1YHPA

Solution structure of ca2+-free ddcad-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
212
structure length
212
Chain Sequence
SVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent cell adhesion molecule-1
publication title Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 33
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08964 Crystall_3 Beta/Gamma crystallin
A PF14564 Membrane_bind Membrane binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.20.10 Mainly Beta Sandwich Gamma-B Crystallin; domain 1 Crystallins 1yhpA01
2.60.40.1720 Mainly Beta Sandwich Immunoglobulin-like Calcium-dependent cell adhesion molecule-1 1yhpA02
1PRSA 2K1WA 3SO1A 1A7HA 1PRRA 2G98A 2M3TA 1YTQA 2K1XA 1YHPA 1ZWOA 1A45A 2A5MA 4IAUA 2B1OA 2NBRA 2M3UA 1I5IA 3ENUA 4FD9A 1BD7A 4NI3A 1DSLA 4PSPA 1AG4A 3SO0A 2JDGA 3SNYA 3I9HA 4JGFA 4AKAA 3CW3A 2V2UA 3HZ2A 1M8UA 3LWKA 5HT8A 2JDFA 1E7NA 2KP5A 1ELPA 2DADA 1ZIRA 4W9AA 1ZIQA 5HT9A 2M3CA 1HK0X 4PSRA 1OKIA 1ZWMA 3IAJA 4EL6A 1H4AX 1GCSA 1AMMA 4GCRA 4GR7A 2BB2A 3QK3A 1A5DA 1ZGTA 2BV2A 1BLBA 3HZBA 1HA4A 3ENTA 1NPSA 2KFBA 4W9BA 3SNZA 1GAMA 1HDFA 1ZIEA
chains in the Genus database with same CATH superfamily
2H2PD 1JDCA 2DQEH 3OZLA 4PTUB 1AS6A 4ELMB 1UHVA 3QIUC 1J1XH 4FN0A 4FP8H 3QDMD 1TEYA 4V1DB 1Z0MA 5CU9A 4B97A 4QRAA 1L9NA 3MI6A 1U30A 2IWFA 3IT8D 1X5XA 2RD0A 3ARXA 2WBJB 5AG8A 5IBTH 4XRCA 5CGMA 4TNFA 3ZRFC 2QT6A 1OE1A 4O02B 2IDQA 4KKCD 4LRIC 5LO7A 3L3KA 1E43A 4MXQC 4GUPA 4HUVA 1OW0C 2BOBB 2UZXB 4KQ3H 1H4AX 1BSIA 2DLGA 5E2WH 3UP1A 2JKXA 1TVBA 3RL2B 1MCJA 1BVOA 4R4BB 4PJBA 1FZKB 5DUJA 3OKLA 4Y1SA 2FSEB 1B4TA 4CMMA 3MTXA 4E9VA 3LPFA 3NAAL 3TO4A 5BV7L 2BNRD 3JT2A 5IW3A 2CDEA 3CH1B 1DFBH 2FWLB 2WVTA 4NO3A 1XD0A 3CXHK 4P4RA 3X13B 1FFNB 1U92A 3O6FC 3QCVL 5AVRB 1BEYL 3SYOA 3B3IB 2XG4B 2Z31C 4APQB 2WN3A 4LHJB 5BZXA 4D0DA 2WKOA 5LN8A 4K07A 1VPOH 1SN5A 3WTSA 4MS8D 3FT3B 5I1AB 1WFOA 3QO1B 4MMXC 5EPMA 3GMNB 3CVIL 3FSWA 4NXSA 5I6NA 3S3CB 1MCRA 4KXZH 3KXFD 3QJTB 4YHMH 1I1FA 3SGDI 2E9JA 3MLRH 3P0VL 4AKOA 2G9KA 1MCLA 2YZ8A 1CG9B 4LSUH 4YC2C 1OTTD 5F0MB 5ESQB 3RA7H 3H54A 3BVXA 5CD3B 3EOYG 4X7CC 4EN3C 5BO1H 4WGVB 4BFIB 2ICEB 3NQIA 4L1LA 3QQ3A 1A64A 2O6EA 2HT4D 2FUTA 2EYRB 2N0MA 1UD6A 4MAYB 1UM4H 2OL3L 2VQTA 1O9WA 2J8UF 3MGTB 3QORD 3DK2A 2BIQA 3D2TA 4JR9H 2HFGL 5GZNC 1S9VA 3ZOAA 3WS3A 4UTAH 1SEQL 4K15A 4UF7C 4XOAA 3ZDXF 1OCWL 1IC7L 1QTSA 4YUEH 6CGTA 5JO5A 2GSGB 3DTXA 2XOTA 4JFSA 3O6ML 2YAHA 3MFFB 5D7JC 3U48A 1SVCP 5CIPA 1KTDB 2B59B 1UKTA 4NENA 4PBDA 1S9YA 5K59F 1WZKA 3TO2B 2Y36H 1HYRC 4TN9A 4WHYH 3L9BA 2WZ0A 2QQLL 4RSVA 3DNKA 3ERXA 3QNZB 2J4WH 3L5XH 4HT1H 3TBSB 5T1MB 3O3EA 5FWRA 4DPCX 4NN5B 3CMGA 3K8MA 4LPCA 3C5SA 4WSJA 3APFA 3MLSH 3STZA 1PSKH 4Y5VC 4OSUH 2YD7A 4YZWA 2R15A 5DFAA 3V0FA 5FW6A 3T6ZA 5C86A 1CTNA 2H45A 4OM1L 1COBA 3OLDA 4R4FL 2GUOB 4Y5XA 5D2NB 3MRJB 1E2VA 3GDBA 4XMPL 3ESMA 5FYJD 1EO5A 2ESVA 4XMLH 3GHBH 1HEZA 2IC2A 4G9FE 4A6YH 1TZHA 1H3VA 1A4CA 3NIDF 3EHBD 2EH8L 5IHUL 1L7TL 2MQ0A 4XNUH 3OHXB 2O1AA 4E9QA 3V0WH 5IMMB 1SHWA 5AVXB 3MRNA 3SYPA 4JG1H 5IJVA 5DD3H 1O9VA 3QJHB 2H8PB 4NQCB 1YN6A 1HK6A 5AYUH 5JDSB 4HCRH 3ZIYA 3AM8A 1GY1A 1A4KA 1NCDH 1RUML 4FQXB 5IR1A 4DO5A 1KEGH 5DUMH 1G9ML 2X6BA 3B9KA 3H55A 5D96C 3WIHL 3M86A 3WKNA 5BXFB 1JDAA 3T4YA 2VN5A 3K2UL 3EGXA 1XTLA 3MN8A 2C1PA 1XH3A 3A6BH 3HG5A 4WJKB 2F8XC 3NRPA 1T1ZB 3EFFB 5IFJA 2BZCA 3ATBA 4QXWA 3J27A 3PAUA 2D7MA 1I75A 4YWGH 2W9LA 1AZBA 4NFBA 4QRBA 5HHVL 1CYXA 3QDGA 1HWHB 2VE6A 1AFVL 3QT2A 3ZZLA 3I6GA 5T33L 1UUNA 1E8ZA 1JF1B 1TQWA 2DQHH 3N43F 4F8PA 4X0KB 5FIEA 1VKXA 2W9DL 1TJHL 5HHNB 4Z95H 3C8KA 1QATA 3I6SA 4HU2A 3NSDA 4H0GA 1S7UB 4X4ZA 4E0RA 4MFHA 1ZY9A 5T5FA 4B9IA 2DYRB 3QI9C 4GI6A 4ZAKB 1LEGB 2XG5B 4FMKA 1AMYA 3MLYH 4KDVA 2WSKA 2C1OB 5I15H 2QFPA 5JIQA 1I1AA 5L2KB 2I7OA 1UVQA 2YWYA 2BSRA 4V33A 1FIEA 4YSOA 2R23B 1P7HL 1CFTB 5TTRA 1KFAH 2D7PA 3ULVF 4YVUA 1OARL 5A16B 1ZLSH 2QGBA 1AC6A 5HYSA 4AMKH 2FGWH 4NDMB 1NMAH 1QLFA 1WC7B 2G2NA 1I9EA 3WNNA 2NZ1A 4G8FB 4IMKC 2EIKB 3E6FB 2AEWA 2AJSH 3IDMA 4W81A 1T03L 1GTNA 1XTMA 5AAWC 2NCMA 1LQSR 2IWGA 5IG7B 2NY4D 3ULUH 1BZ9B 3GGWB 2OQJB 3ENEA 4JM4L 4P23C 3W82A 4Z7QE 5E94A 2Z7ZA 1MIEH 4WFHD 1WT5C 2YA1A 4X6EA 4ELMF 5I5RA 3GHEH 2Q8AL 3EOTL 5INDA 2JNZA 2Y1ZA 4DGVH 3BLBA 2JMRA 2KC0A 2G75B 1CXKA 1T3FB 5E8DH 4JFED 5FYKH 2M3TA 3NFNB 4MXWL 4EN3A 3DO7A 2RQEA 2ZCLL 1TZAA 5CEZH 5H94B 2P52A 1OY3B 4WW2B 1OQXA 4BELD 2H41A 3GSQA 4NRYA 2FJGB 3LEYH 5TDNB 3L3DA 3ZQ9A 3KLQA 2A6DA 5SX4H 3M7OA 1U8JB 3L1GA 4XNMA 3POCA 4PGEA 1CYWA 4KJPD 3B9AA 2VDNH 1RI8A 3L5WB 1RUKL 1WGVA 3BP7B 4NM4H 3U6RA 3US0A 1DO6A 4Z7VE 2R4SL 3SBWC 1TSRA 3BUBA 1SLWA 3TA3B 1UACL 1CLOH 2H4EA 1H3PH 1E42A 3FCSA 4OCXL 4OAWB 4PRPD 3DXAB 4PS4L 3ARGB 3MNWA 1EBPA 5FM4A 3DX7B 2UY6B 4OIIL 1Y1DA 3FT4A 2X9ZA 2Q8BL 1Z9PA 1CFSA 1T5WB 5DT1H 4GRWE 1XL6A 1AQ8A 3MNZA 3VI4A 2AHIA 1XSIA 2FSDA 5KVMC 3ZKMD 4NS0A 2B9AA 3VD9A 4HKBA 2GPZA 2C9PA 3S48A 3LV3A 4Y5VA 4R9HA 5C0IB 1Q9LB 1RZJC 3SKUD 4JHZA 3MTRA 2YK1L 4N4YB 3QULA 1QBLL 3WS6A 1DR9A 1N10A 4OY9A 4TYUA 2WNKA 1GKOA 3OF6A 3EOAB 4OZFA 1HAUA 5DTFA 5EIIA 1PZUB 