3QBTB 4DCQB 3L5JA 5KYXA 1DSFH 1ZLVK 4TQ8A 2UY6B 2AXGA 4W9HC 2NY3D 3U4EA 4HWEH 4TRPH 2CUMA 3T3MB 4HW6A 5B3NA 4OD1H 1WTLA 4DHLA 4IJTA 4QO1A 1DUYB 2OCCB 3T08A 3S98A 5ISZE 1UWXK 3DMMD 5BW7A 5EOTB 3MRJA 2DQEH 3GMOA 3CFDB 5F9AC 3VRJA 1H15A 3NDZE 4ZNEE 1AQ8A 1P7QB 1MFAL 2DQJH 4MJ2A 4RBPK 4UDUA 2D03L 4Z9KB 2LE9A 3GSXA 1GVIA 3FFDA 3JWOL 2DTML 2FJGA 3P9MB 1KBPA 3D09A 4NQVB 3BP7B 1N18A 3KYMA 2JKRM 5CZVL 2A83A 1B6UA 4H13C 4L4VB 1KJ2H 3M6DA 3QDGD 1EQWA 2ZCZA 3HAEG 5BOPA 2BXYA 4TOYL 1WEJL 2RB8A 3OM3B 4Z7WB 5HVFB 4MFHA 4E5XB 3QIBB 2W65A 3HLAA 3GSUB 2ZOLA 2QFRA 4ZMPA 5C1MB 4MDIA 3WKNA 1QPXA 3CAFA 3GIZH 4NNPL 3Q2WA 1LK3L 3E3QE 3HG0A 4LSDA 3UGXA 1NGXA 2VO8A 3MJ6A 1U3HD 1U8QB 2NQCA 3HE7D 3QIWD 3SE9L 2IDUA 5AW2B 3S3SA 4E9XA 2NYYC 3ESVF 3IFPA 4LLDA 4F9LC 4P0DA 2B1HL 5CCKH 4KVPA 5DJ8A 4OLZL 3VXUD 3J8F7 4PSRA 1BQUA 2NW2B 3HZYB 3UYRL 1X5JA 4PJBE 5T3XL 4L37B 1AKJB 1ZDSA 3IXAA 4OGXH 4U1HB 4AYEC 2ALWA 4Q97A 3LYRA 3L2NA 4WJKB 5K9JH 4B9ZA 3TBSA 5BZDA 3KGSA 1M8UA 1VIWA 3IBEA 5I0YA 3JV5A 4LO9A 2DADA 2VDOH 1P1ZB 4OFYA 5GSVA 5HTSA 4QXGH 1FGNH 3DIFA 4BQBA 1ZHBA 1DE4B 4YK4B 1OEZW 1P5UC 2RR3A 5LGHH 3VD3A 4U1NA 1KPVA 4OGAC 1OTSD 3Q06A 3WDIA 4HUUA 1BMGA 1EGJA 1XZWA 2LLLA 4KMLB 4G8FB 2H4EA 1Z5LB 2J8UE 4ALAL 1UM6L 1GC1H 1U3HA 2ZYRA 2DOCA 3KPRB 4OLYH 5L7XL 4XCEB 5KYUA 4FN0A 5IBLD 4NKOA 4PRPB 3FRUA 4OU3A 1UD3A 4MD4B 1T1WB 3U7YH 1QTPA 4HWZA 3VXUA 3D85D 4DTGL 2PW2B 1O75A 3DETD 3DRQA 1JNNH 5EZPA 2VXUH 1V7NH 4KZEH 4E41E 4ZG1A 2Z4TA 2FATH 3VWKC 4F9PA 2IAMB 5LDSA 1GW0A 4BZ2H 3BUYA 2AJZA 3O4LB 4OFYD 4UQ2A 3ZMEA 2X4PA 4O58L 1CXEA 4LCYB 5FHAL 4CVXB 3PWUA 1NSNL 1IGJA 5ETUB 1S3KH 3QFDB 5INCA 4XP4H 3O6FA 2PPDA 1YNTF 