1YHPA

Solution structure of ca2+-free ddcad-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
212
structure length
212
Chain Sequence
SVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Calcium-dependent cell adhesion molecule-1
publication title Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 33
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08964 Crystall_3 Beta/Gamma crystallin
A PF14564 Membrane_bind Membrane binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.20.10 Mainly Beta Sandwich Gamma-B Crystallin; domain 1 Crystallins 1yhpA01
2.60.40.1720 Mainly Beta Sandwich Immunoglobulin-like Calcium-dependent cell adhesion molecule-1 1yhpA02
4IAUA 4GR7A 3ENTA 2B1OA 3SO0A 1BLBA 3SNYA 3IAJA 3LWKA 1A45A 2NBRA 4PSRA 1ZIEA 3I9HA 2M3TA 2JDGA 1E7NA 5HT8A 1HA4A 2M3CA 4GCRA 1ZIQA 2A5MA 2BV2A 2DADA 2JDFA 1I5IA 1YTQA 1NPSA 3ENUA 4NI3A 3HZ2A 1GAMA 1ZIRA 4AKAA 5HT9A 1ZWOA 2K1WA 1ZGTA 1AMMA 4W9BA 1HK0X 1A5DA 2G98A 1YHPA 3HZBA 1GCSA 1A7HA 1BD7A 1H4AX 2BB2A 2KP5A 4PSPA 3SO1A 2KFBA 1OKIA 2K1XA 2M3UA 4JGFA 1ELPA 3QK3A 3SNZA 1M8UA 3CW3A 4EL6A 1ZWMA 4FD9A 1AG4A 4W9AA 1PRRA 1PRSA 2V2UA 1HDFA 1DSLA
chains in the Genus database with same CATH superfamily
4PTTB 3AREA 1DQIA 2VMFA 1WWBX 4J2QA 3VFPB 5I8OH 4EKJA 1QI4A 1ONQB 2BERA 4R90L 3NP4A 1TZGL 2WJ5A 3K2IA 3T0AA 2B1AH 3BP4A 1HI6B 1Y6NR 4KGJA 4KXBA 2MCG1 2EJ1A 5EU6B 5TF1L 1GGTA 3KXFA 1MAML 3OKEA 4F7CA 4YAQA 1JRHH 3C6EA 2KDGA 3QUXC 1P4BL 2JLLA 4U1HA 1KCVH 1TVHA 8CGTA 2WLJA 4Q74A 2NZ9D 3WGVB 3PREA 2ISDA 2FD6L 2L7EA 2VDMH 2IPTH 3V0IA 3QUYD 2VW7A 3AREB 3DYMA 4XWOC 3ZMEA 3UPAA 1JZFA 1UWYA 1URZA 1R34A 3ULVF 2N7AA 5FM4A 1BQLH 1LD9A 4WI4A 5D96C 3BN9D 3PWPE 1DQDH 3SY6A 3QHFL 3ECQA 3VRLE 4CN1A 3KXFB 4WWPA 4YAQB 4W68A 5I8EA 3CMOL 3V0VA 4CADB 4D9LL 4F7CB 1KGCD 2ZT9C 1BA9A 4U1HB 3BP5A 3HZMB 1TVHB 2FT8A 3QHZL 1QBAA 3MHZA 5J11C 4NQQA 2KKQA 1XL6A 2WVTA 3J2PA 3QFJE 5EUOA 4FDWA 4U0QB 4FZEL 1ES0A 4XHJD 2OL3A 1FGNL 5JW4R 2YK1H 1IE5A 2B1HL 1V7NH 3B37A 4XZUA 1M3IA 3IGKA 3Q5YA 5I8EB 3QO0B 1DFBL 3V0VB 3U6XS 5IGXH 4ENEC 3BP5B 4P9MH 5B1AB 2EH8L 1OOWA 3S4SG 1XGYH 3F58H 1BVLA 1MI5A 3BSGA 4L37A 2GEEA 3DVNB 4XNZC 4OGYH 5CN2A 4GI9A 5GISL 2OL3B 3VD1A 5GRYA 2VDPB 1JPST 3SE4A 4U1SB 1R75A 3TCLB 2V3FA 1UA3A 1C5CH 1WGVA 3BPOB 2PR4L 1XQ4A 1J11A 5DMIL 4ZPVA 1OAQH 2K1XA 2NY2B 3TNMA 2EQDA 1AQMA 1VADA 1DVQA 4Q14A 5E9DE 5HYJE 4R5TA 2GTZA 4UTBH 3I9IA 4ZS7L 1BVLB 1MI5B 3KYKL 3ZL1A 3GHEL 4L37B 5FFLA 1UG9A 5E2UH 5K9QG 3B8YA 1BLBA 4WNQA 1FIGH 2BP8A 1HHIA 1NEPA 5EZIL 1LMIA 4H2CA 5DQDH 2R51A 5TE6H 3DO7A 5F1OB 2E9IA 1F0LA 2FEDC 3EJJX 4ZPVB 1E9PA 5TTRA 4ONOA 4OM0H 4WGKA 4WEUD 1QHQA 4XGZB 3CZGA 3CFJA 4RRPM 3V9EA 2A9MH 2ZKWA 1SJXA 4XP5L 1VAHA 5LXGH 32C2A 4YHZH 4F8PA 4WNQB 2BP8B 4JRYD 2IOIA 5BV7H 5C1MB 4G8EA 1E9PB 1I1AC 5KW9L 2DIAA 2DH3A 3IJHA 3LKOB 1MNUL 3QO1A 4XBMA 3WS3A 5DMJB 2H9GA 3CFJB 1GY1A 3NIDF 4WENB 1HL5A 4MXQD 2HTKD 2X5PA 5FR3A 2I27N 3QZPA 5EIQA 4OSUL 1PG7H 1FVDA 2WZ6A 3KPRB 4J3BA 5BZXA 3LDBC 1A7RH 3HE6D 4DFIA 4CVUA 2R0WL 2ZWSA 3NZHH 1EHKB 2BNRA 4G8EB 1WITA 3ARFC 1BJ8A 3IJHB 1MREL 1QP1A 3QO1B 5DJ0A 3WS3B 2E7BA 3AXIA 2H9GB 3N06B 5F8RC 1IFRA 5D1QC 1IBYA 2GB2A 1T7VA 4P2QA 3NOIA 5IJBC 2N0MA 4L4VE 1FVDB 4RFOH 2R7EB 3FF8A 2Y7MA 1OCRB 4JO1H 4HIEA 1WS7A 2BNRB 5KBKA 5LGHL 4ZSOE 1OAYH 4YLBA 1NFDF 1Q4NX 5C08D 4UZSA 3V52H 3Q9PA 2BX5A 3WHE1 2GIXA 4P2QB 5DEFA 3HTLX 2EO7A 4E9LA 4MKMA 3UTSA 2ZYHA 1CDHA 5L2JB 3CFQA 4H5SA 3CSTA 1RZIA 2RTTA 2CGZA 2AK1L 3VFGH 1V55B 4YDJA 2ORBL 3O2DH 3DRQA 1XR8A 1FNLA 1TTBA 4WTQA 4B7IA 1E8YA 3ZYOA 3MACH 4KDTA 3W9EA 1JYNA 4EQ2A 3KBPA 5DEFB 2EYSA 3RTLA 1Z66A 4TULH 4KHXH 2CHZA 4H5SB 1RZIB 5L4FA 2NX5D 3NPZB 3F04A 2YXVA 3VFSB 4NZRL 5BS0B 4XCCL 2YRPA 2X4OA 5DDHA 3DRQB 1XR8B 1FQ9C 1VEOA 2P28B 2G75A 2QBWA 2RACA 4KU1A 4LOUD 5CIPA 5AZEL 2HPTA 2J25A 2ZICA 3FQUB 1ZIEA 3QNFA 3W9EB 4AEFA 1U58A 3D52A 4HALA 3PY9A 3U0PA 2HZHA 2PPEA 1AAJA 2EYSB 4I4WA 3WKYA 5EO0A 3ZTJH 5F21B 1C7TA 5T3XH 4G6ML 2G3NA 4JM2B 4KMTH 3MOBH 1U8MA 4IKLA 4M1CC 1SEQL 2IGFL 3FZUD 4JO5A 2X4OB 5DDHB 4RMTA 1TUPA 2G75B 3TJHC 2GTQA 5EIIG 