3FAXA 3RX5A 2P3YA 4YMPA 1BYNA 3PGCA 1S2EA 3L2MA 3O0LA 1HS6A 4QTHB 1DN0B 2IBZX 3WD5H 3U36B 2F6AA 3G3LA 3MJWA 1KGXA 5KSAB 4CADB 1ESOA 1T1XA 4ZNEE 4QCIA 2YPVL 2HN7A 3MBWA 5TH2B 4JE4B 1NBVL 2CNZA 2X40A 2WLHA 3HNSH 1YUHB 3V0VB 4YHKH 3F7YA 3SPCA 3C9NB 1YMMB 4G9FA 3EYUH 1FYTD 5FYLH 3VGAC 1T89A 1NCJA 4PJEE 1F90L 5ELIA 2VZ1A 4PP2A 3TBBA 5A7EA 1WFNA 1NIDA 3BZFA 5D4QA 3BIBX 4ERSH 3BH8B 3BUDA 2VDOB 3EBIA 1KCUH 4RRPA 4O2CB 3I9PA 3MC0A 2Z7YA 3G9VA 5AUMB 3SPIA 4E68A 1XT5A 4HEME 4JPSA 2G3MA 4K2UH 1A7OL 1DVFC 1VADB 4Q14A 3MRGB 5C08E 2O61A 3MA9H 2FEEI 1KYUA 2WBWB 4I5BB 2OS7A 5INCA 2R59A 2DWDA 2ZP9A 4OT1H 3RNKB 1PLBA 4U1KB 1S3KL 4JO3H 3RWEA 2WLYA 3F7QA 1RCYA 3CIQA 4RFOH 1U8MA 3CLEH 4QNPF 5FLVA 5LAPA 1TMQA 1Z3RA 4FXKA 4A7QA 5KSBB 4PV1C 4F7MB 2WN2A 3BUYA 4LLDB 3CGTA 1KN4L 1MW3A 1U41A 1CFNA 2IPKB 3HZ3A 4BHUA 1RJCA 1RK0B 2VDMH 4JB9L 3B7SA 1BAFH 1FZMA 4KO6A 2ID5A 1YEFL 3RUGE 1BBJB 3VXMD 2ATKA 3FW6A 3VD1A 3TOPA 1UM6L 2UX7A 1TLMA 3RWCB 4IJTA 1I85A 3WBDA 3KBHE 2XWJA 3HB3C 1LMIA 5F9OH 2PCXA 1F3JB 1MREH 2WQSA 3IN0A 4M7ZB 4M9OA 3RJOA 3D07A 4ZUWA 2PP7A 3JUZA 3VFGH 5MHSE 5HPMB 2HTKC 2CRZA 2Y7NA 5FYJL 4D9LL 2D03H 5IVZB 4OGAC 1BPVA 2J8UA 3U4BH 4FLRA 4OQTA 2EJ1A 3BYYA 2J6EH 1AQDB 5GGUA 1XF3B 3P9MA 5BV7B 1SXCA 2AMGA 2C9VA 3BAEL 1ETA1 4PGZA 5DZLA 4HFUL 3PQYA 2F7RA 2QDVA 4JRYD 3IJSA 5AAWA 1U2YA 3VNYA 3QWRA 3ARFA 3H3PL 4G72B 4PCYA 1S46A 5CZXC 4F2EA 4P23A 5H4ZA 2CLRB 4GNKB 3PF2A 4AM0A 4N6QA 2Y5TA 3HHMA 2M83A 3L48A 4PJ9C 4LU5H 4CMHC 4JS7A 1EBAA 1UA6L 4RCAA 4H20H 1AE6L 1P7QD 2HJLA 5IQNA 3UJJL 2AABH 3KMDA 1XAKA 4R83A 4MYPA 4XVTH 5IJCC 1DDHA 1CDJA 1D5MA 2YKLH 1A7QH 5EA0H 3DBSA 4X4YA 5KAQF 4WO0A 4JQIL 2APSA 3EJJX 1G7HB 2OSLB 3UBXI 4FS0A 1EERB 1B6UA 5J1SC 3MRQB 1L0PA 3MLPA 1UJ3B 4P4KD 2PP9A 4I48B 1KJ2L 4MXVE 3ZE1E 5IHZA 3IDNA 3NTCH 4GP8B 2C3WA 1KGCE 2IADA 1QFWH 1UXWB 3IGAB 3ZQWA 1S7TA 4KKAC 1Q9OA 4HPOH 3MV7E 1AG4A 3JVGC 1II4E 2YFNA 3IE9A 2EUWA 3VSTA 4ALAH 4DKEL 3CC1A 1BGXL 1IGML 35C8L 5F7WC 2OL3B 5CEYB 5D70H 4QRRB 3KLKA 3QZWA 5KYUB 4O9HH 1MF2L 2AJZA 1NWOA 2X89A 4HP5A 3BVWA 4BKLA 3DHPA 2CHXA 4CRPA 5DSCA 5DURB 2XZQL 4F15C 5CZVH 2AQPA 2VAAB 4UZUA 4HSCX 1CFQB 4NP9A 2XY2A 4LSRL 3TN0A 5FUOL 4LKXB 3N1QC 3V5DB 3FB7B 1IKFL 3BKJH 2RBLA 4J1UA 3QZNA 1DSLA 4GLRH 1WBYB 5BW7C 5BRPA 5CF3A 3DHJA 3FQTA 3GMRA 1QSEB 1FQ9C 1EHAA 1M6OA 2VXVH 1CS6A 3FCTA 2YFOA 3GPEA 4FYTA 4HF5L 4JL1A 3CZKA 3HE6C 3JWOC 3QEUB 2WSPA 5GGTA 3ABLB 3E0GA 4M00A 2VO5A 1LO3L 4PJXE 5D2LB 5IQ9A 4LLYB 4A7TA 4WW2F 1HN1A 1R47A 5AG9A 4XN2A 2Y7LA 1N59A 5EZJA 1E5YA 1ADQL 1UWGL 1Y18A 2UZIL 3QBTB 4XP4H 5GRUL 1KBVA 1TTGA 3I9AA 4LEXH 4QHUA 4WFED 1PD0A 4FNLL 2XN1A 4P9MH 3TBVA 4JO2H 5ITFA 1NCTA 2OMXB 1BXUA 2CM6A 4X4ME 4DT2A 1QTYT 4ANKA 4ZNEA 2ZSVA 4PY7A 2CUHA 3MGOA 3U4EA 4ONHB 4TUUA 3AS0A 5ENWA 1SJEB 4KV5E 1S78D 4U7KA 2LLGA 1LE5B 2I69A 2GW5A 3EOBA 5JPNC 3NJJA 3QIWD 3BKCH 4WU5A 1V5JA 3IFOA 1CU4L 3ENTA 4Z3HA 1A4JA 1R0AH 4J3TA 5H37A 3CXDH 5LG1A 4H40A 4PJEA 1SQMA 5LCVA 4JO4L 3WTWA 2FEDD 1YCSA 2Z7UA 4UDTB 1UD2A 1DVFA 3I2CH 5G2NA 4JGNA 4XPTH 1K2DA 5IBLD 5LKNA 1KG0B 1HQ4A 5B1KA 4JFXA 5GSVA 3DSFH 1GZQB 3VFVA 3EH3B 1GC1C 4FRWA 1J5HA 4N9GA 3FQWA 4HEMA 5AKSA 3PWPB 4I3SL 4MJHA 4LAQH 1BZOA 2EADA 1OP3H 4F57L 4LOUD 4J12A 2OCJA 5C08A 3CZLA 2Z9TA 5JPMB 4FNTA 3T2PA 4ZMWA 4ELMA 3L81A 5LXVA 5TK4A 3X14A 2A74C 4CSTA 4L5FE 2YIHA 4FNUA 3DJRA 1D2PA 2F7OA 4HKXB 4O58H 4Z0XA 2JV6A 2WBJA 4F8LA 4XNQB 3DO4A 4NYLB 5DYFA 3UTSE 4ABVA 4O02A 5KZCB 4ESKA 1WA2X 5D1ZB 1I3GL 4JRXE 2ZX6A 3ZK0A 2NY3C 2BOBA 1X5YA 3CDGB 1YJDL 2B14A 2VUOA 4OZHE 5I73C 1FZKA 1KCVH 3QHFL 5IMOB 3ZKND 2B2XL 1J0YA 1JF5A 1INQB 1LK3H 1SY6L 4TVUA 3VGGA 4U0RC 3MSPA 1WO2A 4XNDA 4M6OH 2V4LA 3T2OA 3LDBC 4UOW0 1OCCB 5E00A 3UCQA 5FUCE 3ILPB 3MUZ1 1FFNA 3MLWH 4HUXA 4Q89A 3IXTA 3QDAA 2FB4H 3RVWD 4H5SB 1FORH 4P8QA 2XG4A 1H15A 5FOBB 4MWFB 3IFPB 1UADC 3MBEC 3MFGB 1RPQA 3GRGA 3MRKA 4NHCH 1KLUA 5EU7C 1MCHA 2Z65C 5FUCC 4LMQI 5I1AA 4NN7C 1J1OL 3QO1A 1T4KB 1TXKA 2ADFL 5ALCL 3GMNA 4M8RA 1J88A 1JMZA 1GAFL 5KSBF 5JQ6H 1B0GA 2X3CA 4G7QB 2H3XC 3DJSA 2KBGA 4P05A 3ZHDA 3OR6B 3KCPA 4FQLL 4LDLB 1CG9A 5B39B 2FVNA 4ZRGA 5SWSE 1ZVSB 3P2TA 5L9DL 1G7MA 1Z9OA 1EEUA 1XGZA 3NJXA 4GUCA 4IBSA 3BWZA 5CD3A 5HVHC 2MCPH 2P5WD 2BNQD 3LKOB 4XMZA 4F9PC 4BFIA 1ZHBB 4PD4J 1FWXA 3IMUA 5HY9B 1AG0A 2QJDA 1RZ7L 1ETB1 3QDMB 1A6PA 4MAYA 4ZPVB 3UTTD 2PO6D 3MGTA 1RULL 4P2CG 2GC7C 3O4OC 2VLME 3MV7A 4OJFL 3P3YA 2YPKA 4AIOA 1KTJA 5TE4L 1KMGA 1RZKH 3QUYD 1AZUA 3T4AB 3LIZL 1JXDA 3VG0H 2DY2A 4A7SA 2GTZB 1AD9B 1MCOH 3KDMA 3D3VD 1UT1A 2IGTA 5T1DL 1SLXA 3AREC 3QAZB 3KJ6L 4RMQA 2B59A 5IMKB 3FT0A 4ZTPH 2NW3B 3TO2A 2BNRB 2F53D 1PZ2A 3N91A 1JXFA 5GGTH 1BXVA 2OTWB 4NM8H 3TBSA 2GBTA 4JFHE 5I1IL 5T1MA 3DIVA 3WU1A 2VLKD 5GHWH 1PDKB 1KCSL 2GB2A 4Q0XL 5IQ7L 5TFSL 4EUPB 3D9AL 2VDQH 4IOFD 2APXA 1WGOA 3D69B 4G7SB 4LMQE 4G11A 3MYJB 43C9B 3A3YB 3O2WH 2RB8A 1KTRL 3MRJA 4H0LC 1D6VL 4RX4D 1J5IA 3CFKB 4R4ND 3VQ1C 5T3XH 3KXFB 4GKNA 1XGQB 3GWJA 4EIBA 2BWDA 4K8RH 4LOVA 4AIXA 4H8WC 3CTTA 1F53A 1OGSA 1J48A 2VZOA 5EN2A 3SE4C 3MO1B 1MAJA 1G87A 1M4KA 5H37H 1YPZE 3UBXA 5LCVH 1WKTA 1PJWA 3ULVH 2VRAA 3FONB 