5T3ZD 43CAB 1QLRA 3IFOB 4YSSA 5E1QA 3LRHA 3BKJH 3C2AH 3QEGL 4N2KA 2YO3A 4CN1A 2GUYA 4KI5F 3HC3L 1WF5A 4FXKA 4QRPA 2WC7A 1E9PB 1NM4A 1U8LB 1EEZA 4WK0B 3DXAA 1A7HA 3WMPA 3GJFA 2YFNA 1KXTB 1UZ6E 2BHYA 3F2LA 1A7RH 4LKCB 2Z4QB 4QXGL 5AVQB 3ABGA 3DLQR 3AREB 4IRZH 2WCPA 3FF7A 4ZTOH 3P2DA 4K3DH 4KJYB 2BVOA 3OHMB 2O6DA 3LKOB 3PV7A 2ADIB 3CC5B 4K8RL 1XB6A 1K8IA 5C6PB 3CSPA 4S2SB 3UC0H 1VEPA 1N5YL 1EHNA 2Y3AA 3G3LA 2XNAB 3A6BL 3IDMA 3LQMA 3RWGA 3Q44A 4K94H 4KOBA 4GINA 4YLBA 2EIJB 4LF3A 4DZ8A 4FXKB 4QRPB 1J0HA 1G9MH 2HLAB 3DTXB 3DV4A 4O9HL 4YR6B 4FFYA 2AQTA 3KNBA 2P8LA 1DJWA 1MCFA 2GBAA 2CJTA 4QD2E 1G7HA 5LWYH 3VRLF 3DWTA 5M95B 1NLDH 3L3JA 1AOZA 5ETUA 3EBHA 3QFDA 4K94C 4KJYA 1XCTB 2PCYA 3SKMB 1BVKB 5IHLB 2HVJA 3HE7C 1MN4A 1VZHA 5TH2A 5ICZA 3GO1H 4NC0B 2VLRB 4U2YA 2VQ1B 3K72A 3C5JB 2HWZH 1SLWA 4JHVA 3WFDL 2JKLA 1RULL 3DTXA 2IDSA 4P04A 3GBNL 2E5EA 1MIMH 3D30A 2OXHB 2EDQA 2Y3NA 3OAUH 4GEIA 4KGLA 2HFTA 4UZGA 3BKCH 2Q2EB 4LEOA 3EDDA 3UIZA 1JF6A 2HKFH 3O8XC 4WEMB 5MEOA 1S5IH 3DBXB 1RZIB 1ZLUK 3AMKA 2J2ZB 4V11A 1TTFA 4HUXA 3VFWA 3SJVB 5KBKA 1I85A 2KS0A 4JDTH 4NO2B 3PWJB 5C0AA 4HPYL 3TCLA 4E9WA 4F37K 2VABB 1FORH 2WNWA 2D7OA 4KK9D 5INDA 2ZUTA 4O51B 3D08A 4F9LA 1TJXA 1GPOH 1UT2A 4FNLL 1FZMA 4RMBA 4W6XB 1S9WA 2ATKA 2E46A 1BIHA 4LOVA 3N40F 2H3XC 3QZWB 2XX0A 4NWTH 4XCFH 3RJOA 1G7HB 4YX2L 4O58H 2O30A 4HCGA 5D1XB 4UNIA 4G11A 5EOTA 4A38A 4XWOD 2UX6A 2ORBH 4I3GA 1NLDL 2P5PA 2RCSH 3MNDA 5CLWA 3EOTL 4DP1X 4F27A 3CFKA 4JO1L 4FTVA 4NT6A 5L88L 1MCEA 4WI4A 2AJYH 3MUHL 2R59A 2VABA 4CKVX 5J6HB 3QK3A 3FSWA 4OZFB 4IEFA 2APSA 4WNJA 4L9LC 4KROC 1CD1A 3UG4A 4JQIA 3P0VL 3U9PH 2JNZA 2L0DA 2NYKA 4A7UA 