5F44A 2F7IA 4ZTOH 5JIQA 3NSDA 4IRSA 1U58B 3U0PB 2FIRT 3NZ8A 4PJAE 1SN2A 3BZ5A 2RCSH 1BM3L 4I4WB 5EO0B 1JBJA 3NZSA 3X14A 3LH9A 4N9OB 1A7BA 4XVTH 1XF3A 1JCKA 5FGSA 1EGJH 2WKLA 5ECGA 3UTZA 2IAMA 3SGDI 3COOA 3VDBA 5HJGA 2ICES 4IHBA 4NQEA 3QDMA 4XNXH 4X4MA 4IRSB 4JK0D 4LCIL 4Y16A 5IVXF 5DGRA 2F5AL 3C2SA 1PS3A 3WS6A 3MQIA 3E8VA 3NA4A 3JYBA 3A4FA 1ZLSH 1XF3B 1XGRA 2BHYA 1MH5B 1N68A 2FBJL 5FYKD 3UTZB 3T0ED 4JREB 4R0LC 1X5ZA 2FIKB 4NQEB 3QDMB 1VFBA 4ZMWA 5DLMH 4Y89A 2NY0D 3AQZA 4C4UA 3HOGA 3KJ6H 4Y16B 3D85D 5GS2H 1QFWM 1E4KA 5KYXA 3LRGA 2Y5TB 2GSMB 4BRVA 1RZFH 3BGMA 3TGXA 2HYMA 3RP1A 1XGRB 3G6JF 1KWGA 4FEIA 4F7EA 4LCUA 3UZEC 5I15H 2QVIA 1KGIA 1NAML 4DKDC 5CAYB 3QDJA 5FYLL 3FOLB 3UEZA 2QSVA 1UASA 1YN6B 5IBUB 1CS6A 4OJCA 2XZQH 3BGMB 1O5PA 3DV6B 5D71H 4IU2A 2OW6A 1HJBC 2OP4H 4OR1A 5IQLA 4QRQA 4F7EB 4JS7A 4LCUB 5C0RH 3ZDZE 4GW1A 2OMNA 3TN0B 4YSAA 3QDJB 1JPGA 4UOQA 2Q87A 5EUOF 5FV1L 4N90E 4FADA 4K9EC 4PIRF 3NJVA 1MCSA 4XMPH 2DI8A 5D1QE 2LR4A 4JZOA 1UT1A 2WCGA 1PY0A 3F05A 1N26A 4IU2B 1BVOA 1IAII 1DDHA 4QRQB 4L3CB 3KLHD 1NCCH 4MJHA 3QQ4A 2WLHA 3GXPA 4GW1B 1XGUA 3FB5B 5GS1C 2YPVH 1JPGB 5JYMA 5HVHB 2GFBA 3U4EB 4Y2DC 3KPOA 4E9RA 3EZJB 1W16A 3LVTA 5LUMA 3S3BB 4ILDA 4GJTB 5T3ZL 4X80L 2FVNA 4JZOB 4ZAKC 2X4RA 4FFTA 3T1FA 4X5RA 4A67A 4Z3FA 2Y7NA 1JGLL 1IGFL 2JNZA 3U7WH 3GTVA 2NR6A 4I9XA 5JPNC 3QQ4B 1XGUB 4U6VH 1E6JL 2RFXA 1VJSA 1OZUA 4NUGL 5BUAA 2GFBB 2PYEA 4HBQA 5EOCJ 2XVKA 4POZC 3ZR6A 4GP8B 1OAJA 2X4RB 1A22B 3KW8A 2MCPH 4GIPD 1B0GA 5C8JA 2FZ3A 1DLFH 2QSCH 4X6CA 2RFXB 1HX0A 2ATPA 3MRIA 4ANXA 2PYEB 5BRZE 2HMID 4F20A 1TO5A 1T5XA 5BOPA 4IEFB 4BUGA 1JYWA 3TF7C 1B0GB 3I6KA 1J5OL 4HW6A 3OKOA 5C8JB 1JPTH 2FZ3B 4CJ1A 3W81A 4X6CB 3NCJL 4ABWA 4AJWA 2ATPB 3MRIB 4ONGH 2CJUH 4XP4L 1GS6X 5F9DC 5E1IA 2MCAA 4JNXA 2AJSL 1WA1X 2XTJC 3GD1C 2B4CH 3U4BH 1PY9A 3HRPA 4XN2A 2J1YA 1U8IA 2IWEA 2OMUA 4OF6A 1LDPH 4JAMA 3I6KB 2QPFA 3OKOB 2E75C 3Q7JA 1A3RH 2NDGA 1OV8A 4EZJA 3ZE0E 4WHTA 3CHRA 1MY7A 1MRFH 4G6AD 5K9JH 3DUSA 4LHJB 1KYUA 1TTUA 3IXTB 5I1HL 3CFCL 4WW2B 5DMGC 3MLSH 1H5BC 2YPLA 4KZ0A 4PWIA 4PWEA 4J8QA 3RJDA 3WIIH 1UM4H 4AVHA 4YE0A 3VYPA 4NKDA 4NX0A 3BAKA 4XCYA 4ACTA 1Q9OB 1X5HA 3MRCA 2YGQA 4PJ9C 4TLKA 4XPFH 1A8JH 4EZKA 4WHTB 1MWAH 1DSFH 1TMCB 3DUSB 3QWOA 5B1JA 4DP4X 3TBBA 1HA4A 5C97A 4WRLA 3KL3A 1AJ7L 1PYWA 2X9WA 3FUNA 1TQVA 4J3SA 5IHUH 1AQKL 4NKDB 4IQHA 4JMNA 2K3TA 1DEEA 1D3CA 1MFEH 1X6LA 1NMAH 3D2TA 3MRCB 5L7XL 4I1NB 1NGXA 3LY6A 3ELAT 3NFSH 4DQAA 2CJTA 1A7QH 3QWOB 5ICYA 1BEYL 5EU5B 7PCYA 4AUJA 5BRPA 3EIFA 1E4WL 2CCWA 5FB8B 1D9KC 4KNSA 4LGRB 3BEWA 1YDPB 2PO6D 2DBLH 2R1WA 3AVEA 5CP3H 3RVXD 4DO6A 1GIGH 1NAMB 1KG0A 1RVFH 5DC9B 3RVUC 5JXEA 5JPMB 2CUMA 1D6VH 4KV5E 2JK5A 5ECJE 2CM5A 4W6XB 4ZX4A 1NGXB 2CBQA 3SDXE 5FW8A 3VD9A 3P2TA 4JFTA 1NCAL 1U3HA 3QCTL 3KCWA 3D0LB 4C55A 1YNLL 4B9CA 2J73A 3GXMA 2VXUH 3UBFA 3JTTB 4F8TA 2BRQA 2OZ4L 1A4CA 3BEWB 5HDQL 5C0ND 2AAAA 4LIQE 2NUTA 2R1WB 3BWUC 4LO9A 5DWUL 1KG0B 1C5BL 4B7LA 4MDRA 5IT2L 4FQ2L 2JK5B 1CIUA 4M00A 3RFZC 1NGPL 3B9KA 3L1OH 5IUSA 1ZHNA 2NXYB 3KNBA 4GOSA 5E99L 2NXZD 3GJFK 2K1MA 4YDKH 4L29A 1U3HB 4NKIL 1JF1A 5SX4I 1MXGA 1PX4A 2NUTB 2VZSA 4ODBD 4GRMA 4EAEA 5IB2A 2IG2H 1OANA 5DHDA 4Z3IA 1DO5A 5D1XA 4OUOA 1BLIA 2VXQL 1OK8A 1JGDA 5C3LD 2WINB 3PFQA 2CLRA 5EF2A 3KNBB 1V10A 4L29B 5B38G 1JF1B 4L05A 4NQXA 1S3RA 5FA3A 1NSNH 1TQCB 3A24A 3NTCH 3N40F 5MENE 5CBEA 1IKFL 4GRMB 2YRBA 3QZLA 1W72L 1OP3H 3KPNA 5CS7A 4DP0X 3IKCA 3L4VA 4E68A 3BDBA 1B0RA 3GBEA 4YBLB 2CLRB 3HR6A 1T1ZB 1CN4A 3PXHA 1EUTA 3H42H 4PGDA 2Y24A 4NQXB 3BVNA 5FA3B 3CW3A 3OB0K 2DN7A 4L23A 3MLVH 2JKTM 1D7DA 4M5TA 3HVNA 3KPNB 1M6UA 1AQDA 3IKCB 5ILTL 5AB1A 5L8LB 4RWYL 1B0RB 3HG1A 3V5DA 1I7RA 4UTAH 1WUZA 3QUML 2V9RA 4HX1A 2G9KA 3WU1A 4PGDB 4ELKA 1MFCH 2XHNA 4HHGA 4X42A 3BVNB 1MCDA 2F15A 5E4EC 2I60H 2P43B 3UBXI 2IOOA 5DD3L 1EZSA 5IMLA 3D51A 4CU6A 4GXVL 1ET8A 4Z7OB 1AQDB 4NAQA 1TSHA 2C1PA 1CTOA 2XTJE 1R47A 4O02H 5HHXL 5C0CE 1P6AB 3RX7A 2NY7H 1P69B 5C0FB 4H0GA 3QUYB 3HG1B 3V5DB 4YJZL 3L9YA 3DRTA 4HX1B 1IBBA 1YJDL 1KBPA 3PWPD 3V4PA 4ELKB 4FERA 2EABA 4FMKA 1BF8A 4TUKH 