4JX0A 3U6XA 4E9LA 5IMMA 3FQUB 1KC5L 1JFQL 3P3SA 1Q0EA 5EU5B 5HI5D 2X4OA 4WEMB 2H8PA 4NQCA 1CMOA 2E74C 4UQ2A 1DQQB 4DW2H 4GFXA 2BRRL 2JI2A 4RMSA 1RLWA 1RXLA 2CJUH 4FQXA 3QORB 3UPRB 4BE6A 4FGMA 2XTJE 2CGZA 5TQ0H 3B7TA 3QHTC 5AD0A 1B3IA 5BXFA 2TSBA 1AIFA 2K7QA 5E6ID 3UL4A 3QXUA 3FN9A 1U4FA 4HC1H 4YFLF 4YXHL 1QQDB 3DUUB 4RA3A 5AENA 4PS7A 3O6KL 2KPWA 3S8WA 4U4IA 5D2LF 3OGOE 1RZFH 5EUKA 2XTJC 3OJMB 4HWBA 4O02H 4FLQA 2EC9U 3H7BB 2H1PH 4OVVA 4KK9C 4I3RL 5C2BL 5D7EA 3UGEA 5JUEL 5EMYA 2E9GA 4X0KA 4Z7UB 4JUTA 3FN0L 2FYYA 2HSIA 3BSGA 4NNPL 1OAUL 2E7DA 4LLQB 5LHDA 1S7UA 1FLRH 4YVNA 3WCYA 4JRXA 1LEGA 1NINA 2MQGA 2XG5A 4KRPB 1IFHL 3OKMB 3SD2A 3PABB 5C7ZA 2EXWC 3V6BR 5FPIA 4XN8A 2NY2D 3TC9A 15C8L 1CFTA 4H88L 4ENEC 1Z9NA 4LSQH 1I3VA 3CBKB 4KTYA 2X4NB 1IFRA 4L8CB 4NDMA 4J3SA 5AW7B 4GP4B 2GJZB 1WC7A 3C8DA 3EHBB 4TULL 3U2IA 1LDSA 4HW6A 1CF8L 5F6HI 1ZCRA 3WY1A 1HAWA 5CZKA 2DMKA 2IOMA 1CUOA 4XTRC 5IG7A 1JZJA 3HW7A 4FMFA 4JFDD 3BQUD 3T6WA 5J0BA 2OQJA 5FCUH 3FDWA 1BG1A 4W9GC 4NLAA 3RGVC 3LB6C 1FYHB 1BIIB 1JNJA 1HI6A 4POZC 2G75A 1MJ8H 2VN7A 3JV5A 1T3FA 1EZVY 3D85D 4I7ZC 3WHE1 1RUAH 3CZEA 3ZDWA 3R06A 1HQRA 4K7PY 1IX2A 4KHXL 4F9PA 2HMIC 5J9PB 4NOBA 2D8KA 1HH6A 4HETA 4WW2A 3L08A 1NSNH 1CLZH 4P9HH 2BVQB 2FJGA 2KH2B 2ZNXA 3D52A 4ONOA 4HGKC 5TDNA 1A6ZB 3FF7A 4IBWA 1OF0A 1WCBB 4DP8X 1W72L 3DUSB 2ZXBA 2HX7A 3WE6A 3H8NA 1T2XA 4XNYH 5E9DD 4QJ3B 1E6OH 3BP7A 1F11A 4UOJA 3QZPA 5DHDA 3TVMD 3RJQB 4QRTB 2ZKWA 3HZVB 3S8GB 4W9DC 3DXAA 1YNKH 1WZ1H 3K6FA 2DQDL 4NC1E 4OZGB 1XQ4A 3BVNB 3DX7A 2UY6A 3O6FB 5HDWA 3SDAD 2EE0A 1AXTH 4UBDC 3AREA 2P24B 3MLZL 3SQOH 5FFLA 4ZMOA 1R46A 1SGKA 2BSDA 1T5WA 3RHWK 3D4YA 2WLLB 4TUJB 3S88H 1USQA 1NCAL 2XXFA 2ZUVA 1T0OA 4HUKB 3HZ2A 4NC1C 2IDFA 3S35X 3E8UH 3OPUA 1E8WA 3I6KA 5BRZE 3QSKB 4M8QA 3MLUL 2XWTB 3X1EA 4MZ2A 1IC5L 4ODHH 5C0IA 4R7LA 2YN3A 3FYIB 4LSDA 2ZWYA 5E6SB 3DX2A 4HH9A 3ELQA 3MRDB 3CSYB 2NXYC 2WXFA 2QQQA 4LPYA 4P2YA 4DQOH 5IIEA 1BAWA 4Y19E 5C0GA 1GW0A 2XN9D 5IEKB 4I4WA 2NY4B 4DVBB 4M7JL 3H0TB 1QUPA 2F68X 2X0VA 4HIQA 4QTHA 3TBWB 4GY4A 1GGCL 3U36A 5KSAA 5I18L 3QUZC 3L3IB 1QUNB 4WO4D 3R0MA 3CUPA 5EBGA 3H42H 4M3KB 2ZQKA 1UGNA 1C12B 3HR6A 4JFEB 2ZONA 1LD9A 3ZT7A 1CZ8H 3LQAH 4WTQA 3C9NA 3E38A 4HIPA 1KACB 1EEQA 4APXB 4N86A 1F02I 1IGFL 4M62L 4N6RA 4WI9A 1YEDA 1EANA 3CFCH 4XPAL 5AWNL 4I18C 4A7GF 3AMKA 3UJTL 3BXNA 1NLBL 2PPDA 3RVUD 3BH8A 3EYOA 4LGRB 1JTPA 2B0SL 5SWZD 2W59A 2OW6A 5AUMA 1UWEL 3A67L 1F00I 1HK0X 4Y16C 4L0PB 1WVZA 4PW3A 4LLVB 1PAMA 2YQ2A 4PRPB 3HS0C 3MRRA 1XIWC 3MRGA 3QFGA 5I1GH 3BAWA 2JFCA 2Q2EB 4I5BA 4KZ0A 4GW1A 5L6YH 1MQ8A 2E9IA 3E7JA 4U1KA 3RNKA 5B1JA 3JXAA 4TQPA 4ETQB 2XQBL 4N8PA 2LLLA 1T1YB 1KEML 4WWNA 1FDLL 3T04D 4PP1D 3ULAB 5C6WH 1RFDH 4MVBD 2IAND 4NUGH 1N5YL 3OR7B 2IPKA 2QVFB 4L8SC 1OEZW 2ZXAA 1RK0A 4AV4A 4E9YA 1LK2B 2ZKHH 4XMKL 4OCWL 3U46B 3FS9A 4G8GE 4EOWH 5F9JB 1NLDH 2PF6A 3RWCA 1BLBA 1HA4A 4DTGL 2QVMA 2I60H 4NC0B 1BVKB 3L2NA 1F3JA 2AXGB 2IFFH 4ZMQA 2HLFC 4POYA 1JXGA 2J1ZA 4TNVK 5AB9A 4DPBX 5JIHA 2BJMH 2OSYA 2QSCH 4AG4L 5IY5B 2CK0L 6TAAA 2QSTA 4FEMA 2Z6FA 5CSGA 3PV6B 1E5ZA 1X6LA 1JHLL 5F2FA 4UM9A 4ZMXA 1IEBA 1TJIH 3BLKA 1Q1JH 5GRXG 3Q44A 3WTXA 4AJYV 4BCXA 1M7UA 3CNKA 1SMOA 4S0SD 1FYTB 5AZUA 5HI4C 2QADC 4NRZB 3W0WE 4KMTL 4QRPD 5E08H 2RFXA 1AZRA 1MQKL 4NZ8A 3UAAA 2IWEA 5AVTB 3FRPB 2QQKH 5EZLA 4MS6A 4TKWA 5F6IC 3APNA 1VZHA 4KXBA 4UQBA 4C55A 5H37G 1FRGH 3GYRA 3I9IA 1EHLH 4Z7UF 5KVGL 1G7HA 2W0KA 5DGRA 3H6JA 4O2EB 1MVUB 3GFUA 3MRQA 5DHEA 2AEPL 4I48A 1W8EA 2J44A 2I5YL 2MSPA 4HJ0D 1IRAY 3QDME 3VYOA 2ZAIA 3IGAA 4KK6C 2P8MB 2ICWJ 3VQ2C 4Y5YB 2IPTH 1YTQA 4KVCL 3QS3A 5E9AA 5KVFH 1BVZA 1ZLUH 4XVUC 1DJHA 1TQCB 2OL3A 4JY5L 5CEYA 3WXWH 4CGUB 2Z91A 3VXMB 5F7UA 3QG7H 4HWNA 2RR3A 2FHCA 4QHMB 1QW8A 1ZT1A 3S37L 3WKYA 4YDKL 2WZPA 1BDYA 3HZMA 4ENZA 5E4AA 3ZZSA 1C7SA 3OMNB 3S5YA 2VAAA 4FQIH 2BRQA 3HG1E 2VQ1B 5J57B 2R0ZL 3V5DA 3FB7A 5DRZB 2ZAGA 1DE4B 3UXFA 2NZ9C 3T2NH 1WBYA 5FYKU 6PCYA 3OKEB 5F7AA 1T6VN 1GYVA 1QSEA 4AEFA 1DBBL 4ZFOL 2AV1A 2A99A 2C9RA 4JRYB 1E4XI 5BRZA 3TEWA 2MOGA 5A2IH 3QEUA 4QXTA 2DW5A 3SBPA 5HJGA 5HHMD 5J11C 1CLYH 4OGXL 2J21A 4LLYA 4CKVX 5JXAL 1PZBA 3KXFE 3N9GL 1EEZB 4HV8A 2OKMA 4Y19A 3GSXB 4JJOA 1P7QB 3CCHB 4OGYH 3KPRD 3RVTC 3SGKA 3T3MB 4YH6A 3AT9A 1EAQA 3NMEA 4A04A 1GZHC 2OMXA 3D0LA 3W3BA 3SE8L 1WS8A 1I7UB 3ATFA 2HRGA 3ASOB 5EF2A 1U6AL 2FATH 4I18A 2VDOH 3OAUH 4ONHA 4P4KB 2GEQA 4OZGF 3C60D 4KTEH 3GIVB 1LE5A 1ETZB 3AJ7A 1OM3L 3OMZA 1A5DA 4JFQA 1OTTC 2WZ5A 5E0FA 5IF0B 1UATA 2ED8A 4DEUA 3S36L 1AD0A 4PGDB 4UDTA 4P5RA 1UEMA 3HS0A 4B27A 1XIWA 2HPOA 4MMZB 3EUUA 2QKSA 4MB1A 1KG0A 5L7XH 1S7QB 2NXZD 3BDYH 4GQ9H 4XP5H 4XXCC 1GZQA 1FL3A 5KYXB 4HS8L 1JNHB 1P1ZB 3WIHA 1REIA 4HSAC 5LXGL 3P2BA 1J1PL 3R4RA 3QE5A 3IBOA 1N5AB 1NPNA 3ABKB 4OLWL 4QXUL 5JPMA 1N64L 3DX9B 4L8SA 5DMIL 3TNMB 1J7VR 2W07B 4PJ5E 5KBLA 1ICTA 1FVEB 2BM3A 2AK1L 1SXNA 4GO6B 4XH2B 3SKOB 5I9QB 1OTUD 1NUFA 5D1ZA 3ZKXC 2V5RA 4A1RA 3ILQC 4HJGA 1T21B 5D7LE 1EHNA 1QLEL 2Y07L 2IBBA 4GYBA 3RPBA 3S8FB 3QISA 5IMOA 2ICWB 5BV7H 1X7QB 3DGCR 3B2VL 1INQA 2EVGA 1BJ8A 5EUOE 3BUPA 1LWRA 5HJDA 5CBEA 5HI3C 