5D4HA 1QG3A 1VPOL 2QHRH 5FYJU 2X0WA 4EI5A 2C3XA 2A74A 3PS6A 1PF3A 2ZCKH 4APXA 2E7LC 3EYOA 1DBKL 4FJZA 1A6UL 4LHUD 5DC2A 2DKSA 4XXWC 1I9IH 2WN3A 4TVPD 4BHUA 3QIWA 1E90A 1XGYH 3LS4L 2OMZB 5DMGC 1PZ3A 2X2JA 4CC0A 3QUYB 3KR3L 4N87A 3SPIA 3SD5A 2VAJA 1F2XK 3AQZA 3EDFA 8FABB 4NQDE 3KDMB 1FPTL 4X6CF 5I5IA 4LCVA 1CU4H 3EDEA 1ZPUA 2CDFB 3RZWA 2VLMD 1H6EA 3ZR5A 3ET9F 3LZPA 4CMHB 4GQPH 3D85B 2Y5TB 1INQB 5HI4D 4KK5C 3W5NA 4HDIA 2PO6A 2D0GA 4QRUB 3SYAA 3ISYA 3W11C 1IVLA 1R3JA 3S5LG 3GSQA 3SE6A 3UMTA 5HDLA 3N40P 4PGCA 3FBKA 4Q0XH 4B0MM 4Z3FA 1ZIAA 2DKMA 4AZ8A 3L1OL 1VZIA 5EDXA 1NUNB 2ENYA 4WTQA 3Q2VA 3D52A 1A25A 3TJHD 2X10A 3H9ZA 5DS8B 1G9NL 3SZ6A 1RJYB 1HEZA 1DQMH 1M71B 1V3JA 4LPWA 3SCMA 5MERA 5CIPB 3QPKA 1QSFE 1R3KA 2V8MA 2XWCA 3MRFB 3QGVA 1A9BB 1PLAA 5DVKA 2GVYA 4EXKA 3LIZA 1LWJA 1CS6A 5FECB 3LNGA 3SGJA 5HPMB 4JZNA 3FZUC 3PY9A 1G6RA 1ZGTA 5T1JA 1NH6A 1ERNA 3QORC 3TF7C 1XGQB 4J8RA 3FO9B 2ZOKA 1UUNA 1OGPA 2BP8A 4BQ6A 4FI7A 2AABH 4LP4A 2A9MH 4DAGH 4HZLB 1TTRA 1VFBB 3TL5A 4UTBL 4B53A 1MCLA 3ZDZE 3WAJA 5A16B 1R5IB 3N55A 1A9EA 2Q7AA 3B37A 2ALAA 5IF0B 2VERA 4W9DC 3GI9L 3RNQA 3EH5B 3QFJB 1EZSA 4M7JL 4P8QA 4U4IA 5D72H 3VFOB 4AVIA 4R2GB 3WUZA 1WV7T 4U6VH 3ZRFC 1DVSA 2YK1L 4OIIH 3ESNA 4XMTA 5PAZA 2Y7SA 1MQ8A 3DXAD 4G7YH 1DO6A 5BQ7B 1OAQL 3CHOA 4K9JA 1SJEB 1JF1A 3Q8AA 1JHTB 1FVEA 1U8OB 1XGRB 1J0YA 4UQCA 1NINA 2VSDA 4U1LB 4O4YL 1KBVA 2EDTA 1VKXB 2F53B 4FHBD 4AGPA 4PMFA 5EO9A 4H0LC 3QJSB 1NMBL 2KLSA 3QJTB 4GT0A 3MBEC 5ANHA 2QGBA 4ZO8A 4L29B 1BXVA 1FGVL 2Y24A 4O2CB 1SM3H 1XH3B 4PJIA 4B3VA 1QI4A 4UYPA 1JZ4A 3RGVB 4WK4B 4PB0L 4PJGE 3MV7E 4S1QH 4TNGA 1G0YR 3PDOB 5EF0A 4X9IA 3HPLA 1CT8B 2HTKD 