1VPOL 4L0PB 1REIA 1Z7JA 3BW9A 1KTCA 1KLUA 4FFVD 5IMLB 1FA4A 3O2VH 3MCKB 4AUYA 2VLRA 2C1PB 1JZ7A 3BLBA 2B9AA 5AAMC 4IU3B 1ILUA 3QFJD 4KFMA 4BE6A 3DRTB 4WJ5A 2NY6D 3L4XA 3V4PB 4C54A 2VSMB 3NH7H 1J12A 2DQIL 5IHHA 5KVEE 1KPUA 3BW9B 1KLUB 3X1FA 1A7PH 5E5MB 4TL5A 4Y9FA 5D4QA 4DW2L 5J7CC 2VLRB 2X12A 5BRQA 1ML0A 5LKNA 1WA0X 2VMDA 3QWRD 1SLUA 1FRGL 1XXFC 4OZGA 3BJ91 4GQZA 1GYVA 1HZLA 3T6VA 2FO4A 3GSNL 5KTEL 5E23A 5CN1A 1KPUB 3IS1X 4X7TA 3SQOH 4D9QE 4DPCX 1BJ1J 4ABQA 1KN2L 2NQDA 3FDWA 4UU9B 3ARRA 4UBDC 5E9DD 2W1NA 5LG1A 5HYJD 1SVCP 2ZWZA 4KKPA 4I2XE 4HT1L 4JCMA 3EOYG 4X6DA 4X6CF 1PX3A 3WHXB 5FYKL 1TJHH 4A7VA 2XXCB 2OZ4A 4K07A 3THML 5ID1B 2FO4B 3DSNA 3HC3L 4I1RA 4IMKC 5IROA 5GGSA 1I5IA 2AI0L 4QRSA 3ETTA 2OTWA 3MLTA 2EUZA 4X7TB 4GO6B 5CSZA 1ZGTA 1J1OH 2QQKH 3QAZC 3MCG1 2GG1A 4AC4A 1GCFA 1R1CA 3EBHA 3RWIB 1AC0A 3DROA 1IAIL 4GO8A 4G9FE 4X6DB 1G7HA 1LM8V 2BY0A 3IDXH 1SMAA 2DQDL 3MLZL 5B39G 1T0NB 1XF1A 4DP7X 4CUCA 2VR3A 5GGSB 1IEHA 2OTWB 3MLTB 2VXQA 2LAAA 4IBSA 5CSZB 1JGUH 2IOMA 3HE6A 1KYDA 5DJ2B 1MHHA 1BAGA 1ZIQA 2WN3A 1XB6A 3GEWB 3DSFL 3DROB 3S37X 1G7HB 3INUH 1ZWIB 1U8NA 3V5HB 1N6UA 4RAUA 5EH1A 2HSIA 1UGKA 2ZX8A 1KOAA 1ECZA 1N12A 1M9WA 3AT9A 3FC8A 4MXVE 4OZIE 4XP1H 2QGBA 2WN2A 1WZ1H 5I1IH 4BK5A 2UZPA 4ANVA 3MOAH 2E7HA 1U91A 4NERA 3HE6B 2DMGA 2QVFB 2WXFA 4RMVA 5L4IA 1J8KA 4UINH 4M5SA 3RVWC 3M8OH 4AT6A 3U1SH 3AU0A 5C08A 5I1AA 4Y4HA 1U8NB 4P2OC 4MB5A 2IMNA 4RAUB 3T2NH 4L4VD 1TKWA 1KIUA 5HJBA 1Q1JH 1W72B 2Z8SA 1E4XI 2PABA 4OLUL 2DQJL 1U91B 3B4NA 3IFPA 2O72A 5EC1A 4XBGA 3QUMA 1T21A 4AT6B 2M3UA 1IC7L 3QP3A 4KVPA 3QJXA 1ACYL 5C08B 4Y4HB 3SPCA 5TF0A 1HEHC 4M62H 1L6ZA 3SE3A 4J6RH 1TKWB 5LAXA 4ERSL 1HVXA 1KIUB 4X8GA 4CSZA 3WYRA 5C2UB 2NY5C 3NIFB 4JO3H 1C08A 3OSKA 4G70B 3IFPB 1M05A 5AOMA 2NX5A 2W0LA 3LD8B 4XBGB 1BZDA 3QUMB 1T21B 1WZKA 3EOAA 3K8KA 2Q86A 2KQNA 2EXSA 3QUXD 1U8HA 1DEDA 1A4AA 4X9FA 4ODSL 1CICC 1IC5H 3L9RA 2GEQA 5LAXB 3KL5A 4R7DA 4OFYD 5IJVA 4WU7A 1FSKB 4YIQA 2VN5A 1CLYH 1C08B 2NT0A 4OLXL 5E1HB 1P1VA 4I87A 2NX5B 3CAFA 5ANHA 4HCFA 2VQ1A 1R3LB 1ADQL 1PIFA 3EOAB 1MCPL 1Q94A 4PRDB 2Q86B 2V4LA 3WN5A 1U8HB 3F85A 2WUBL 2F58L 2C3HA 1UD5A 4PRBA 3SQRA 3B8SA 1FH2A 3EYOA 1TTAA 3RLSA 3OKNB 2PKDA 3UXFA 5IJVB 5HGBA 1XDTT 1Y7VA 4WU7B 3MLUL 4YIQB 4E42A 3LZFH 3QUKA 1UM5H 4B27A 1M8UA 4ICXA 4UQ2A 3UMTA 3CVHA 1TT6A 4J23A 1KMGA 3WN5B 5LXVA 4ENED 4HZLA 3D69A 2R0ZH 3MA9L 2BMKB 1Z1WA 2A99A 4PRBB 1RZ7H 4ZODA 9PCYA 3SKJL 1DQLL 3EYOB 5TQ0L 1SXAA 5CEXB 4HWBL 1HZHL 3QQNA 4M6AA 1ZOXA 2WQWA 2R0KL 4E42B 4S1SL 2VW4A 3KEHA 2HT2C 1WH0A 1CB4A 4OM1H 3QUKB 4F37F 2GJRA 3T0EA 2EDLA 1RU9H 5GS0C 1UXMA 2HG5A 3GSNB 1XBDA 1IVLA 1KC5L 2W94A 4GG8A 3D85A 4TQPA 4F58H 4JDEB 1Q72H 3N91A 2C9AA 3EDKA 2KZBA 1MJUL 5MI0B 2O26U 4RRPG 4UTCA 3KMDA 3BOVA 5D93B 1EJ6A 1I9EA 3MRNA 4UWQB 2EE9A 3NABL 5DSCB 2PXYC 2PPAA 3T0EB 5GZNC 5GRUH 4DAGH 3C09C 5F7EL 3LN4A 2APSA 2HG5B 3ABKB 2FEDD 4HGWA 2NY0B 5AL8A 4GG8B 4Y5XC 3TEYA 3LMJL 1S7QA 5ANME 3D85B 2ZG3A 3D4YA 4NBXB 4P49A 4XN5A 2MMXA 3FN0L 4J6IA 5AW1B 5DFTA 3UTOA 3ZW3A 4YHIA 2UWEE 3JSSA 1QKZH 1THCA 3MRNB 2B3RA 3T65A 3D9AH 3AG4B 4Y4KC 1QR1A 3PHOA 1LO4H 4ZX5A 3S3PA 3LN4B 2H6PA 2VAJA 2OYKA 3WMQA 1I1AD 4H8WL 1S7QB 2AMGA 1MFAL 1GGBL 3GLEA 1KTRL 1Z3GL 1ZIRA 3KVQA 4YHIB 2PN5A 4IBVA 3ARYA 3FONA 1ZMYA 2YEZA 3DXAE 3MC0A 4QF1A 3A4EA 4FLSA 1DBKH 3JZ7A 1O9VA 3T65B 3EYFB 2HJLB 2QKIA 2XA8L 4OQ1A 5EBGA 1QWNA 2WW8A 3OMZA 3PHOB 3VMPA 1RZGA 3CTTA 2H6PB 4R97C 5DR5L 1RUAH 2QZ5A 4N90D 4MA7H 1C8PA 5GGRY 1NMCB 4Y5VC 1DYZA 5D1QD 3B2MA 5GRJH 4EJ1C 1CBVL 3FONB 2VMEA 2YEZB 4QF1B 5C7ZA 2W65A 1OCOB 2YKKA 1R46A 2FJSA 1ZD6A 2C9RA 1YNTA 3FUEA 2QKIB 1RZGB 3OB8A 4RDQF 5T33H 1BFSA 3CH8A 4OZGF 3X17A 5HJ3A 1SLVA 4F57H 4FCAA 3TYGL 4H0IA 3RAJL 3QJSB 1OGAA 5A2JH 2W65B 1KGUA 3QYNA 5B21A 4JFPA 2MNJB 4BFNA 2VRKA 1YNTB 5I1CL 1XSIA 1A5FL 4OUUA 4GQQA 4CN4A 4X6DF 2J3SA 1BLNA 3HEIB 1C16A 4OCYH 5HJ3B 1I9IH 3TH2T 3WNMA 2BOCA 3VXMA 4JFQA 4KO7A 1OGAB 3MLYH 3GSWA 1DZ0A 5JQ6L 2C3GA 5TDPA 4W9GC 2SODB 4JGNA 4XPGL 3P30H 1OM3H 3JWNG 5L88H 2YS4A 4PJIA 4OUUB 1BLNB 2JB5L 2B20A 1X5FA 5DRNA 5BRZD 1EERB 