5DZAA 3B5HA 3QCVH 1BEYH 1ZT4B 2DMHA 1GMEA 3VXTB 5I1JL 3ILPA 4FFVD 4N0CC 1NAKL 1LP9E 3PXHA 2E86A 1AGEA 3ZSSA 2HTLD 4F7TA 1ID2A 2KLTA 4D8OA 2XNAB 5FOBA 4B0MB 4MWFA 7TAAA 4N0YH 4LIQL 4TNWK 3QIWB 1VEMA 4TQ8A 1MY7A 3BO8B 2WSDA 2XWZA 4FJ6A 2E56A 4MQXD 3W0WA 2A6JB 1MCWW 1Q0XH 4H1LB 2H26A 5ESAA 3RTQD 3SO5A 1QHQA 2P8LB 5CNHA 2ISDA 4HUUA 5IB3B 4PJFB 4JG0H 2A1WL 3SO3C 2ZG3A 1BBDL 1X5FA 4FNPA 1OXYA 3N04A 2NY5L 5K9QG 2JELL 5I23A 5JYMA 2K9UA 3LKOA 5LUMA 1MCQA 1ZHBA 1SYVA 1J0HA 2OL3H 4AQ8C 3V2AR 1QW9A 1U4EA 3QDMA 4ZPVA 1ZHKA 2HFGH 1U8QB 2Y23A 4LSTL 1A3LL 4XE5B 3F00A 1W72B 3RI5K 4AE0A 2KZ1B 4PW9A 4FYSA 4XNXH 3IXAB 2ZTBA 1OCWH 4L2LA 1IC7H 4Z7WB 5KAQG 2AJUL 1FSKB 3RWIA 1PQZB 1OO2A 3O6MH 4UWQB 5FW8A 2GTZA 3TZVC 3MJ9L 1X5JA 4X7DC 1L9QA 3D05A 2OTUA 3ARBD 4FXLA 2IDUA 3L3HB 3TX4A 1HKLH 2P44B 5HGBB 1BZ7A 1A6VL 2QQLH 1TYRA 5IMKA 3HG1A 2J56A 1DLHA 3NCEB 2I32A 5KW9L 4HS3B 4EIZC 2OTWA 3HRZC 4IBZA 4AW4A 3G04B 2BDNL 4X4KA 5C0DB 2XN2A 3RWHB 1IEAB 1PDKA 5FEBA 2UWEB 1R1CA 3FUHA 4PIRF 4L9LC 4EUPA 4M4RB 3VG9C 1IV8A 4OM1H 3F8UB 4F2FA 4MD4A 4R4FH 3UTPD 3ZT5A 5JXED 43C9A 4LCIL 4U6VL 4AC2A 2H0FA 4UILL 3VM7A 3W37A 3NCFB 4Z23A 3UG3A 3MREA 4JFEE 3KXFA 4P2AA 1XGQA 3SOBL 3WMPA 5CILL 2EH8H 5IHUH 1L7TH 4IBVA 1G7LB 3PREA 2YPVA 5IM7B 2PPEA 1ZVNA 2EE6A 4Q4EA 2VQUA 5MENB 5LB1A 4P5KB 2X4QB 3NQKA 3X11B 3KPLA 1GJUA 1XCTB 4PJHE 1UWXK 2ZPKL 2JDGA 1RZQA 2CKBA 3BD5A 3SY0A 3U30B 2P5WB 3HZKB 3RE0A 4KZDL 2C4FU 3PWVB 3FQUA 2ZCZA 4RGMB 5J89A 5EU5A 1RUMH 4ORGA 4JDTL 4OCSL 4U3HA 2N59A 1G9MH 2X42A 3J7HA 5AKRA 4AQOA 3WIHH 5HBBA 4PRPE 2PO6B 3BLPX 2WCGA 5EIQA 3K2UH 3QORA 5GS0D 3UPRA 5EU3B 3ML9A 4HJJL 4YPGB 2ZSWA 3HI1B 3CD4A 2GIMA 2V5TA 5DCCA 2ITCA 5I8KL 3BOVA 2A0LC 3BIAX 3CQPA 5HHVH 2NY0D 3QCUL 3BN9C 4K71C 4Q7DA 2XWXA 3L4YA 2PCPA 2EILB 2OX5B 4P2QD 2Y5QA 5IW1B 1JVOA 1K6QL 5T33H 3HKFA 1JGVL 2YJQA 3H7BA 2JKRM 4G42B 4YSCA 4OLYH 4P57B 1TJHH 3N06B 3BESR 2F1EA 1MCIA 2F53B 4Z7UA 4CC4C 3FQYA 2LTQB 1P84J 2R29L 4LBEA 2AQSA 3VFTB 5C09E 4QOKD 2VLKB 3B83A 4NAMA 3UYPB 3DIDA 3T0ED 4PJCE 2BVPB 4XZUA 5I5MA 2FX7H 1RQ5A 2P28B 3O3AB 5IWLC 3CK0L 3F5WB 2YMXH 4F9LA 5I1DA 3ZBMA 4N20A 3V4UL 4N0RA 1OARH 4IBYA 3FUFA 3OMAB 1JWSB 4RLDA 3U6XS 3V9CA 1S9WA 5B1CA 1WSST 1PBYA 1XGTB 4L8CA 3OHMB 1E4KC 3QO0B 5ICYB 1T03H 5KTEH 4KFZC 2E7LC 2GJZA 3VFNB 3F65A 4OFPA 3P30L 1J9TA 1T7ZA 5JMRA 1LP9A 2YARA 4JM4H 3MYZA 3H6AA 5IBUG 4JPKH 2HX9A 2F1AA 1EH9A 4XT1C 1NC2B 2Z8WC 3CVCA 2XBDA 2Q8AH 3EOTH 4KQ0A 1WZMA 1PCSA 5AW8B 5MEPA 2QVIA 1BIIA 2DBJA 2WBKA 2CWRA 2Z0UA 2D3VA 2Z8RA 1ZAGA 2Y72A 4KJQD 1CL7L 1NCWL 3WFCL 1PGRB 3ECBA 3I84A 4KAQL 3C2SA 1UKQA 4TLSA 3KG5A 3ECUA 4JQIA 1VCAA 3IJEB 4JO1L 1T80A 1XZ0A 4KKLC 3UEZA 4S1DD 5J9PA 3BH9B 3F6LA 3WHXA 4OIFA 3CSGA 3N1GC 4OZIB 1KJ2A 2DWTA 3FTVA 1OGAE 3BWAB 3GBEA 3WEMA 5D7SL 4DO6A 4IDLA 5BJTB 1A6ZA 2A6KB 4P2RE 4X5XA 1WCBA 3LXUX 2R4SH 5CJOL 3DUSA 4WCYH 3P4LA 1M8UA 1UACH 4AIZB 4OV5B 4FDWA 4PS4H 4QRTA 3HZVA 4OIIH 5DFTA 2EXYC 1NBCA 4HQQL 2XVBA 5IFHL 3D87B 3GS0A 1YEHH 4OI9A 3LEVH 4OZGA 1N4XL 4PIBA 2DI8A 1EPFA 4M48L 3L45A 1A3QA 5IVNA 1KBWA 3A24A 5FW7A 5T3ZD 2XZCL 4H26A 4IRJD 5PCYA 3LMJL 5EZOH 3CHSA 4JE0A 1X5GA 3IPBA 1S5IL 4UAOC 4DEPC 4NZTL 4EUPH 2K6WA 1QBLH 2BW5A 3QUGA 3FULA 2XWTA 4L9LA 1CC3A 1NEZG 4GIPD 3ZMEA 4N2IA 2YC1A 4E41D 5IJKA 3MRDA 4MCNA 4ZFOB 3B2MA 4PJFF 3CSYA 3UDWC 2GAZB 3NCBB 3DVIA 4Y9FA 3N0AA 4J3OC 3SNZA 5CHNB 3V8OA 3WLWD 4AQEA 5D93B 5AEAA 3LHPH 2R2BB 3ARWA 4OUOA 2HXAA 3ETBJ 1UOVA 4YS4A 4GKOA 5D7IB 3ATEA 2YPVH 3TBWA 1LMKA 3GTNA 1NBVH 2RH0A 1SN2A 1ADQA 4WV1B 1QUNA 4JL2A 1M7XA 3MACL 3VFUB 4CNIB 5B3JF 5AQ0A 4I77L 1YDPB 1FHNA 1RUPL 5LNGA 4IU2B 1C12A 2WHVA 3D85B 3HFMH 4JFEA 1N68A 5C71A 1F90H 4Z7WF 3JWDC 2H0PA 2MCAA 3DIFB 4DP5X 3U1QA 1TCRB 3POHA 3TWCL 3GS7A 5ISZD 1VCBC 1XH1A 2FJSA 1PZSA 4MRCA 2K6YA 2CM5A 2FJUB 3IFNH 3VNZA 4LP5A 5DD1L 1QEXA 3QUXD 4GRLC 5A2JH 1AC0A 1NKGA 3QG6B 4HX1B 1A7OH 4PVBA 1AZZC 2JJTA 3GNML 3K6SA 4I89A 3TVMB 4PJAE 4CVXA 2KP5A 1PYWB 4I2XE 4LLVA 3AADB 4PRPA 2OW7A 4XOBA 1S3KH 2NR6D 4TNGA 2UWEF 1FC1A 2DQGL 3SDAB 3RY6A 1JGDB 2MQ3A 5C0BD 3KDPB 4FI6A 4JFFE 4F7KA 4ETQA 3TIDB 4N8VB 1T1YA 1KN4H 3ALPA 2TAAA 5HHXL 4D8PA 1U8LA 2E6QA 4NJAH 3OZ9H 5A7BA 2FCBA 2AEIT 3G7TA 1WBZA 4MHHG 1IKOP 1LK2A 2Y69B 1PX8A 1SDYA 1UM6H 3TPKA 1RV6X 3VI3E 4PHXA 5DFVC 2X53A 3BSZH 2GJJA 2QDWA 4TVPH 5JTWA 4OW6A 4XWOD 3R7QA 2VRQA 1BVKA 2XN9B 5FYJH 2AXGA 4D9LH 4W9KC 4PJCA 1ZT7B 3D12B 3P1VA 2VZTA 3D33A 4N2HA 2EVFA 4JZOA 1SY6A 4KI1A 1H5BC 2EAEA 3PV6A 4WO4B 4X50A 2EE3A 1FI8C 1JTTA 2KMWA 3N40F 3TF7C 3QQDB 5EDSA 1EAOA 3B7UX 1JRHI 4HIXH 4FXGB 3A4EA 2O5ZL 1UA6H 2G5UA 4Q6KA 1OD9A 5H4YA 1AE6H 1K5NA 4G9DB 4P5TC 3UJJH 2ZKMX 5I0YA 3O3DB 4M8VA 2FQGA 4GUOA 3FRPA 5SWZB 5HYQB 4A7UA 2E5EA 5GS0L 5I0ZA 4BH8B 1K72A 2VO8A 4HIIB 4OF3A 3UZVA 5F9WC 4A37A 3CJJA 1YAZA 1N19A 5KYWB 2E9BA 4O2EA 5ITBH 1MVUA 4PJGB 3RBGA 3BEVA 3KE0A 5DK2B 3UPCA 2BVYA 4BUHA 4I9WE 2DIBA 2IH3B 3WAKA 4IOIB 1ES0A 4F1ZA 1ZLWH 2YAFA 4GXUM 1BGXH 1IGMH 35C8H 1KWGA 2ZKYA 4W68A 2IANB 4Y2OB 2A73B 5K93A 4J6IA 1MF2H 4P2RA 2OCCB 1YQVL 5D4HA 5FGBC 1KXVC 2ADGB 3JUYA 4AQ1C 3ML8A 2BP0B 3SO0A 5E6ZA 4DOHB 3VXMA 