3EBAA 4LB8A 4UNTA 4C8XA 2UV3A 3ASWA 3S34L 2IDFA 1L0QA 4LQ1A 2MKWA 1HSAB 1CGSL 3X1GA 3KPOA 5SWSA 1IGCH 5GGSB 3V0DA 1F8TH 1BG1A 1G4MA 2G0KA 3LPFA 1SJHA 2R23B 3LIZL 4WWNA 1HTYA 4MD4A 4QNPF 1Y7VA 4F33A 4PWEA 2Q20A 3FRPB 3OKNB 4X4KA 4KJWC 2Q7NA 2XI9A 3Q2CA 2ZKXA 1FVEB 1U8OA 5KVFH 1K85A 2JI2A 2XWJA 1FQ9C 2IH1B 4FCAA 1DBMH 1B88A 3DPBB 1JK9B 2A38A 3BKML 4O02B 1IEBB 2AKRB 3QE5A 3ARBD 2EXTA 1F3JA 1E4WL 2N0KA 3EBIA 4Q6KA 5DVMA 4ZMXA 5T1KD 3T1WA 3DBSA 3FAXA 3ILQC 4N8VB 5FUZL 4PS4H 1OCCB 1H9VA 3T09A 1KT2A 2R0WL 3GJEB 1HXMB 3OKNA 2KP5A 4OLVH 5I74B 2O6PA 4NFCA 1IBGH 2IANE 5I8OH 4N26A 2LU5A 1S9WB 4IIQA 2XWEA 5HI3D 2NLJB 3V5HA 1J48A 1OSPH 4A55A 3G5ZA 3GSWB 1WC7B 4AWJC 3D07A 5D1XA 5BV7H 3R06A 5GISH 1P2CA 3RWEB 3QYNA 1K5WA 1SJHB 1LMIA 3T6VA 1PG7L 3BPCA 5HGHA 4OJFH 5DRWA 1PEZA 3FF8A 3IS1X 4D0BA 4PJIF 1ICTA 4GXUN 2D3NA 2JMRA 4PJXE 2Z31D 1T22A 3VFPA 3K6SB 5GS1C 4GIPD 1LEIA 1DN2A 1XF2A 4HUNB 3MLZH 2BP0B 2J71A 5JTWA 4JDEB 4AX3A 4ISVA 2K9UA 4YHPB 1A1NA 2FEEI 3KWWA 4CU8A 3I50L 1I7RB 1YPZA 1MFBL 1V3LA 1AY1H 1XEUA 2FLMA 5JR1H 1L3NA 2WQSA 5SX5K 3UBFA 4XODA 1EXUA 2GJ6A 1KGIA 2R2CA 5IGXL 1W91A 2VDPB 2CKBB 3PV6A 3ALXA 1OE1A 1I8IB 1GJWA 3GJEA 2EH7L 3NRPA 4P06A 3F7YA 4W4NA 2JFCA 3C5JA 1MI5E 2D9QB 4FQPA 4ZXBA 4JY5H 4U33A 1HI6B 5FM8A 4FQXA 4AYGA 5DC0A 4DK5A 5F9JB 4NJAH 3VQMA 1PZAA 2F58L 2MOVA 4P2QB 2H9GB 2Z31A 1XD1A 2E9GA 1QHQA 4PVNA 4JM2C 3UTPE 1JXGA 4KHTL 4QIRA 3QPXL 5MEOB 4WW1A 4ZX5A 2UZPA 3KM1A 2CKNA 5D7SL 2VITA 4OM1L 1XH1A 1MCJA 5CHNB 2ZTBA 1I8LC 2RQ8A 3O9WC 2B0SH 3KAAA 1OCOB 3MLVL 3MYJA 4P05A 3RG1C 4D0BB 3AVEA 2GEEA 1ZA6A 2QPSA 1FL6B 1YEDA 3D18A 1AIFA 5D6DC 4E68A 3NFNB 4H8WC 5ESVB 3JWNC 5B7EA 