1C16B 3RILA 3TA4D 4TLTA 3ZYZA 4LLWB 3QXDA 3VXMB 4ZOAA 5ID0A 4FL4C 3GSWB 2P24A 2WXHA 3BWZA 5TDPB 2Z64C 1SHXA 4KPHH 4BFIA 3D7PA 2FWSA 2ICEC 4RLDA 1GW6A 4JANA 5D4JA 1MJ8L 1OSPL 4M1CD 4L18A 2JH2A 4ZUTA 1GJIA 2ZX6A 3TJHD 1JPSH 3QXDB 1QPXA 3WO4C 3UO8B 1L9NA 2P24B 3FHQA 6FABL 1QFHA 3ZPDA 3STLA 4ENZA 2JIXD 3RVVC 4BFIB 3ZQWA 1NBQA 3SY0A 2IEPA 5ABAA 1BFTA 2R29A 43CAA 1E2VA 3B2VL 4JANB 3KBEA 2DD8L 5ELIA 4JHBA 4N26A 5E8OB 4ZUTB 5C0EA 4YC2B 1DQJB 4N3TA 5DT1L 1F1AA 3CC1A 1GJWA 3JT0A 5DJCB 4CKQA 1AGCA 3P0YH 4FTVA 3TA3A 4EOWL 3DIFA 5LCVH 4TRPH 2WWKO 4OJFL 1IU1A 3KPMA 3DUUB 1G0XA 4PJFE 5EORL 2NQ3A 1NBVL 3SY0B 4DT2A 1UH3A 3OMAB 43CAB 4Q0XL 5J13C 3WKML 1YY8A 5GZOD 1G7IA 1NPSA 1WWAX 4ATWA 3HZ2A 1AGCB 3TA3B 5FF6A 3DIFB 3SZ6A 1NFKA 2PO6A 3APFA 4JG5A 5E8DL 3KPMB 2Y5EA 3KYAA 3WMPA 4P5KA 3FL7A 2F9BT 1SN0A 2UUDK 4LLVA 3RPIA 1JFHA 4LOVA 5HHVL 2O5YL 5HY9A 3VXRE 1AY1H 1AG0A 2DQHL 1L9PA 1G7IB 4OD3L 3QDHA 3ZDWA 1RZKC 2PTTA 1XGTA 4HEPA 3SKNA 2AZAA 2PO6B 3MRBA 2KYIA 3V0JA 4XNAA 1Q9WA 3S3CB 1XCTA 1IGCL 4U1JA 3Q01A 2Y1AA 1NBZA 5MP6H 4P5KB 2P52A 3WTVA 4QRAA 1Q8MA 3RPIB 4LLVB 5HY9B 2HVJB 2DWYA 2CBPA 3D39E 4DOHE 2YEVB 1PAMA 2PTTB 1XGTB 3SKNB 1UKTA 3MRBB 4O9HH 4PP2B 5AWNL 3WJJA 1E4XL 3A4AA 1Q9WB 3DYPA 3FUIA 5IBTL 1XCTB 1JD9A 4U1JB 3RQ3A 1SJMA 4DEUA 5I0DA 4R7LA 4FXKC 1NBZB 5L8JB 3BPLC 25C8H 3EJZC 3H54A 4MCNA 2NXZB 5CWSB 3GIVA 4EZLA 3UBXA 2DEWX 1NOLA 4BHUI 3MR9A 4NDMA 1A66A 5CU9A 4B50A 5I6KA 1BD2A 3QIBA 4Y2DD 2W0KA 3L3HB 3TH3T 3PABA 4U1MA 4ZAKD 4F5CA 4YE4H 5EU3B 4JO2L 3Q1SH 5CBAA 2E76C 4R8WL 3NJLA 3GIVB 3OVUB 1I1CA 3B5GA 4MD0A 5DUPL 4MTMA 4U3HA 3L3OC 3UBXB 1L7TL 5MEND 2X88A 3N50A 3MR9B 2LTQB 1LK3H 1F58H 2H2PC 3GMLB 1NTDA 4NDMB 4NSKB 2G9HA 1BD2B 3QIBB 5AQ0A 5FUZL 1YC8A 4U6HA 3X2QB 2X2UA 4EO5A 1RFDH 4G7YH 1J0IA 3BUBA 4PGCA 4M9PA 5E9AA 2R8SH 3PABB 4U1MB 2UZXA 3VB8A 1TFPA 5GRWA 1N3NA 2MNUA 4N0UE 3PWVB 2E7LA 1DUYA 3PGDA 4KH2A 4ISVA 3E0GA 3H7BA 4OGZA 3GNML 4MD0B 1KCUH 3MCLL 5E70A 4KMLB 4O2EB 2N1TE 3C5SB 3HNTH 1Q9KA 2G9HB 4N1CA 1IAKA 5JXAH 4PY8I 4K3JL 4NO3B 2WXPA 2GC4C 1A1OA 3HC4L 4FYTA 2A9CA 1N3NB 4QUOA 4UT6A 1DUYB 3PGDB 4QOKA 3B7TA 4ISVB 1RPKA 1GOGA 1XF4B 3B83A 2FGWH 5AW5B 3GZOA 1DSWA 4XWGL 2YHGA 3VE0B 3BDXA 3MRJA 3MODH 4JGFA 1Q9KB 3KGSA 5EC2B 5H37H 1Y1DA 1JGEB 4F1SA 4CN6A 2XTJD 5C0CD 2GJ6A 1JUFA 2Z8RA 1S7RA 2J4WH 1F4WL 5F7AA 4KITB 1TMQA 1ZGLA 4DN4L 1A1OB 4KQ4H 2A74A 3QFJA 4M03A 5LNGA 4NKOA 3PWPB 3EHBC 4JGJA 5H35A 5FYJE 4RX4A 2EDQA 3MRJB 4H8PA 4OB5H 1GS7A 1QNIA 2E3VA 3KS0H 1KYFA 3I75A 1YNTF 3UADA 1JUFB 3DTXA 1ZGLB 2EO1A 2B14A 3ARZA 3UAJA 3R19A 3VG0H 4Z6AT 1RJYA 4HHWA 2A74B 2IVFC 3QFJB 2JJTC 3QWRA 2NY6B 4NKOB 2FLMA 5H35B 4U33A 1DE4A 4PJ9D 1O7SA 2FB4H 1II4E 3C5ZA 4HF5L 1QI5A 3P3RA 2XG4B 3CN4A 4D0BA 3DTXB 2JB6A 1I8AA 4N85A 5HYJA 3KVDD 1J18A 1JDCA 2B9BA 4HIXH 1M7XA 4X6FB 4JDTH 2EDHA 3D2UD 4PS7A 1PLCA 4OCXH 1DE4B 2AEPH 2O1AA 2XNAA 3C5ZB 1ZWMA 1AFVL 3UZVA 1QR4A 4BE5A 1HXMA 4D9QD 3RKDC 6TAAA 3LPPA 4OI7A 3UG4A 1NCWL 2VDRL 3S0PA 2Q8BL 4D0BB 1D9KD 4K4KA 5F9OH 2CIIB 3DLQR 3U36A 4PJIF 2JB6B 2AQ2A 5HYJB 3C60C 4GLRH 3I02A 4OLVH 3WNLA 5C92A 2BNQA 3MREA 3V2AR 5ADOL 2VO8A 5G4NA 3RVUD 4PBVC 1LEKA 4P59L 4XPTH 1GR7A 4N1EA 4W9JC 43C9A 4B95C 1RZJL 3UZVB 4JHUA 1HXMB 2P80D 2X6BA 4FG4A 3P77A 5EIVA 1BW8A 3MBEC 1D5ZA 3VI4E 5DQJA 3U36B 2AQNA 4G9FD 3HB3C 4ZNCD 1NCOA 1B3JA 3I02B 3WFBL 1FAKT 2BNQB 3MREB 2FUTA 3ZL2A 3ETSA 4LSUH 1LEKB 5DEZA 4C59B 1P53A 2RIKA 2Y36H 4E0RA 4QWWD 5KSAC 43C9B 1E8WA 2ZP9A 4OLZL 2FWUA 2YD2A 1XV8A 3P77B 3ISYA 3TVMC 3PGCA 3EOBB 2G0KA 1NC4A 3NCCB 3QNYA 3SD5A 1HYRC 3ULVH 1OPGL 4KTEH 3EZ8A 5JNYA 1O75A 4FXGC 3AUWB 3O0RH 2QGCA 5CGBA 1A6PA 1ELPA 4E0RB 3WFEH 3AY2A 2Q76A 4K7PY 3WE1A 4RMBA 4LBAA 2VDNL 4DKTA 3D07A 3PGCB 1HHKA 1NC4B 1JZIA 3ESNA 3QNYB 2XWRA 4HIIA 3HI5H 2Q0ZX 3QDGE 1CT8A 4N5UA 1QPPA 4NQDE 2GY5A 3SDDC 3GLZA 3QR0A 2LVEA 5JNYB 3ZMNA 4NENA 4ATTA 5DGQA 2CA3A 4JO4H 3PCYA 1WAAF 4PCKA 4UDTB 3WTWA 3F83A 4MB1A 5KSBE 5HD8C 1BBJB 4HLJA 2ZKMX 1HHKB 5LWYH 4ODWB 3MV9A 4MX7A 2LE9A 3GXFA 3K1KC 1JYVA 1MCEA 4Z7WA 2XPYA 4PJ7E 1CT8B 2NY3C 3L81A 5H4YA 4F8OA 3CDGA 4I88A 4JFUA 