2XZQH 4LZKA 3FFDB 1KTLB 4FA7B 1R3KB 1FG9C 2FYVA 5AYTA 2CR3A 4DWHA 2VW6A 5CJBA 4LSRH 5FUOH 1CGXA 5CLWA 5LWYL 1P2CB 3WJLC 3LIZA 2Q0ZX 4X5PA 2OZ4A 4NWTL 3UJIL 4AJVA 2ITDB 5DRZA 3S4SA 2AJXL 1DE4A 1M42A 2OYKA 4LCCC 4ZSOE 4WWKD 4DK6A 5EO0B 5DJXB 2EVHA 1CXIA 1RZIB 1IBBA 1CXEA 1LO3H 1W80A 1IBGL 4KRLB 3TH4T 4AKQA 2GI0A 3FQRA 4Y4FD 3L4UA 3MUHL 4N8CL 2WLZA 1ADQH 2DJSA 1T22B 2UZIH 3DX4A 5BUPA 4OZIF 1LO2L 1A4BA 4QRPB 4PEEA 3OC5A 4FNLH 3SCMD 1EEZA 2VIRB 4TUKL 5D1QD 3GSXA 3VGHA 4YSAA 1P7QA 1QBBA 2JJSA 3CCHA 2B4CC 3CZFA 3VXSE 2YPLD 4P06A 4D9RD 4DH2A 2BZDA 1P5UB 1SEBB 4JFZL 1DZ0A 2JB6A 5DUBB 1I7UA 4LNRA 5EBMA 2BNQE 4PI0A 1CU4H 4P4KA 4FCAA 3GIVA 5B39G 3RG1C 1HDMA 2C7FA 3CX2A 3HG2A 3NACH 5GJSL 3MBXL 3N50A 4OD1L 3UTTE 4GSQA 1EXUB 3X3GL 1KENL 4HJUA 4G1EB 3HPLB 3L16A 3VUAA 4PGDA 4LEBA 4U33A 1SM3H 5B38B 2CR6A 5IROD 2J88L 4MMZA 2PTUA 3RKDD 1S7QA 4XVSL 1P1ZA 3D3VE 4F57H 4B3VA 1ZLWK 3HNTL 4MA7L 4FQJL 4PJAA 5AZEH 4I2XA 2FZ3B 1KWKA 5TK2A 5T3ZL 4HSQA 1R3HA 1N5AA 3CU1A 2CRYA 5GS1C 3DX9A 2ZX8A 5C0ND 3SBRA 3QC6X 5CR1A 5EZPA 3TNMA 3GXFA 4LP8A 2W07A 4JFFA 3VVVA 4PRNA 1ANUA 1FVEA 5D5MB 1N2RA 1GJWA 5D7IF 4RGOL 1FAIL 2P45B 4JW3A 2VLKE 3QIBC 3PAZA 4F7EB 3VRJA 1MW1A 3SKOA 4QY8B 4FF9A 2HG0A 1VERA 4LCYB 1YJDH 1IAOB 1NUNB 1IZKA 1WTGT 1C5DA 1T21A 3SGDH 4DKFL 3QHFH 3RX8A 2B2XH 4Q2ZB 3J8F7 3S9DB 3RWDB 1N6UA 1YN7B 5HHMB 2VXSL 4OKDA 4NSKB 3DRQB 1QMUA 4EUPG 2ICWA 1X7QA 2X6MA 3B8SA 1K85A 5F7FA 3K91A 1H5BA 2WLMA 4IS6A 2FQFA 4N2BA 5J4MA 1IAKA 3LRMA 1VLXA 1ZT4A 3FL7A 3KPRB 1XEUA 3V0GA 3GM8A 3G5XB 3CFUA 3BT2L 3KEHA 3B2PA 5G4MA 4PRBA 4R4NC 1I8LA 2WUCL 4UAHA 1P4BL 3ARRA 3NFPB 1QFHA 2HUEA 4LHUD 5F1NB 4AEIH 5FKPB 4YHYC 3HR5B 1AYOA 1J1OH 3C60B 4H13C 4JQVA 3ATDA 2FNBA 2ADFH 4ODTL 3QIWA 4DVRL 3R8BB 4M5SA 2JDFA 1GAFH 3BO8A 4MCMA 2N4IA 2FBOJ 3CSBA 1ZK5A 1U91B 3TCTA 1HZHL 4FQLH 1ZWIB 1XGUA 3RYMA 3B6SA 5AAMA 5KVGE 3PU7A 1U3YA 4AXWB 2W92A 1T20B 3QJFA 4YR6A 2NXZB 4PJFA 2K1XA 1TU2A 2C4XA 1E9OA 3Q8AA 1RU9L 5JW5A 4ODXB 5DWUL 2YUVA 3GT6A 1LNUB 5E6IC 1E28B 1RZ7H 2UY7B 3FFCD 4AY0A 4XO5A 3N3EA 3O8XD 4QDGA 2DKUA 2F7IA 1LO4L 1JFHA 3ROLB 1KXVA 2BFGA 3ISRA 5ANHA 1U8QA 2VR8A 5HSFA 1PKQE 4OJFH 1BM7A 2VCOA 3HC0B 4GI9A 1W72A 4K5PA 1UH2A 3VMPA 2E0PA 5IV2B 1IZJA 5TE4H 4UOZA 2YXWA 4M7LL 1J8KA 3F58L 3QRBA 3LIZH 4Z7WA 3VFOB 2HT3D 4POUB 4RBPK 3VXPB 1JG9A 1CFVL 5T1DH 3P0YH 4NBXB 1ZIBA 3MLVL 2VSKB 4YHPA 4GJTB 2HFEB 4JZNB 4EI5D 1WD9A 2X1OA 1OAKH 2M8XA 3KJ6H 1EJOL 3DDFA 3L3HA 4IBUA 2V7NA 3NP4A 4M02A 3PWJA 5HGBA 3ETSA 3FZUC 1O6SB 5I1IH 3Q1EA 3NIFB 5AW6B 2P8PA 4HS3A 1W9XA 5IB2B 1KCSH 2NY2C 3G04A 3KPSE 4Q0XH 2IH8A 1IO4C 1IGIH 3D9AH 5L8JB 4NNYB 4NC2B 2UWEA 2LAAA 4IHOA 5FECA 4JFDE 4PJGF 4ZPTA 2ZCHL 4G6FD 5CINL 4A68A 4ZZKA 1Z5LB 1YYLL 3GSNL 1I8IB 2WB1A 2BCMA 2P7TA 2XPZA 3DOSB 3ETBF 4C83B 3BZ4B 1UZGA 2WQUA 3WKPA 4CVWA 4Z7AA 1OHZA 1ACZA 4FTVE 3BP5B 4UQDA 1HHHB 1AGFA 1BWWA 3BQUC 3QHZH 4AVJA 3A0OA 4TSBL 1U95B 3RTQB 4GR7A 3VXSA 1T4WA 3P9LB 1G7LA 3SBQA 4MNGB 2WCSA 3IJHA 3NJMA 5J3HC 3B2DC 5IM7A 1NBZB 5DVMA 3MRPA 3QZLA 1KC5H 4ZS7L 2CO3A 4MNQE 2WTOA 3X12A 4XB3A 4K5OA 3UAJC 2AQ2A 3CMOH 3KS0J 5EU4B 5BCAA 1BM3L 2P5WA 2BNQA 2X10A 3DBXB 4QWWC 1F0LA 5DJ6A 3PWVA 2BRRH 5E9DE 2DQFB 3GMQA 1OOWA 3GLDA 4BQ9A 4MCYB 3T3PB 2W0PA 5I8CB 3T1WA 2DF3A 3UTTA 2PO6A 2R1WB 4QHLB 1VGKB 1U3HC 3W81A 5J13C 5AOMA 5EU3A 4K3GA 3MRHB 2E8YA 4YXHH 1A1NA 4JCWA 3HI1A 3O6KH 3LRHA 1R9FA 2OMWA 3KPOB 5GS1A 4HG4K 3QUYA 4ZUVB 2DH3A 2ZAHA 3CFNA 3D3VA 1LEIB 2OX5A 4I3RH 1H19A 1R5WB 5F1OB 3ARBB 5C2BH 1Q9KB 4G5AA 3KYMB 5JUEH 1A5FL 2CUAA 4ZODA 4P57A 4UU9B 1HCYA 2FLMA 4NNPH 5B4MC 1OAUH 4NWUL 1FGVL 1GGBL 4Q6IB 3V5HB 5DI8A 3RL1B 4M6ML 3WDIA 4ELKB 3VFTA 2E27L 2VISB 2VLKA 3JTTB 4G7VL 4HBQA 4JGMA 4S1QL 4XHJC 5AW9B 2BVPA 3UYPA 1XCWA 2ZUSA 4K3JL 1XGYL 5ADPL 4JO8A 1L6ZA 5FR3A 3O3AA 3B9DA 2AAAA 2XFGB 4UM8B 5DLML 1TZGL 15C8H 4WFFE 1CJYA 2FQEA 2HJKA 3QNYA 1T2QH 4H88H 4K0OA 2QFRA 2RALA 1JWSA 3S2CA 5JORB 1LHZA 4WNQB 5DHVB 1JZEA 2XPGB 1XGTA 4LLWB 5EOCL 2X1XR 3MV01 5CKGA 4HGWA 1CF8H 5FLUA 5I75B 3EUDA 4WAFA 1BG9A 3CPUA 2VQ4A 5C07D 2NCEA 3VFNA 4XPHL 4BFRA 4R97C 2BVEA 4W9BA 3NPSC 5CSZB 4UINL 3MV9D 1F4WL 4FCHA 4UUJB 1CICD 4H1LH 3US9A 4JPVL 2WWMC 1FNGB 1O7VA 3V6ZB 2W9EL 3HC2A 3TTYA 4DFIA 1BQKA 1KB5A 2AITA 3UMNA 3EJZC 2Z7WA 4WDIB 4LAJH 2AZUA 5HGDA 4LCUB 3RVUC 1U0QA 2D7OA 5D5MF 4DFHA 2E3VA 4KRMB 1M71B 4KHXH 1BMZA 1VFBB 5E6IA 3IJEA 4HEPG 3BH9A 1HCVA 2NY0B 5DJDB 2OXGA 4OZIA 5FO8B 3AZUA 3NCMA 1D9KD 6FABL 4P2QB 4WU7B 3L9YA 5BJTA 2A6KA 1VPOL 3B56A 1I9IL 2QV2A 3OJDB 3DJZA 2VOTA 1DVYA 1KPUB 3QRFM 3GJEB 4L4TD 3RB5A 1WAPA 3MJ8B 3L6FA 3QDJE 2DEYX 2DQDH 5JZ7D 2VSCA 4OZ4B 2UXGA 4MVBC 5CD5D 5AW2B 2DLHA 5G5DB 3G5WA 2VKWA 2DOCA 1PKQA 4KJYA 3IRPX 3MZTA 4QOKB 2J5LB 5J6GB 1AMMA 3OAWA 3T0EB 2EDKA 1PPIA 4LARH 5CLXA 4PWIA 4IHBA 4F7PB 2DYSB 2COVD 2R9HD 2WLKA 4NUJA 5F7YC 3THMH 3F12B 3MJ6A 3SEPA 3LXAA 4ZW6A 1BLNB 3FB5B 2PWHA 3EDKA 3EYVB 2PCFA 1E3FA 3MLUH 5FYLD 4BH7B 1IC5H 3UYOD 3LPWA 5FS5A 2F5BL 4FQHA 2AJ3B 4MA3B 2DMGA 4KX9A 3BP4B 1FC2D 5KVDL 3ZZ1A 4W9AA 1QA9B 4TNEA 5GIRA 4M5TA 1E5AA 1ROWA 1XF5B 2GHWB 1BMGA 4M7JH 1IL1A 2XI9A 5CHNA 3IDIA 