4LE8A 1O6SA 1JZ2A 2BP0A 1HH9B 5JIMA 4UF7C 4GKZB 3ARFD 4YC2C 3UJJL 2F53D 2GKIA 5D8JH 1DFBL 1NGQL 3DHUA 4OJAA 2KZBA 1UZGA 3ATBA 4MJ6B 1OARL 3SKUD 3BC9A 4YDLB 1IGFL 4AEHL 5JIPA 5KYWB 4JJ5A 5CP7B 3R8BB 4ACTA 5AVZB 4OV5A 3ZGIA 3II3A 4C4BA 1YNTA 1C5CL 2Y1VA 1UXSA 3Q48A 1BD2E 4OF0A 4XPTL 2IOIA 4M3KB 5TE6L 5MEPA 2NOYA 2OTPA 5AVRB 5AD0A 5F9WC 2X3CA 2OZ4A 3KYOA 5CJXC 4ZUWA 4L8CA 1V3MA 1A3RL 1MHHB 5DUPL 1WS8A 1NBQA 3WE1A 3ZW3A 4XPBL 2CDEA 3HZVB 3V6FA 4A68A 1V27A 1WQVT 4AQEB 2PCPB 2DV6A 5H37H 4UTAA 3ULAB 1UURA 4E9TA 2BNUB 3EGDA 3L7FB 3F6JA 4ZS6D 3N0PB 3MOAH 4PRDB 2IBZX 1XGPB 2CDFA 2XTJE 1ML0A 5EO1A 1PCXA 3HB3B 4I4WB 5HD8D 4AJ0A 2GI7A 4YQXL 1KTRL 4TLSA 1NDMA 4N90E 3BWAB 4OUOA 4PJIB 4HV8A 2VH5H 3K8MA 3EGSA 5MHSE 1RZQA 5JNYA 3IN0A 4G7SB 4NWTL 2W1NA 4WTZG 1A6TB 1YDPB 3COOA 5FGBC 5C08E 4CMHC 5GIRB 1LVEA 3GWJA 4G8GE 5C2BH 2CPCA 2GAZB 1JE6A 1MWAB 2CM5A 4HPOL 2CJSA 3AY4A 4WO4B 4PJEE 2ZXBA 2XLLA 3GB7A 3H4FA 4PRID 3MRBB 1NC4A 3RPKA 5I1EH 5CCHE 4AUYA 4HLZG 2CHWA 2CM6A 2OCJA 5D70H 1N7MH 2R15A 3MODH 2G98A 1UADC 3KH4A 4JO4H 4KWUA 1D7FA 1P4IH 5C2BL 3U4BH 2AXHA 1MRCH 3KYOB 3QUKB 1WIOA 4N25A 5I26A 4Y1AA 5DC9B 1YMME 5DHEA 1I4FB 1EIBA 2OXHA 1M3JA 4WI2A 1KPUA 4JM4L 3MNWA 5IVNA 3LV3B 3CVHH 3QNYB 4ERSH 2AZAA 1PX4A 3QZPA 1GSMA 2R4SH 1I9JL 3W9EB 5AW5B 1R75A 4N0UA 1QO3A 3DHMA 4LHJB 5F1NA 4YHIA 2V7HB 4Q74A 3NH7L 4HOMA 4E36A 3UBXI 3PWPB 4UM8A 5H94A 2NY4D 4FYSA 1JZ6A 5A1AA 3NABH 3CSGA 3EGSB 5AAWA 3HI6L 3IB4A 4HHAA 4I2XA 4HUVB 2FLRT 2EACA 1OPGH 2QGCA 3FB8A 4RA0C 4X7SH 2QQNL 1RUKH 4KXCA 4UYQA 4XMZA 4YHNB 3QDGE 3OR6B 4KTDH 3AS0A 5F44A 1GGIL 1CC3A 1I53A 1Z9LA 3AUWB 5A7EA 3CFIC 4P4KD 2DWYA 4ELMF 1UKSA 