3QUXA 4PJCA 4UT9A 1SUHA 3GJFH 1BAFH 1UZ6E 4LVHB 3QEQE 4NENB 1X4YA 1RZQA 4A2HA 3BP7A 4N8PA 1E90A 1R5IA 5ALCH 1I8KA 2Q7YA 5DTFA 1NINA 3EG9A 4MHHI 3RWCA 1L3WA 3NUKA 4HXAL 1MCLA 1CQKA 2XX0A 4JRXE 4LKXB 4MX7B 3ZTDC 1E50A 4A63A 4HH9B 1H4AX 5K9KB 2A77L 4JL2A 3OAUH 3CDGB 4B5ZA 3QUXB 3ARGC 4PJCB 2X4PA 1AP2B 2ENJA 2Y6SC 4PN6A 3OR6A 4PY7A 1ZK9A 2D7PA 3MX0A 3VXOA 1V3JA 3BP7B 1R5IB 3V0FA 4FGMA 3F2LA 4BBWA 5DURD 5AB2A 3TFKD 1I8KB 2Q7YB 1YEJH 5DTFB 2A6DA 3EG9B 3RWCB 4GIAA 4WKXA 5D96B 5ERWA 2WYZA 4LEXL 4L9DA 3P0GB 1MXDA 1BIIA 4GUQA 2ZWLT 3F84A 1YEFH 2X4PB 3OR6B 2WZAA 1HJCA 3N1GC 1BD7A 3MX0B 3VXOB 1I3VA 4LF3A 5DD1H 2E8YA 5J11B 1TLMA 2F8OA 3EYSH 1A4BA 2A6DB 4D8PA 2DL9A 1KEML 5ERWB 5CILH 5JHAA 3LIZL 2WQAA 3S3SA 2H8PA 3RBGA 4KQ3L 5TE7H 4AOFA 4RGMC 1G4RA 4OFQA 1GJUA 4PJHA 3JWOC 1I4FA 2RB8A 1L5GA 3MUY1 3LSOA 4AEHL 4TPRL 1TVDA 4KUCF 2BFGA 4DP1X 4D8PB 5CJOH 1T22B 2YJLA 2V9UA 1DN0B 4XNZB 3SKUD 5HYQA 3VQLA 1SRDA 2YR3A 1EH9A 4X2UA 1RSYA 4Y2NA 4UBDD 1DSLA 4DEWA 1IX2A 3TJPA 4TMPA 3CLEL 4PJHB 4G43A 2VDRB 2DQTL 2VIRA 1QEXA 1TTRA 4LLDA 1K3IA 1L5GB 3LSOB 4HK3J 2M3TA 4ABUA 3U0WL 4P9HH 3QH3A 2PUQT 3N42B 4PQXA 4OGXL 2H0EA 2LGNA 5B3NA 2OSXA 5HYQB 1CYXA 4JQXC 4Z8FH 2ZKXA 4KK8C 3CSBA 2VABB 3UZQA 1J0ZA 3OGOE 4ZS6C 1FNHA 4HWNA 5T1MA 3TJEL 1IRAY 2WYIA 4LVNC 4XMZA 3RB7A 2JQAA 2NUPA 1I1AA 4G43B 2VIRB 1NKOA 1U8OB 3WXVL 4FI8A 2BHFA 4BXVA 4NN5C 3ZHLA 3QH3B 3EDFA 1NA8A 2YQBA 4IBTA 3SO0A 2EEAA 4GAFB 3O6LL 2ADYA 3U7AA 1MZYA 1YQVH 2LABA 1UJTA 5F89A 5EZOL 2WTPA 3UZQB 3WY2A 4LSTL 1O9ZA 5T1MB 7FABL 2VLLA 1RCYA 1I1AB 3ARFA 1SQMA 3BAJA 3DXAD 1X5LA 4NJ9L 3N41B 4A68A 3QULA 4ODHL 4A2EA 1OKIA 3OLIA 4Z7QE 4AGNA 3ZDZB 4LIQL 1F4AA 4KY1L 5FCUL 1CXHA 4J2XA 4RDQG 5F89B 1IFHH 1KT2A 4ONFH 3LDBB 4EUPG 4RISH 4IAUA 4IDJL 1OEZW 4K9EL 3S2CA 4DVBB 2VLLB 3ARFB 2VDNB 1N5AA 2G2RB 3QIUD 4CMMA 2B59A 1IT9H 4HC1L 5DEGA 4OFIA 3VFNA 1KACB 2CO7A 4P2OD 5D1QB 4PJ8C 5DZOA 3QULB 2VLKA 4AIXA 1JV2A 2BSEA 4PCTA 4K3DH 5LO7A 3NJXA 3TWCL 3WTSA 3HI6H 4N2LA 5EHFA 1KT2B 4FQIL 3TO4A 3AG3B 3SODB 1A9BA 2ZUQC 4OGAD 3T3MF 4BWWA 4FQ1H 3ZN6A 2B59B 4CMMB 4EZMA 5DEGB 1YEKH 3QARA 3VFNB 4A7GA 2CO7B 4GAJH 1NJ9B 3HG3A 1VERA 2MPAL 3O6KH 4UZGA 1JV2B 3BQVA 2R23A 1T04B 4LCVA 4TKWA 1H8SA 1KJ3L 2H6UA 2HLFC 4S1QH 1IBGL 3L8QA 3OMIB 3H55A 5DD0L 2XXMB 1QHOA 4PJGE 1OP5K 4X83A 4HIQA 1QLEL 2PCPA 5FOJA 5BRZA 4RGNE 3ZL4L 2GPZA 4LU5H 1CICD 3I2CH 3O6FA 1HK6A 2KLSA 5FPIA 2V2TA 4LCYA 2R23B 5I0VA 3MUJA 3R4DA 5LDUA 5D5ME 1E3XA 2A1WH 2B08A 1TJMA 2WB7A 5FKPA 1R3IH 3K7UA 1MAKA 5KBMA 1P84K 3I9HA 4JUSA 4LSPH 2PCPB 1NCDL 1OQOA 2X89D 3STBA 5BRZB 1NC2D 3QQDA 4DGUA 1ZDSA 3LIZA 4UI2A 3F7YA 1R3JA 3O3DA 2UXTA 1YEEH 5K69A 1KN4H 4K9JA 4LCYB 1AHWC 5IHWA 5I8KH 2V2TB 1TCMA 2WO3B 4WWOA 1A1NA 1P5VA 1XFPA 4FX5A 3KCPA 4ZFZA 3VSTA 5FKPB 3A21A 4FZ8L 2EEDA 2R2BB 2LFGA 3VGHA 3GRGA 3MCYA 2F5BH 3K2UH 3MBWA 5E5LA 3QQDB 1WTGT 5ITFA 3X3GL 2WBWB 1QNZL 4ZO9A 1X44A 2BSTB 1IQWH 1N10A 3BC9A 3F7YB 4IBLT 1R3JB 4EE2A 3O3DB 4KKLD 1U41A 2Y2YA 2YK1L 3NAAH 3Q2WA 2JIXB 4MRBA 3DOSA 3UAFA 1E4JA 4H8QA 4F2ME 1A1NB 3CN3A 2Q8AL 2HT2D 2ZXWB 3FT3A 3KCPB 4ZFZB 4MZ3A 1JOIA 1GZPA 4OVVA 1SXSA 3ZE0B 4ELMA 4D3CH 2VDPH 4BK4A 5M7QA 1CXLA 2IFGA 2BVYA 4R0LA 3MBWB 5KG9A 1RIUL 3CVCA 1PJWA 5I76A 1LYQA 3GRBA 4LNVA 1JHLL 4Q7DA 5KVEL 3Q3GA 3DOSB 1I3GL 4Z7WF 1EMTH 4Q9CA 4X0KA 2CO4A 3FT3B 4X8XA 2BH0A 1PDKB 3JT2A 1CIDA 3OF6A 4PJCF 1CXFA 2FATH 2PXYD 4ELMB 3BUTA 3EFFA 5GZND 1TG8A 4O00A 4R0LB 3UZEA 3ZO0A 5ITBL 1KEGL 5KG9B 4DGYL 1D7FA 3ZE2F 5L2KE 3L2LA 2P26A 4L2LA 4TQEL 2KPWA 1MQ8A 4L5FE 4LPTA 4B9IA 4IBWA 5I5JA 1J0KA 2ZYSA 4I18A 5K5YA 3Q3GB 2HKAA 4O5LL 3UERA 1Y1UA 3A6CL 1PPIA 4PLNC 2DM3A 3VXRD 3IRZA 2IH9A 3EFFB 1PKQE 2ZJSH 4Y4KD 3AQDA 2WZ0A 1DBJL 4N2OA 1TJIL 3RZWA 1KBWA 4X8JA 2D8KA 5J3HC 3SD2A 1UXWA 3DMMC 1A2YA 2A6KA 1PTZA 4N1HB 1AKPA 4XNUL 1IJ9A 1TTGA 4NXKA 3WD5H 2K6ZA 2DY2A 4FYQA 4WUKH 3WSQL 2XKUA 2ZOTA 2R4SL 3D39D 4M9OA 4HSQA 4R4FL 2OYPA 4LHUD 4KKZA 4Z3JA 3RWDA 3IMVA 5E6IA 4JY6A 3ZHNA 3GSQA 4OCMC 4AQEA 2XZCH 1UXWB 1A6UL 1F86A 5GS1A 1KXQA 1A2YB 2A6KB 4IYKA 1UXLA 2IFFH 1BAWA 1CL7H 2XZAL 4OAWA 3IE9A 1S3KH 