3BPNB 5HYJD 4PLOB 4UTAL 3ZTDC 3ECVA 1GGCH 4TV3A 2Y1VA 1DBAL 5HGHB 3FU7A 4JFDA 5I18H 2HCZX 1MHEB 3BQUA 2WIIB 3GMLB 2BLFA 3C6SA 2WYHA 5DA4A 3VJ6B 4IAUA 1M7IB 3HN5A 4H8VA 4WV1A 3H9SE 5KVEH 4NFCA 1RUQH 4AGNA 3T6VA 2A2QT 4JHWL 2DL2A 5IB5B 4CNIA 3FRPG 1YDPA 1HZKA 4FTVA 4IU2A 1CPUA 1W6WA 1A8JH 1T1WA 2O72A 2R69A 3DYMA 1U8NB 3M8OL 1TEGA 1IGFH 4M62H 5AWNH 4EKXA 3I3DA 3FO2B 1HH9B 2WB7A 3UBHA 3DIFA 2J20A 5DK3A 2J4WL 1NLBH 4HT1L 3UJTH 1UA7A 2QGDA 3QWOB 1GY2A 5KSVB 4IBTA 2B0SH 2I24N 1Q38A 2VXUH 3ILDA 2WINB 3L4TA 1TVHB 3RVVC 5EOQL 1S7XB 1U3HA 1CDUA 1UWEH 5A6IA 3QR1A 4FX5A 5JOFB 3BUQA 2NX5D 2FWUA 3TNNA 5E9DA 1DJWA 3FU8A 3NIFF 3TVMA 4B9CA 1NFDB 5CJXA 1PYWA 4WI8A 4Y89A 4GKZB 3D09A 2NY7L 4FFWD 2ATPB 3MDJA 2XQBH 2EDWA 3CXFA 1KEMH 1JGDA 4A6YL 5TE7L 3E2HB 1FDLH 5C7XL 2CO6A 7CGTA 3QZBA 1XL4A 1N5YH 4N8VA 4K7PH 4OJAA 4NCC1 2X2JA 4L4JA 4ZFZB 3LD8B 4DP7X 1RVFH 5BOPA 2EEDA 1CE6A 5HHOE 4UTBL 2V9QA 2M1KA 4OCWH 2ZNWA 3G5ZB 2EE2A 1YYML 5DD3L 5EO1B 2VR6A 4YZFE 4RAHA 3FNKA 4DTGH 3KLHC 5I1EL 4WUUD 4E41B 5D7KD 1QI3A 1LWHA 2BXZA 2LU4A 1EFQA 2PN5A 5SV4A 3QARA 3BJ91 1BW8A 4MJID 1CDGA 5G4NA 1WG3A 2V6HA 3LN5B 2XN9A 4E9WA 2ARJA 4AG4H 1G0XA 5A2LH 2CK0H 1ZT7A 3L1FA 4RMTA 3KPRE 1UASA 3A6BL 2WGNB 5DQJA 1P4LA 1Y0LA 2W60B 4BDVB 5ACZB 3BRGC 1JHLH 4G59C 2B5IC 3DVGB 1OSYA 3HA0A 3SO1A 3T3PF 4RIRB 4WO4A 3QQDA 5IFAL 1MHCA 4GAGH 4HAGA 4KMTH 4ZFGL 3V95A 4AX3A 2X4UB 4HMCA 2Z92A 1INEL 2V2TA 5ISZB 3MRFB 1MQKH 1KTBA 2NUTB 2QKIC 4FL4B 2X0UA 4N3TA 3ZY7A 1DDTA 1WK0A 4NO5B 3ZHFA 5SWZA 4ZW7A 4DJMA 4GKSB 2DYPD 3QUKB 3T8XB 3RIFF 4BH8A 4K94C 4U05A 3NG5A 2QELA 4LVOB 4P04A 4D0CB 1EZUA 2GJ6D 4PS8A 5LDSA 2I5YH 4M7LT 4RNRA 5KYWA 4PJGA 5JW4Q 3F2LA 5DK2A 1Q72L 1ECYA 4U0QB 4N0UE 4G6AD 2OMYB 1UB6A 4IOIA 4JZJC 5C0BB 1ZDQA 1G5AA 3O4LE 4KUCD 4ZMTA 5CN3A 5KOVC 4PRAA 1ZE3H 1KIRB 4CN6A 1G0DA 4Y2OA 2V5YA 4JY5H 2A73A 3FMGL 4GRMB 3ZQXA 4DKTA 3OM3B 1AO7B 3S35L 3GQFA 4BFFA 3S37H 2QZ5A 2BNUB 2BP0A 3HI6L 3NP3A 3WN6A 1T0MB 4YDKH 2AEOA 3FFDA 1KTLA 3BISA 2IDTA 2QBWA 3DWTA 4PB9L 3WNIA 4DGVL 5EOCJ 4KNTA 5F7EL 3VWKC 3QUML 2VSDA 4FQ1L 2R0ZH 1E4HA 1KXTA 3LKRB 1GKEA 5KS9B 4G43B 3MJ9A 4AMXA 1QFOA 2ITDA 1C08A 1V05A 4P2OD 3PL6D 4FE9A 5EO0A 5I6XB 2BIPA 1JCVA 3P3RA 3Q3GB 4N90E 5DJXA 3SGEI 1LQBC 5EU6E 3IJ7A 3IS0X 5FC9A 3ZGHA 1F5WA 2OCFD 4LSPH 3VFMB 4ZYKB 4N5ED 2HH0L 1O7SA 4L4VD 4GB9A 2TRHA 1CFBA 5FAAA 3L9RB 2YUWA 2CMRL 3UG5A 4Z3TA 3PDDA 3GSNB 5GSRA 3OX8B 2VIRA 3O9WC 5T1LB 2EDYA 4R84A 5CEXB 2AK4D 3SE8H 3TP4A 1P5UA 4EZMA 1AHMA 1SEBA 2AC0A 3HFFA 3AVEA 1U6AH 1NC4D 5F7DA 1ZEAL 2PMZA 4CU6A 1AVAA 3U2SB 4H1LG 2VL5B 5AVUB 2H6OA 1FL5B 4FG4A 1JHTB 1ND0B 2K6ZA 1P6AB 1M1SA 4IKJA 3TURA 1LLAA 5GGSY 2X4PB 3AB0B 3GMOB 5I1HL 3S36H 4P49A 3QYMA 4FNQA 3G5VA 3CFEB 1DVZA 5EF3A 2VZSA 1EXUA 2AFNA 1OKIA 3PGDB 3PHQB 3BHBB 4G1EA 3QXAB 4ZQKA 4AGQA 2MTPA 4XCYA 3VSVA 4ODUB 4HS8H 4JKKA 2X05A 2HFFA 4WGWB 1MFEH 5LXGH 5IKCB 2VR9A 3Q2VA 5T1KD 4DEPB 4JPWL 3GMPA 5IJDC 2JLPA 4WI3A 1VESA 3MCKA 1O5DT 4CN4A 2C3GA 3KPPB 4OLWH 4QXUH 5DMIH 2FZ3A 3MMEA 2VLRE 4NN6B 1HJCA 3BZDA 2BWQA 1KYOJ 4KK8D 5AB0A 4NQSA 3OKKB 1RZGA 2AK1H 3LQZB 3EYUL 2VLJD 5FYLL 4Z7NE 2C3HA 1SJVA 5B21A 2XETA 4AVHA 2VITB 1O6VA 3X1FA 3B1TA 1ZLVK 4F7EA 4WWKB 3QFJD 4QY8A 1K8IB 4U1SA 5HHOA 4LCYA 1IAOA 2Y07H 3UTPE 1SXSA 2R29A 1UXMA 2XKNB 5DJAB 5EN3A 1DTUA 2FT6A 2D7NA 2FHBA 1EFXD 4Y4FB 1OTSC 4Q2ZA 3IVKB 3B2VH 3KM2A 1GRWA 3RWDA 1YN7A 2ZOLB 4OLXL 2BSEA 4XC1H 1U2CA 3DRQA 4NSKA 5G4OA 4L48A 3WV0A 2EC8A 3DUHA 3TEUA 1PCXA 3SCMB 4AYBA 1CDBA 4TLTA 1AGDB 1XGPB 1G1OA 4JBSA 5DD0L 5D1QB 2B16A 4WFGD 2ZICA 5GJTL 4R7DB 5I1JH 3DETC 1BD2E 2YPLB 1QEWA 3CIAA 3CBJB 3FSVA 3KPRA 4LT7A 4GRLB 3SZ6A 1UB5B 4YNYA 3WO3B 3AS1A 3G5XA 2OMVB 4HZAA 3AACA 2DLTA 4EPSA 3Q2NA 1NFDF 1V55B 2AJVL 2E4TA 3UMTA 4LIQH 3BC9A 3NFPA 4GBXD 5F1NA 3FU5A 5FKPA 3HR5A 2FJHA 4ECNA 1EIBA 3C60A 5CU5A 1SPDA 3RURA 3T1FA 3GO1H 5JIIA 3WKQA 3MRBB 1N0LB 3RDTC 4KOCA 1QYGL 3NIGB 1A0QL 2OPCA 1U91A 3H7LA 4ADJA 5F9OL 4IGBD 5LN4A 4B7IA 1CO1A 1EXHA 4QTFA 3MKKA 3TWYA 1BBDH 4KI5E 1T20A 3PCYA 3T2LA 2NY5H 2JELH 2K70A 3GDCA 2J6EL 4ZXBD 4ILDA 5FYJU 3A6CL 4ETYA 2CXKA 3IRCA 4YGAB 3BFQG 1E28A 3FCBA 4XGZB 4HIJB 3C5ZC 5E99L 4N2EA 1L9MA 3N42B 1FCCA 1A3LH 4HLZG 4KI5C 4LSTH 2YOAA 3NEEA 5F0PB 4QRUA 1I82A 3VFSB 4PAZA 3O4LA 4BK5A 1YO4A 3HC0A 4QOKE 3MXWL 4FJZA 2RGSA 2AABL 5ACLA 3NGBC 4UT6H 3ISWA 5DO2C 3PWUA 3VYPA 3VXPA 3MJ9H 1A7QL 2KERA 4N68A 4CVUA 4I1PA 9PCYA 2F15A 3VW3L 4JZNA 1BFTA 3RZCC 1ZA6B 3L4ZA 5E4OA 1A6VH 4PB0L 4NQVB 5KEZA 3L95B 3NTCL 3IETB 4C58B 2OJ1A 1E7UA 4P5TB 2KYIA 5F8QC 3CE1A 2BDNH 2TRYA 4HZLB 5EO9A 3ZE0B 4BFJA 2L04A 3ULVD 1NPJA 4KY1L 1HC1A 2IAMD 3K4DA 5FGCE 1MVFA 3TEZA 4QO1B 4JG9A 5EC1A 4Z3IA 3ZTNL 4FAAB 4NNYA 3LHAA 2XU9A 1S3RA 1P5VA 1D5IH 4LHUB 4R2GC 5DC0A 4LCIH 4U6VH 2SEBA 3O9WA 3FPXA 4UILH 4YDVB 1Z5LA 5EU6A 4CW1A 5C3IA 3EGDB 4K9EC 2ENYA 3H2QA 3R1GH 3V6FB 4KDTC 1IKNC 1KGIA 3DOSA 4C83A 4AL8C 4Y4KD 4AT6B 3SOBH 5JNYA 2VM4A 5CZVL 5EDXA 1JZ8A 3KWWB 3KPQB 4PJ7E 1MI5D 4YIQB 3WHE0 2F8OA 3BP5A 4DP9X 1HHHA 4L1SA 3NA9H 4C57C 3RTQA 5FB8B 3P9LA 4KGJA 1FHGA 5FCSH 4MNGA 4PGCB 3WFHA 4KXAA 1NBZA 2ZPKH 4KZDH 3BVVA 