1LO3H 4W9GC 1B4TA 5T3ZE 2QDVA 1DQML 2GHWB 3BIAX 4OM0H 5HGDA 3UJIL 4IRJA 1S7RA 3ULUL 1TJIL 5JHDD 3T04D 2E9WA 3MRNB 1MY5A 1EFQA 5AW0B 5E08H 3AACA 1UEMA 1ILUA 5C92A 4Z18A 3ERXA 3VG0L 1BZ8A 4ZMWA 5HHXL 4GUPB 3HC0B 4G9DB 1S7QB 1UD6A 4EMZA 2FH8A 1U2HA 4H1LB 4P2QD 4FG0A 2B9BA 1MQKH 2GC4C 3K91A 1CO1A 1N8ZB 3QUXC 3FAWA 3E8UL 4UV4H 4QYAA 3EJYC 5T1KB 5IJBC 5FYLH 5IIEA 1ZT1B 3K74B 1AXSA 5A2IH 3UX9B 2HJKA 1CGYA 1RERA 1JGIA 3VYNA 4U1KB 2JQAA 4JMXA 4M6NH 4PRPE 3BN9D 4PJAE 3MJGX 1E6JL 4L2YA 1LE9B 4LCCA 2XWZA 3F7YB 4ZDHB 3WNKA 1LEKB 4KZEL 3RY4A 3BDXA 1YVLA 4XNYH 3IM1A 4RISH 3IK2A 3MACH 3ENTA 5C9JB 2G5RA 1UC6A 1GYCA 4OZHA 3L13A 4MHHG 1ZT1A 3IDGA 2WLHA 5LWYL 3WE6A 1DQQB 5HJ3B 4BFBD 4P9MH 5I5JA 1KIPA 4FP8H 2QKIA 1EXGA 4NN7C 5E1GA 1F02I 1WT5C 4ODTH 4N8UA 4AIEA 4R9HA 4WQOA 4QOKE 1Y1DA 1TLKA 2EVJA 4MNGE 3TT3L 1GGCH 5ADPH 3IXTB 1L5GA 2YD2A 3JTTA 4UNVA 1MJJA 1H6TA 1DTUA 1J1OH 1X3DA 4HPYH 5FUOH 3VGGA 5GRJH 4KFZC 2FBRA 4FG2A 3VYPA 5IQOA 3FW6A 2MCPH 4FMVA 5AAWC 5T1DL 2OP4H 5B1JC 4IJ3B 4J5VA 3C6LD 1A65A 2QSQA 5CEXB 1EDHA 3M8OL 2Z91A 2L7UA 3HFFA 4PJ5B 2JJTC 5DWPA 4X0NA 4YPGA 1NL0H 4ZZKA 3OF6A 4X8CA 1FE8L 5C0IB 3BI9X 1CLYL 1UD8A 3BUDA 1R6VA 4PJ7F 3K46A 1Q9LA 5GSRB 1AGBA 2YPVA 2VDQL 3HI5L 1T1WA 4J3WA 1SPDA 3MUZ1 1XZ0B 3V0WH 3WLWD 3NFPA 1KWKA 3A3YB 4N3UA 4BZ2L 2ZUQC 2H3KA 1LWHA 2CIIA 4AIXA 1TF4A 3SCMD 2MTPA 3WEOA 1L9MA 2N7AA 2SEBA 4TSCH 5JHBA 2Y6SC 2JCCF 4HWBH 5T3XD 3W38A 1X5LA 3BVDB 1IBDA 1RHFA 5D6CB 4KKBD 2WAQA 2F5AL 3GMLB 3E8UH 4UV4L 2DYSB 4JRWA 2BOLA 1N5YH 4MCNA 5E6IA 5KBNC 5SV3A 3IDNA 1BYPA 1C7TA 1RZJL 1E5CA 3RVVD 2DIAA 3MC0A 5HYJB 3MLRH 3R7RA 1ZEAH 1T1YB 3QUMH 1M56B 3NK3A 1GA2A 1D5MB 5A2JH