3I6LE 3FS9A 4EN3C 3DURB 3AAZA 3UCQA 1PJ9A 4WGWB 2WIMA 5FS5A 2Q9OA 3KYNB 2XVGA 4FMFA 4HDIA 4PJHF 3RWDB 4M3HA 3V9CA 5JPNA 4RCAA 3GSQB 4FCHA 1KB9K 4KROC 4AQEB 3BPCA 1RIHH 4LB8A 5GS1B 1S9WA 1CPUA 4HBCH 1YEHH 2BVQA 4OAWB 3NMEA 4Y2DB 3S5LA 1N4XL 3LAFA 4TVPE 5FO9A 5KVDH 4JO8A 1E3ZA 3US9A 3AAZB 4ZAKB 4YDMA 1ZE3C 1N8ZA 4D7BA 1Q0XH 4IM8A 3CFNA 2PR9A 4FFWC 4G7VL 4HDIB 2KDYA 5IIEB 4YZWA 2X6AA 5JPNB 2QT6A 4O51B 4XNQA 1I75A 5MENB 3EUUA 4TF4A 3BPCB 5EFIB 4R90H 1S9WB 1TZGH 3D48R 3LRLA 4FFYA 4WI8A 1G7QA 4KJQC 3UPCA 5FO9B 5TF1H 1QLEB 1MAMH 2K78A 3VFUA 5GQBA 3S35L 3W0WE 1P4BH 1N8ZB 2A4EA 3QCVL 3QI9C 2HLAA 5JHDA 2FD6H 3N41F 4F7PB 3Q2VA 1MFDL 4XNQB 3FT9A 1T2XA 4WKZA 4DGVL 3ZT5A 3QISA 1RKRA 1G7QB 3ZDZF 1C8QA 3NA9L 3QHFH 5C0CA 2YJQA 2I9TA 4NUJA 4WDIB 4HKJA 5LGHH 3VFUB 3CMOH 4D9LH 4AG4L 4PHZA 4CBZA 3CX2A 3QHZH 4P23C 3IFLL 2HLAB 5JHDB 2OV0A 2WC7A 4UMSA 2YWYA 2EC9U 5GJSL 3OKLA 4WKZB 1P5UC 1BV8A 2I32A 4FZEH 1FGNH 2XTJB 2YUXA 5C0CB 1R0AL 2B1HH 2B5IC 4NUJB 1H5BA 1YAZA 1WP6A 1DFBH 3K4ZA 1FE8L 3T3PE 4N4YB 1DVTA 2WNGA 5G5DA 5FYJD 1JHTA 2EH8H 2BVTA 3RY4A 4PJ9A 1XEUA 3OKLB 3LN9A 2P8LA 2W88A 3HBQA 2AK4E 5I1JL 3E7JA 2V3DA 5GISH 1LVEA 1QFPA 4ZNEE 1VEMA 1H5BB 4QO1A 3TXAA 1X5XA 1XCWA 2DI7A 1N5YL 3ABGA 4GH7B 1XAKA 2PR4H 5DMIH 1I85C 1OAKL 1M53A 1J8SA 2VKXA 4JPIA 5F0LB 5G5DB 1JHTB 3UG3A 3FU0A 4A7GF 2WAQA 3CV5A 1PNDA 4PJ9B 4ZS7H 3ARBA 1KFAL 2RQEA 1E30A 2P8LB 3KYKH 4PWKA 3GHEH 4O2CA 2BVUA 1FDLL 3HCVB 2C34A 5EZIH 4LAJH 1D9KA 2WQVA 4I2XA 4QO1B 4UNUA 1DJIA 3DX2A 2GITA 4MJ6B 4QEGA 1EEYB 6CGTA 2ZWYA 2XN9E 4WHYH 1SN5A 5LNDA 4JPIB 3D4ZA 3QZWA 2RAMA 2X2JA 3D2UB 3S2AA 5C9KA 2XICA 4Z3TA 1G1YA 1H3GA 2DIJA 2P80A 2XN0A 4H1LB 4O2CB 4XP5H 2WSKA 4DQOL 3ABLB 3ETBJ 3BAXA 1D9KB 4I2XB 4RFEA 4G9FA 2FLRT 3OAZK 2DRUA 2GITB 3DX0A 4CMHC 4IJTA 3MI6A 2JI3A 4HV8A 4RFNC 3FB7A 1IO4C 3EBGA 2AQPA 3D5OF 1B9ZA 1S7UA 2DAVA 5KW9H 3CFKB 1MNUH 2HCZX 1V3LA 4N68A 3RFZA 4QTHA 5KZCB 3SE8L 3VSVA 4XR8C 1ZY9A 3VH8B 4OSUH 1MELA 3ESUF 1S7TB 2GW5A 4J8RA 2F6AA 3J07A 1RQ5A 1NDMA 4RFEB 4G9FB 4Y1TA 3ULVE 2QMJA 2R0WH 4BCXA 4HV8B 1WCQA 3FB7B 3FQWA 3P4LA 3QJQB 1MREH 2B3IA 3RFZB 3VXUE 3S36X 4OZIA 4QTHB 3QXVA 2FJFA 2VKWA 3V6OC 5J1AA 5B1BB 3GDCA 5I75C 5IB4A 3FUFA 4J8RB 4LHQB 2UUDH 2VJ0A 1UUNA 4ELMF 4TNVF 3C08L 3IMSA 4FD9A 3FQWB 4P3DA 1YN7A 4OZIB 2WVUA 1RHFA 1JZ5A 4KZDL 2FJFB 4TSBL 1N0XL 2PETA 2KH2B 1W2KT 3GLDA 4OJAA 4JN2A 4YDVA 3QDGD 4NQDD 4X4ZA 5IB4B 2CHWA 2PWHA 2YD1A 4ZMVA 2AK1H 3OMNB 1UFUA 3DJZA 4WK2B 2QZQA 4E9XA 3R8BB 5JW3L 2ORBH 4P3DB 5DLLA 1YN7B 4HUXA 2ZCHL 4UOW1 3EDEA 1OCZB 3EBIA 4QRUB 4LZKA 4U3CA 4OF3A 3H3BC 4JHZA 4WFHE 2VOTA 4RSVA 2OR9L 1Z0NA 2Z91A 1PKOA 3OC8A 3QEQD 4G6KL 3AT8A 1KB3A 4NZRH 2NY5L 1CFNA 1UWEL 3FT2B 1J0YA 1OO2A 4XCCH 2BSRA 3SE9L 3RDTC 5AZEH 2W60A 3BSZL 1NM9A 2R83A 2YLHA 1F56A 4X9GA 5KVFE 4Q2ZA 4JRXD 1SHSA 4WTXA 4XN8A 2FX8L 5GJTL 4GRWE 5E4EB 4XXDA 3LS5L 3RUGA 1FFOB 4YO0B 5GS3A 1WISA 3TPUA 3PLYA 3MUZ1 4G59C 1ROCA 4G6MH 4LDCA 3ZMRA 3ALXA 1SEQH 2IGFH 3PL6D 2BSRB 3IB4A 5AAMA 2W60B 4V1DE 1UC6A 2VTFA 5DURB 2Y0SA 4Q2ZB 1NCUA 3EHBD 2WOBA 3L9BA 3Q8BA 1PSKL 4KHTL 2DLGA 3HNVL 1T0OA 1BM3H 4XXDB 3NIDE 2KUTA 3RUGB 5HYFA 2OMTA 2EINB 4GBXD 3DHJA 4XRCA 2VRQA 1KFGA 3CJJA 1BWMA 3GB7A 4PJBA 1O6VA 1EAJA 3CSPA 5DEJA 1X5KA 4HCGA 4QIRA 2ZOLA 1WCBA 3MGTA 1MW1A 1HIMH 2DJSA 4LCIH 3AS0A 4ZZKA 5AVSB 4P4RA 2ZUXA 4GS7C 3U25A 2OMTB 3SBQA 1ZVSA 1CJYA 3FBKA 1JXGA 4XRCB 4DKEL 1L9MA 2OM5A 1HEZA 1UENA 2FBJH 5K9QI 3AU1A 4PJBB 1MFVA 2K6YA 4TUJA 3AMKA 5F9JA 3SBWC 4K8RC 4DP2X 4Q97A 4XPFL 2ZOLB 1ZXKA 1O6SA 3K4AA 1JGIA 3MGTB 1WFJA 5GS0L 1NIFA 3E6FA 1F4XL 1NFDE 2Z8WC 5TE4H 4IMKA 4P4RB 4YHNA 4ZUWA 3RKDD 1UT2A 1CVRA 1P7BA 2WCSA 1ZVSB 4G5AA 5SX5K 3RL1A 5C0IA 2J6EA 2L4OA 3AS3A 5ANMA 1HEZB 4NZFA 2Z31C 4XCFL 1I53A 2VDLL 2WXOA 5F9JB 4TUJB 2YEQA 3SGEI 2NSMA 1KCRL 1NAMH 1MOEA 1O6SB 5ADPL 5FYLH 4N5EC 3UTPE 3EAKA 2APVA 2NYYD 4WK4B 3D6GA 3E6FB 3VAEA 3TM6A 1OCWL 4ZUWB 4YHNB 1YY9D 2GI0A 2KLRA 1PEWA 3WG7B 1SOQA 5AB9A 3RL1B 5C0IB 3QAZB 3MBED 4WSKA 5ANMB 1SMOA 2AQTA 1AZZC 4GUCA 3HB3D 2AGJL 2UWEB 3DXAA 2X4TA 2XETA 1GH5A 4YGAB 4ESKA 2JKNA 