4PG9B 2FECI 1HYSC 4JDTH 2D9CA 2Y06L 5DJZA 4OCSH 1J9RA 3FFCB 4K5LA 3DBXA 1Z32X 5I5JA 3BUIA 3O8XB 5T5NF 3BKYL 5JQIB 4LVNC 5KS9F 3ZDZE 4HOMA 4L8DA 4JREB 4HJJH 2OZNA 1G9NL 3QXWA 1DJYA 2RQ8A 1MWAA 3ULSA 3OXSA 3QCUH 3EJUA 1WAEA 1WISA 3KPOA 4JO2L 3KL5A 4Y2DC 5BQ7B 1CD9B 1E3ZA 1K6QH 4WVRA 1JGVH 4FG6D 4F2ME 4EI5B 4GT0A 4B0MM 1LEIA 4A6YB 5C92A 1R5WA 2PYEE 1E0OB 1Q9KA 1YSOA 3QZOA 3KYMA 3M1OA 3KR3H 5JLZB 4BSWA 4UU9A 3LVTA 4HBCH 2HLEB 4X5WB 1TFHA 3OD3A 1I8UA 1R0AL 3UTZB 3TEYA 3KW7A 2BVTA 2YEQA 4IRJC 4R3SB 2WD0A 5AW3B 4AM0Q 1H3XA 3V5HA 2IXQA 4LCWB 1SHSA 5ANME 5TQ2H 3M6DA 2VISA 3I2CL 3HUJE 3JTTA 4AQAA 1USZA 3CH8A 1DSWA 4Z7OB 4G6FB 4KZEL 3V4UH 2Y9RT 1ZD6A 3MV8E 4PRHE 5CJQH 3HVNA 5IUCA 5JXEA 4UM8A 4PJDB 2IDCA 4R0LB 2FO4A 5D71L 3UTQA 3ZL4L 4LAQL 3KH3A 2ZOUA 1U8IB 3ZYZA 2WXHA 3SNYA 4WNQA 2PKDA 3QQ9D 5DHVA 3BCFA 3SDXA 1JE6A 5E2TH 1JV5B 1JGEA 1OAZL 3P30H 1JAEA 5FFOA 3WO4B 2GJRA 1JN6B 3LKPA 4GQRA 4O51B 2ZE0A 1MRDL 3GRBA 4S2SB 3RDTA 3C12A 4E9TA 2PWGA 2R83A 5E4EC 4NGHL 5CSZA 4RGND 1O7DC 3Q01A 4UUJA 1LDPL 2AF2A 4J4PD 4XODA 3TEXA 3V6ZA 5A40E 2PXYC 3ZHNA 3D39E 1MDTA 4WDIA 1NCWH 1SMDA 3JYBA 3WFCH 3ENUA 4KAQH 3GF8A 3M7FB 4LCUA 3ABMB 3QUXC 1KNOB 2V2UA 2BOLA 2VUKA 4JO1H 4BZ1L 4EKJA 5BS0E 4Y0GA 3ISYA 3R19A 4JY4A 3QIBB 4Y1AD 2F74A 2WJ7A 3NJFA 5FDWA 1BQRA 2CAKA 3HTLX 5FFGA 5D7SH 2C9SA 2BY3A 5DJDA 5I1KL 3QQ4B 2KLSA 3RFZB 5CJOH 3BD3A 3O3BB 3SE3C 5FO8A 3WTVA 1GTFA 1QPXA 2EKSB 4P2QA 1PZ5A 4JKMA 4WU7A 4UIKL 2ZXDA 4NPYA 2HFTA 4AZ8B 2XVKA 4N8VG 2XJLA 5CMAB 5BOJA 3U1PA 4HQQH 1E9QB 2Q20A 5IFHH 3MJ8A 4L3CA 2VXQL 1X44A 5BZWB 2Y25A 4AEHL 3FUDA 4M48H 5JQ6L 2ZT9C 2Y5EA 5CGYD 4QOKA 4PBXA 5J6GA 3T0EA 5F88B 2XZCH 3LMJH 1WUZA 5GGRY 5PAZA 1OP9A 3QUMB 4HS6A 4L0YA 4DGIH 1S5IH 3FTGB 1FG2B 3OB8A 4C56D 1BLNA 2JH2A 2D2OA 3FB5A 3NIGF 4NZTH 5D1XB 1TQTA 3UTOA 2FLRT 4BH7A 1QRNE 1GCYA 1CQKA 2V17L 3M1BA 1R34A 1MKFA 1A7NL 1TPXB 1TZOA 3GRWA 1JYNA 2I07B 2FH8A 3BP4A 3TPUB 4WW1B 1A3RH 1T7VA 3GKZA 1QA9A 5C07B 3VE0A 1XF5A 2E7MA 3WFDL 4ANVA 1WAAE 1IKNA 2EYSB 3EFOB 4YSEA 4BWWA 2R1YB 1PFCA 3K71A 3T2QA 2PW1B 3MV9B 4JFPB 2XICA 1CICB 5FO2A 5HGHA 1MFVA 1RZKL 1Y07A 4DP0X 1X4ZA 4XI5C 3W5NA 2WIIA 5DDHB 1SJMA 3N42F 1HDFA 3BPLC 3DMMD 3MACH 3SQRA 1DANT 4JLRB 5KJ4A 3VJ6A 5C0CD 5I0DA 4WI2A 1RUPH 1M7IA 2NSQA 3FYEB 5HD8C 2BSTB 4CN1A 2J43A 3T5WA 4BFKA 2DQTL 4PJ7A 4ZTPL 2CIKB 5D6DC 2ZG2A 3TWCH 1FV1B 4YK4B 3ARDC 1JPSH 5I1LB 4BYHA 4QEGA 2B39A 3FO2A 1ONQB 1R24B 3CZSA 1DL7L 4OKVB 5DD1H 2EH7L 4ZAKD 3E80A 5KSVA 5C9KA 2G4GA 1IGTA 3HMXL 2WINA 4AENB 1TVHA 2EIEA 1D9KB 1MUJB 3IYLW 5AKVA 1S7XA 3EF4A 1KLFB 2FUQA 4EI6B 4U1IB 2DQCL 4PREB 4Z76B 3DROB 5A3IC 4L4TB 3ZE0F 1H6EA 3O2WL 3SQBA 3VWJC 1U58B 4JJ5A 3ESVF 5BVJB 4FD9A 1NFDA 3G5YB 2X2YA 2DQGH 4ZBJA 1KPVA 4N3UA 1ZTXE 1BPLB 3N1PC 2KLRA 2PABA 1L6XA 4WRLA 1V3MA 1OB1A 3REVA 1WCQA 1UM5L 2MKLC 2H6UA 5HHXH 5M7QA 3QQNA 2X12A 5JHLL 1CGYA 1S8DB 2GHZA 4P46B 1JF6A 4IRJA 4ZFZA 3VB8A 2W94A 3ULVL 3NCYS 1HNFA 2EO1A 3LSOB 4W93A 3Q5OA 2PWDA 2XIBA 3G5ZA 3GSVB 4AYEC 1DUYB 5IB4A 1IGYA 4DW2L 4KXZI 4AYSA 3ILEA 2ZYHA 1GGUA 1QVOB 2YAOA 1RKRA 4HK0B 2H0JA 2QGCA 1PF3A 3VGDA 4YBHA 5TQ0L 3ZTJH 4LSVL 1A7RL 1A6AB 3TONA 5GZOC 5EEVA 5HYJB 3LN5A 2CJTA 4BFNA 5HYIA 5CS7A 3B7YA 4HC1L 4IRSC 1V7NL 2E46A 2VJ8A 2W60A 4ZMVA 2Y4SA 4L37B 1IM3A 4RZCA 4JKNA 5FA3A 3ZMNA 3ZYOA 2AVFA 1KJ3H 2H1PL 5EG6C 1VFOA 3TA3D 3NZUA 5HVGB 2O5ZH 3T77B 3Q06A 4FFZH 4L3EE 3G6DL 4D7PA 5I6OA 1QHOA 1FO0L 1CT8B 3BUTA 3HG4A 4ELDA 2A9CA 5FF6B 2PTTB 1KY6A 4NQQA 1MCSA 2H9GB 4XMUA 4GG6E 2JTYA 1FLRL 1EZVX 3SSGA 5GS0H 1RAMA 1L0QA 5DRXA 3QUXA 2V3EA 1BF5A 3VGEA 4Y1TA 1HXKA 3IRZA 2KUTA 3OAYK 2NX5B 3QUKA 2NQ3A 3FU6A 1RSYA 4FG0A 3D39A 4YBQC 4D0CA 3W9EB 1P69B 3TBYA 2ADJB 5FOJA 3PDGA 4G8AC 1NGWA 2D31A 2I7SA 2R2HB 3M17B 5B38G 4NPJA 5CP7A 1HHIB 2NR6A 4GH7B 4YSDA 3EAKA 2D4FA 1A47A 2OMYA 5IESL 3F7VB 4Z7OF 1M3JA 2NY1C 1E4XH 3LH2L 2BIHA 4A7VA 1RHFA 2HT2D 3C09B 2I9LB 2BSSB 4FC3E 4PJDF 2P9RA 3S6CA 2IJ0C 1CE1L 1FCGA 3LS4L 5ICZB 4GRMA 2FNWA 4PN6A 1EO7A 1BOGB 4YSQA 2Q2LA 1VEOA 3KS0H 2ZWNA 5MERB 4XBPB 3RIFK 2WC7A 1T0MA 1YEJH 5GGSB 5LWYH 4WUUB 5I76B 5AW4B 1MJ8L 4ZUTA 4GIAA 2JCWA 4NWTH 2NSXA 1DQKA 3UJIH 4UIMA 3HE7C 2O6PA 1ITCA 4NERA 5JOPD 3DI3B 4JM2C 3WL9A 4J8RB 1IE4A 4KKQA 1N8ZB 1OIOA 4KROD 3U0TA 2I85A 5E6YA 3WMSA 1D5ZB 3JQOB 1IBGH 1U8KA 3IDJB 3Q3GA 3RU8H 2MTAA 3VU1A 4N8CH 3SDCC 1XMWA 1XCQA 3DX6A 1QI5A 2WVUA 3VFMA 1U8PB 3KGUA 4FKHA 5GGQH 4ZYKA 5BZDA 3BP6B 1LO2H 4AI7A 3MR9B 1AHWB 5I8EA 2Y6SC 3L9RA 2N7BA 4Q9RH 1KB9J 4PGBB 2Z4QB 1WAAA 5IHLB 4JDZA 3HVDA 3KPTA 3GSNA 3OX8A 3EXLA 4FULA 3OJVC 3SQOL 4NI6A 1V3LA 1DYZA 5CEXA 2OP4L 2XBTA 2Y3NA 1HXYB 1BXXA 3IDXL 2DYPB 2CDFB 2JCCB 4D9QE 4PV8A 5E03A 1MG3C 3WY4A 2GJ6B 2H3NA 3U2SA 3DX3A 3G6JB 2AGJL 1FL5A 3NCXA 1JHTA 1ND0A 5C3LD 5GJSH 3MBXH 4FG2A 4NUMA 4ODHL 3QEGL 3X3GH 1L3WA 1WPCA 1DJIA 1KENH 3GMOA 4X7FC 3IDYB 1M9WA 3ZGIA 3VWJA 12E8L 1R19A 2F54D 2YXFA 3PGDA 2J88H 3BHBA 3PHQA 2IG2L 1OGPA 1WDAA 4ODUA 4XVSH 3H4FA 3HNTH 4MA7H 3VDCA 5IKCA 1U21A 4YPJA 1NFIB 1IFGA 5SX5H 1JSYA 5IQMA 2OMZA 1SBBA 4JEGB 3IU4L 4P3WA 5T3ZH 5HVFB 1HL5A 2FIRT 5F3BB 3INUL 4AUJA 5AOLA 3H42L 3KPPA 3UH8A 3ALWA 2ZUWA 2ZUXA 5DMGC 3NFSH 3V6OA 5KN5A 2CIIB 3S5ZA 2OMTB 1CXHA 4B3EA 2J1KA 4RGOH 1FAIH 5EBWB 2J57A 4X5RA 4AGMA 2VITA 1KCWA 4WI7A 3HN3A 4P2OB 2OMBA 5F7HA 1DBJL 3PL6B 4U6HB 1M3IA 1Q94A 1J18A 3EDEA 1K8IA 3GINA 3QK3A 3NSJA 4DKFH 1XSOA 3IAPA 2IFGA 1BAGA 4XN5A 2A9NL 2VXSH 2XT1B 2XKNA 5DJAA 4JQXA 3IVKA 3GXUB 4Y4FA 1XWVA 4L4VB 5EBLB 2O93L 3F3HA 4ANWA 1I1YB 2ZOLA 1NGXB 5FDYA 1CIUA 3WEXB 3H9HB 4N2OA 3ZUCA 3ZHKA 3L7EA 5D1QA 5ICXB 1PG7X 4ZS6D 3BT2H 4AE1A 3GBNL 4IK7A 1P4BH 5DC2A 3TFKC 5GGVY 1NC4B 5DVOA 4QRSA 1XB8A 5KJRL 2KQNA 4ODTH 4EF3A 1BQHB 4JPIB 5IK3B 5E8PB 4DVRH 4BCZA 4M1DL 3FT2A 1U3JA 3PJSA 4EVNB 3TJPA 1NCGA 4Q8BA 3MRBA 1BFVL 4UQEA 2XIDA 4RFNC 5KJ7E 1JZ4A 4AOFA 2YD9A 2A4EA 4QD2E 3HKZA 1G4RA 3ZXAC 3JT0A 3GMMB 3S34H 1Z5HA 2I60L 4GG6A 4KJWD 4XVJH 1U8HB 3NBNA 5B3SB 4X0NA 4NO2B 5IROA 3VTMA 4IIQB 4KVNL 1RU9H 3TO4C 5T1KB 3H1ZA 5DWUH 5L2JA 3K4AA 3UACA 5EC2A 5C6PB 2B3RA 4Y9GA 3MJ7B 4ZFFB 3Q6GH 1Q1JL 3PJNA 4XCFL 1TQUA 4XGZA 4I0PD 1SDDB 2J7LA 4MSWA 2BC4B 3WENA 2DS4A 3ULUE 5I74C 2VLJB 3VXUB 1CGSL 5D7HA 3ZTEA 1KLGB 5SX5K 4M7LH 2F7PA 1KBPA 2X70B 3QFJB 2DJMA 1CFVH 2GKIA 4PSRA 5ETUA 4M3JA 3H56A 1U8OB 2Q7AA 2K9FB 1W0WB 3ULUC 2CALA 1Z9SB 4WSGA 5FYKE 3H53A 2O30A 1EJOH 3SYAA 2EDNA 1EFXB 5DRWB 3ZLQC 1T5XB 3CDFA 4KKPA 5CEZE 1TQBC 1CK0L 4B50A 3ARUA 4UQ3A 5FM5O 2YQGA 4RISL 4LCVA 4NQVA 5CBAA 1J12A 1BP3B 1EAPB 1CBVL 4E42B 2AANA 2G0KA 4DCQA 4HZLA 1BFOB 3SDCA 4U31A 2BHZA 4OCMC 1OB0A 1T0NB 2CHNA 4M3HA 5IB1B 4EJ1C 2CUIA 2OI9B 2IPTL 3ZTJG 1CR9L 4XX1E 2GEEA 4HHAB 4QO1A 2ZCHH 1XEDA 5CFAA 4XB7A 3GSNH 2JF1A 1S9KC 2V5SA 2WXIA 4LHUA 5C0JB 4EDXB 3QXDB 1KCKA 2F5AL 3HG0A 4YDVA 3KLAB 4G8IA 3LIUA 4HGMA 4DGYH 4JM0A 3A5VA 4OI8A 4UTAA 3ASWA 3BZEB 2WBXA 2D2CC 3KWWA 4FQIL 4TSBH 4OV6F 4YIQA 4IGBB 3UBGA 3WG7B 1KJMB 4XAWH 2I27N 5HGAB 3MRIB 2G9HA 4A2MA 4PGCA 1QZ1A 3T2NL 4ZS7H 4M56A 4QHNB 4JDVB 4ZXBB 3U0PA 4PG9A 1N9PA 1PX3A 4P3DA 3TASA 2N7AA 3O81A 2KFBA 3JYCA 3FFCA 1JWUB 3V4PL 1IM9A 1UURA 4X6FB 4URKA 2K45A 4L4TE 2ESVE 1UOWA 4K55A 2LOEA 1BJ1J 3HZYB 2ZYIA 5DJCA 4LK4A 4U1HB 4ZDHB 4WK0B 1EJFA 4OGYL 3BJLA 2ORBL 5IJBC 3WTYA 4NT6A 5BQ7A 4OFDA 1WD8A 4LVHB 4GAJL 1A5FH 3QEQE 1FUNA 2FATL 3L4CA 5FYLE 2VDOL 4A6YA 1U3ZA 4LGPB 2VDKL 4WHCA 1MIML 1OK0A 4NWUH 5FO7A 1U9KA 4Y4HC 3T71A 5JLZA 1FGVH 1GGBH 2J3SA 2R9HC 3P3UA 3BVUA 2VABB 1YEGH 3FUNA 4LE8A 4M6MH 4NRXB 4PVNA 4TVSa 3UTZA 2E27H 4G7VH 4GXFA 5I28A 5J06A 2IAMB 1Y6MR 4S1QH 1Z6JT 2WXNA 1QSFD 2JCCF 4K3JH 1XGYH 4ZTOL 5ADPH 1F6LL 3TCLA 3AM8C 3C6LC 4PLKD 3G6JF 4HCRA 1TZGH 5DLMH 3WN5B 3ROOB 3QDGE 1KB3A 4GQ9L 4HHGA 32C2B 2BV2A 1M05A 3OGCB 4PR5B 4U1LB 4PJDA 1S7SA 1T0PB 4UNIA 4R0LA 4Y4KB 1KXQA 1GGTA 4KUCF 4JHBA 5I19L 4CDGC 2OSXA 2GVYA 3DX8A 1P7KB 5EOCH 1U8IA 4YGVB 1MI5B 4MJ2A 3I6LE 4IBLT 1IAIM 1AQMA 4B9JA 2VSMB 4O2FB 4M93B 4XPHH 1JV5A 1LJMA 5DJYB 4NZUL 1MVYA 1HWWA 1MCWM 5GGRB 4MAUL 3VXQB 1JN6A 4UINH 3LVEA 2ZXCA 3HBZA 1F4WH 1WBXA 4JPVH 3ETTA 3VQMA 3AABA 2ERJB 3B5GA 1JZGA 2LVCA 3AW5A 3ES6B 25C8L 2W9EH 1FO0B 2YLKA 2XX0A 5GRVL 1KIPB 4FABL 2NNFA 4M43L 4F93B 5E56A 2OTPA 1K4DA 4JFVA 1JPTL 5JW4R 4PV9A 2V7HB 3GSOB 4PLJD 2DTSA 1UUSA 3TJHC 4BQCA 2JJWA 5JHDD 1I1AC 5DQ9B 2IGFL 2DJ4A 1J8HB 2NTFA 4NQEB 2IOIA 2MNUA 1XD1A 2J1WA 3EH4B 4E9RA 3BCDA 4JHUA 3AXIA 4MZIA 3FBKA 5GS2D 3IMVA 3VXRE 6FABH 3P9WB 1UZ6F 3QQ4A 3IDGB 3RFZA 1I9IH 3PAVA 3Q13A 4HKJB 5LGJA 4EZLA 3NPZB 4N0YL 1A14L 2LLNA 5TE6L 1YY9C 3WELA 4PVMA 1XMEB 1QZNA 2Q5BA 2BVOA 3LN4B 3STLB 5FO9B 1E9QA 2DMCA 2SODB 4PUBH 3QYNA 1I7RB 3BE1L 3E1F1 4OCYL 4MJIE 1Q0XL 3D4ZA 2VB5A 5HPOA 1NGZB 5I17A 1S4IA 2W65B 2H2SD 4JG0L 3QUMA 5DJ0B 5MI0B 1LGVA 1X9RA 1ZA3A 3FTGA 3MOAL 1G7IB 4LP4A 4I0CC 2VJXA 1QSZA 2F5BH 2VRKA 5H35B 3UOAB 1XAUA 2VW4A 1HTYA 2WV3A 4RVBA 5KVDH 1MRFH 4YBLB 1MJJA 4J5VA 1E8YA 4NQDD 2I07A 5IVXB 2IH1B 3TPUA 3BPOB 3HJ0A 4WW1A 1NL0L 1M6UA 2CLZB 4K3EL 3BWUF 2EZ0C 4XNXL 1DBAH 3EFOA 2R1YA 3JTSB 2B08A 3S5LG 3U82B 5HDOA 3VI4E 4YHNB 4RGNB 1ACXA 2PW1A 3BDBA 3MV9A 2ADIA 2R0KL 4IJ3C 1CICA 1MH5A 3AT8A 1F1AA 3ZRSA 4JHAL 1N67A 4ALAC 1LILA 2NYYC 4HFWB 5DDHA 1ZGTA 4FA8A 5I2IA 4KNQA 4JKWA 4BHUI 1P6WA 3CFJA 4JHWH 4JLRA 4Y2NA 1CGUA 3FCGA 5TF1H 1H0DB 2BSTA 3M8OH 1FVCA 3X1BA 1HKLL 3IFLL 1XH2A 3RVXC 3UCRA 2CIKA 1AS7A 1FV1A 3FO0L 5JHBA 4Y1AB 5I1LA 3L4VA 4KHTL 1ONQA 5IW6B 1R24A 1YEIL 4UQCA 3QPQC 4XAKD 4R90L 5EOQH 3MKGA 2EDDA 4Q74A 1J05B 4KRPD 3KGRA 4M29A 3WS6C 4AENA 4YN3A 1MUJA 3WNJA 4TVPD 4F33A 2J8HA 1KLFA 3LCYA 3UO1H 3SDDD 2XYBA 3I02B 1I1CA 4Z76A 4DK3A 5C0EB 1DSFL 3DROA 1W0YT 2BK8A 4IW4C 2BW4A 4L4TA 1U58A 2NY7H 4PJIF 5DEGA 3RPIB 2DIAA 4X8JB 3ME0B 1ZDSA 2A83A 4DP2X 5TE7H 4EEEA 5C7XH 4R7VA 3SYCA 4AITA 4JGFA 3LAFA 4OIAA 4RMRA 4Y4HA 4L1TA 1JRHH 3D06A 1S8DA 3B9KD 2B4CH 4C56B 2JWYA 4UTBH 3MOBL 5IZ7A 1T89C 1YYMH 4ISVB 3QEQA 1JIBA 5T5NG 2XV2A 3WXVL 4G70B 3LSOA 3V9EA 3QIUD 3GSVA 5I1EH 1AOZA 2Q10A 3C6LA 5CAYB 4UQAA 1DUYA 1MG2C 4X98A 2MKWA 1IVLA 3MOQA 2MIZA 3GBML 4L4VE 4TQIA 1F4AA 1QVOA 4OLUL 3NJVA 4HK0A 3F7PC 4RZKA 1RIHL 2AI0L 1Z0NA 5L0QB 1A6AA 4WEUD 3L8QA 5C70A 5HYJA 5E5UB 1NIFA 4MXQD 5A6LA 4XN9A 2AK4E 1PLAA 4N0FA 2ZUQB 2EDRA 1EEYB 3CHXA 4GS7B 1TETL 5DZJA