3HKZA 1FAIH 3RI5F 1C7SA 2XLLA 1RJZB 2O5NA 5T5FL 5FECA 4IJ3C 5JUEL 3TVMD 3R06A 2IPKA 4D94A 1PG7X 4DESA 2DL2A 5D72L 4FRWA 3GMOA 1KV3A 3JWNC 4RMUA 3DXAB 2X4TB 4P2OA 5DXWA 2ARWA 2CIKA 4IKJA 2FHBA 5HDLA 4K73A 3UJJL 4R5XA 4YFLI 3T5WA 4R9HA 5FECB 5LJYH 5T3ZH 4X80H 4QRPE 2ZSWA 2CNZA 3FYEB 5JHLA 3BVXA 1E0OB 4V2CB 2LQRA 3GMOB 4ZYKA 3SDDD 1JGLH 1IGFH 4W9DC 2ETWA 1JI1A 2B4CC 1E6JH 2EDFA 4GKNA 2CU9A 4HJGA 4P2OB 4UNVA 3S8WA 4NUGH 4YXLL 2CIKB 5EZLA 1HCYA 3CZEA 5D6CA 5D7IA 4XC3L 1G1OA 2MTAA 4M6ML 1Z9SA 2IPUG 2ZSWB 1LL1A 3BSZA 5IVXE 1SF5A 2K45A 4N2KA 4ZYKB 4OT1L 3U1QA 4C83A 3BD4A 4HJGB 5IQNA 1CICA 4GKNB 5KYWB 2VB5A 2FSDA 5E2JA 2HLEB 1BQHB 2PF6A 2P45B 5AOLA 1KPVA 5BZDB 5D7IB 4BA0A 4URKA 3U2SA 2LU7A 3BWUF 1Z9SB 3QRLA 5KANG 4RGND 5T1LA 3II3A 4OBSA 3RPBA 1J5OH 3ESPA 3KXFE 3BRFA 3ARGD 3BH8A 3N5AA 3G6JE 3SYAA 1CICB 3NCJH 2TSAA 2Y6SD 1KJVA 4HPOL 4PJ5A 1GGIL 2XV6B 4ZJ9A 1QLFB 4XP4H 2GK0A 1ACZA 1RPQA 2AJSH 1GSKA 4XCEA 2AHIA 5HSFA 2HWZL 1KPVB 1N2RA 2H1XA 3U2SB 3KL0A 3MPCA 3H2PA 3MRRB 5T1LB 2MCMA 4ZQKA 1NQBA 4NC1C 4QRTA 4U6XA 4MXVF 2XQYA 3RWHA 3BH8B 3GI9L 5HYSG 2L04A 1SLXA 2GK0B 4B60A 3IPEA 1PCXA 3MTRA 4XCEB 3KS0J 5I1HH 2NY4C 3V4PH 3CFCH 4AE0A 3NCXA 3GSVA 1N2RB 2YD4A 2ID5A 5EUOE 3VM5A 2ICWJ 3N0PB 2QDWA 4U6XB 1YUKB 3QJHA 5I19L 1PBYA 3RY6C 5AKSA 4UV4L 5FYJL 3DVIA 2WLLA 4AYEC 5KOVC 1ZV9A 5IR1A 2YO3A 1EXUA 4MGXA 4PVLA 3GSVB 1AJ7H 1MI5E 4G8GE 3WLBB 1K4DA 2BIPA 3F5WA 4LL4A 2EZ0D 2IAMC 4LRNL 1DQTA 3M88A 4AMWA 1AQKH 4JM4L 1A6VL 4N6QA 1S5HA 3GLAA 5GZNA 5L7XH 2RH0A 1CLCA 3QJHB 3BQUC 3VXSA 2AJYL 2V8LA 3IPBA 3OBAA 4BFKA 3U9UA 3PAUA 2AEIT 4Y5XA 4M7LL 1NGWA 2D7TL 5J57B 2DZEA 1AQ8A 1BEYH 3QZBA 4PJFB 1E4WH 2EXYC 5IR1B 3MJ9L 1WA2X 4KRPC 3BUDA 3GRWL 3F5WB 3VXRA 2PXYB 3TIEA 4KK8D 3KW7A 2IMMA 4Y4KA 1S5HB 5L2KD 3C09B 4X9BA 4ZS6D 3VXSB 5IWLA 3TZVC 2P5PA 4P04A 5T5FA 5AKVA 3U9UB 4Y5XB 1DQVA 1NGWB 2WTRA 1ORSA 3QCTH 2K6WA 1YNLH 2QADC 3B7SA 2R1XA 5I28A 3RUGF 2IV8A 2OZ4H 5HDQH 5GIRA 3MNZA 5I73C 5IJCC 4OV5A 4Q9BA 3VXRB 3TIEB 5DWUH 5IT2H 1C5BH 4Y4KB 4FQ2H 3H7LA 1NGPH 7TAAA 4KRMB 4L8DA 5E99H 2HTLC 4GFTB 4ZOCA 4P2RA 2WTRB 1ORSB 3TU6A 4NKIH 4Y5VA 2ZCLL 2R1XB 3JWNE 5CHNA 4IKKA 1PGRB 3A47A 2K3HA 3MNZB 3PDOA 5J1TC 2K4WA 2PLTA 2XY1A 4OV5B 3SBRA 3CHXA 2Y5QA 4L48A 3D39B 2ZOWA 4PJBF 1HESA 1FO0L 3P4OB 2VXQH 2RR3A 4R97B 4L8DB 4HOZA 4AYSA 2BNRE 3I6LD 4P2RB 2W92A 3CXDL 3W5NA 3FYIB 4Y5VB 2DDQL 4PJ8D 1KSRA 5CHNB 5CMAA 5KVDE 3PDOB 1IKFH 1BMZA 4P2QE 2K70A 1W72H 3RU8L 3PPSA 2AABH 4Z77A 2WJ7A 2X9YA 3S3JA 2R69L 2MTPA 4S1RL 4YLCA 1YEIL 2VZ3A 3O81A 2X1PA 4TVPD 4JQIA 2ITCA 2FX9L 3FXIC 3EJYC 2YAOA 4GO9A 5HT8A 1BXAA 3W38A 3UTSE 1HDMB 3DX3A 1EBAA 2HLFD 5ILTH 2NR6C 4Y5YC 2HAZA 2QKSA 4RWYH 1XH2A 1QO3B 1DVFD 2F7OA 3QUMH 3D1MC 1OWWA 3SB3A 2K0RA 4ZDHA 4QY8A 5DC0A 4MNQA 4NRXB 5KWYC 1JZ2A 2ITCB 4UV7H 5DD3H 3W0WD 4N0UB 4G1MB 3ABMB 4QHNB 5IFHL 4GXVH 4AGMA 4GXFA 4Z0XA 3VFOA 3AWFA 2ADFL 5HHXH 2ICEA 4JHWL 1YUHA 2HFEA 4HA1A 3BIAX 3SGDH 3W1ZA 3T08A 1YJDH 1ED3A 1ODAA 2ZUSA 1MCFA 1XTLA 2EE0A 2XWJA 4QY8B 4ZDHB 4MNQB 1NH6A 4X7SL 2CO1A 4DO4A 1IFGA 1FZMA 1VPOH 1QI3A 4FL4B 4X9HA 1QQDA 1EZVX 3SO1A 1AIFA 1M2VA 1OB1A 5A43C 3GEFA 3IJSA 3CFUA 4JG1L 4Z0XB 3VFOB 2DF3A 2ICEB 2DQGL 3OPUA 1YUHB 2HFEB 4J7RA 2X4NA 1ITCA 4DH2A 1ED3B 4XNMA 3QZMA 5JIIA 2XWJB 1USZA 5FUCE 2L8AA 4F9PC 3PPEA 3WO4B 4NC0B 1OP5H 3SPGA 1QQDB 1W15A 4FNTA 2X3AA 1AIFB 3C6LC 1OB1B 3IJSB 4DW2H 1I1RA 1LDSA 4A38A 3DGCR 2AK4D 2EDNA 4UUJA 1FRGH 3MJ9A 4K0OA 4XNMB 3GRWA 3GSNH 5KTEH 4NQEE 1XX9C 3E1ZA 5D7IF 3BSHA 4OD1L 1HL9A 1WWCA 1KN2H 1HS6A 5DJ6A 3VWJC 5ICXB 2CRYA 3APCA 4HT1H 5J13B 1SJHA 5FYKH 3O6ML 4UUJB 4ANKA 2Q7AA 3THMH 3HC3H 1AS6A 3WTYA 2AI0H 3QQXA 2BY1A 1QLRB 5JIHA 1K72A 2XN9D 3H53A 4GKSA 4P2CG 4NN7C 2KBGA 2OTPA 1K2DA 4JGMA 1Z0MA 4EI0A 1G9EA 4NI6A 1IAIH 5DMKA 2GSGA 4DJMA 2DQDH 3MLZH 1A14L 3DX7A 4RBPK 2OAAA 4FQXC 4NI3A 2WWMC 3ENUA 3DMMD 1GC1C 4P99A 2DJUA 4HISA 5C0AA 3SHSA 4GKSB 4OZFB 3N9GL 1A5DA 5CD5D 1VESA 1SLWA 1IJNA 1K2DB 3DSFH 1NIBA 2WXIA 4FXKA 4NNYA 2GSGB 3EJCA 5DMKB 1U8KA 3CVIL 4KOBA 2DQEH 3FU5A 3DX7B 3VI4B 4HHAA 1EEQA 4NGHL 4MBOA 2A3TA 5E8NA 1IGYA 1FO0B 4F7TA 5JW4N 4LK4A 5C0AB 5CXPA 5B7FA 3DDFA 2PTUA 4EN3D 3X11A 3VXUD 4F2EA 3VRIA 2VQ4A 3EUDA 3B9KC 4NNYB 4FXKB 3TBCA 2C9VA 3BPLB 4W70A 1HSBA 2AFNA 5GRJL 1AXTL 4HHAB 3O41B 3L3OA 4KROD 5I74C 2HPOA 2MRYA 2UY7A 3LB6C 4OV6F 2WLYA 3WE6A 5E8NB 3ARQA 1IGYB 3MLXL 4AL8C 4F7TB 2CKBL 4K5PA 2DQJH 4OLUH 2VSKB 4CA4A 4PU2A 2LW3A 1U95A 1VA9A 3ESMA 5D1XC 1XF2A 3VRIB 1X7TA 1FJ1A 2XCMC 4HS6A 1NFAA 1PQZB 1RK0A 1ACYH 2MEJB 4Q6KA 1JL8A 3PGFL 4FFWD 4ERSH 4HKZA 1FL3A 5MEPA 3QDGB 3L3OB 4NQDB 3WE6B 2UY7B 1IKNA 3CFDA 2IIJA 5DZPA 2Y3AA 3GUFA 2G0LA 4N2GA 1IBHA 3S4SA 3C9NB 4L0YA 2Z7WA 3QEQA 4PJDE 3QQ3A 4KJQD 1FN4A 1U95B 4JX0A 1NIEA 1XF2B 1SXNA 1FJ1B 2I7SA 2O6DA 4HS6B 2EDKA 5KSBB 5E8EA 2Y7QA 4A2MA 4ODSH 3QI9D 4WFHD 1ZEAL 4JRXA 4HKZB 4HGKC 5I1LA 1ZS2A 1FL3B 2X87A 2CO3A 1BZ8A 5C3TA 5MEPB 3EBAA 3CFDB 4OLXH 3BFOA 4ONHA 3S4SB 3P4MA 3QEQB 2ED9A 4WO4D 2W5PA 4FOMA 3NRFA 1ADQH 1MCPH 1DZBA 1HHHB 5CR8A 2WUBH 2F58H 2DB8A 1OKEA 2Y7QB 5E8EB 4P23D 4K15A 3OR7B 4HWEL 4JRXB 5I1LB 5D7KE 2F68X 3LHAA 3DTUB 1G6EA 3JTSA 4KKQA 3MLUH 3T6ZA 1QEWA 4ONHB 5AVQB 5E51A 5J4MA 3P4MB 3TFBA 3WUWG 2ADIA 3SPVA 1HSAA 4NB7A 3T8MA 4PAZA 4K94C 4V1DD 1HZKA 1S2EA 2FHCA 4YHPB 4Z7UE 2CLVB 2A5MA 4Q52A 1DN2A 3MA9H 4PV8A 3S5LG 2OJZL 4QNPF 3SKJH 3EHBB 1DQLH 1NUGA 5TQ0H 4N8UA 1HZHH 3JTSB 2BB2A 1B90A 4R7VA 3N2JA 2R0KH 3TS8A 2DOCA 4S1SH 1WWWX 3NJGA 1QZNA 2ADIB 4AUUA 3SPVB 1HSAB 1YA5A 3MLRL 2YPLE 2NSQA 4AGQA 4PV8B 1GZQA 2G5UA 1KC5H 3QXTA 3N44F 4NYLA 4P5TA 4WFGE 1G4MA 4R96A 3TBYA 2HFGL 4AEIL 1P1ZA 4XBPA 3T6WA 4WWID 1MJUH 1EWHA 3FB8B 3JWOL 3MRDA 3QZNA 3NABH 5C6PB 1V3MA 5F7YC 4M93C 1GCSA 2E46A 4M8VA 1AYOA 3C60A 5F7EH 1GZQB 4NYLB 1BM7A 3LMJH 4X6BA 4R96B 3TBYB 1JZEA 3FN0H 1P1ZB 4XBPB 5E94A 3AS2A 3ARTA 1CD8A 1JVOA 2CAKA 2WXKA 5SX4H 2NYZA 3MRDB 3C6SB 1ZJBA 2AJZA 3MBEA 2COQA 1GHFL 3SDAC 4M1GL 3C60B 2ZWNA 2UVEA 4MQSB 5CZXD 3JUYA 3UTPD 4YDZA 3K2MC 4XXCC 3ZK0A 2V2XA 1M7UA 2H3NA 4H8WH 5GGTA 5JMOC 4X6BB 1GGBH 2R1YA 3ZVVA 4L5FL 1Z3GH 5IMMA 1G5AA 5KSAA 3P9LA 5E94B 1ZLWK 5I1EL 3TVMA 3C8KA 3VA2C 1OE2A 5HP5A 1DJWA 2AJZB 4F7MA 3MBEB 2XA8H 1DCLA 5HVFB 3HB3B 5D2LA 1GSMA 1D5RA 3IMBA 1JVLA 2GHWB 4I8DA 5FDWA 1AQHA 5DR5H 5E2WL 2VZOA 2V2XB 1WEJL 3QNZA 2R1YB 5KSAB 5IMMB 2E5EA 3P9LB 1CBVH 3EGSA 3LEXA 2VR5A 3TVMB 4C4KT 3C8KB 2UYLB 2XG5A 2F1BA 4F7MB 2J56A 1NPUA 4OH2A 4LEEA 4R6UA 1YLBB 3FFOA 4U1IA 3W9DA 5D2LB 3V10A 5EUKA 2AXWA 2WSPA 5IFAL 5FDWB 1LLAA 4FXGB 4H44C 4HEMA 1XR9A 2FX7L 2Z3FA 4QRRE 4Z7QB 5D1XE 2DEYX 2CKBB 4IOSD 1M7DA 2LAGB 2PWDA 2D7OA 4FNRA 3TYGH 4QRPD 5CEZL 4BK5C 4KKRA 3OAZH 2A4CA 3SOTA 3EGSB 5EIIA 4Z9KB 3LEXB 2YGOA 2NNCA 2K9FB 3QZWG 1IBDA 5I1CH 2WXRA 3SDDB 1A5FH 4U1IB 4ZMAT 3W9DB 1AI1L 4PJ6A 1AHMA 1A47A 1EZLA 2ZUUA 5T1KA 4AENA 1XR9B 4FABL 3D0VA 1M7DB 1OTTD 3GBNL 4XMWA 4BFBD 3H4HA 2H32A 5EIIB 4PJGA 3F6IA 4GP4B 4TVPL 4WI6A 4ABVA 3IU4L 3H6AA 5JQ6H 1QSZA 1P6FA 4FF9A 1MF2L 4ANUA 4XPGH 2CD0A 2NY3B 2D2OA 3UABA 3W37A 4GW5A 3ARGA 4AVJA 2EIKB 2JB5H 3AMLA 2A4ZA 3MGAA 3SE3C 5T1KB 4AENB 3QG6B 3KLLA 4X5XA 3ARED 3F12B 3D0VB 3RDTD 5D5MA 2EDDA 3HG1E 1L9OA 2H32B 5FEBA 4PJGB 4W9LC 2DLHA 5IQMA 4IKNA 2DTML 4RGOL 3KXFD 2A9BA 3NJJA 3CPLA 3UGXA 1MPAL 3HN8A 1SJEA 4GW5B 1MHPL 4N2BA 3ARGB 3KHQA 5LN8A 4XX1G 1MJ8H 4X5XB 3K5RA 4OFPA 1CGSL 3G04A 4M8QA 5D5MB 4LSSL 6FABH 4HS8L 3P69A 4PRPA 2M8XA 3CPLB 1ZPUA 2VR9A 3I6GA 1SJEB 5HI3C 3QS3A 1I9JL 3NCWA 1OZTG 3B2VH 4FXTA 2DD8H 2NRDA 1TQUA 4Q6YA 4TQHA 3TEXA 2BINA 1QWUA 2VLRE 2WLZA 4BZ1L 5DT1H 3G04B 4KMQA 2NSXA 4F2MA 4M8QB 5KYUA 4EOWH 3EJSA 3T4YA 3GBDA 2D3NA 3OQRA 5K39A 4PRPB 2R2HA 5EORH 3M6DA 1NBVH 3I6GB 4GEIA 4NM8L 5IFJA 4Q0XH 2YN5A 3WKMH 4RGMB 4WU5A 1JNHA 1NCHA 3WJLC 1TF4A 4XOCA 4EDWL 4F2MB 2AMUA 4K8RD 4HCIA 1MI5D 5KYUB 4G8GD 5BOJA 2ITDA 1FL6A 4OZGE 3T4YB 2Q3XA 2XXFA 4N9GA 3LV3A 5K39B 3GPEA 4JQXA 1CUOA 5C86A 5CR1A 2R2HB 1T7YA 5E8DH 4JY4A 2EE6A 3J7HA 4Q4EA 2APBA 5IFJB 1SBBA 2XVLA 4KXZI 4R7XA 4XB7A 5HHVH 2O5YH 4WU5B 1JNHB 5D1ZA 2DQHH 2DI9A 3K46A 4OD3H 4D0CA 3HPJA 1JNLL 2DKSA 4X6DE 1NGQL 2ITDB 4N5ED 4RA0C 3L4CA 4W9BA 1FL6B 4ETQA 1DQQA 3LV3B 2QELA 5HVGB 4JY4B 3G5XA 1IGCH 4W9CC 4K7FA 5F7BA 4LLAA 1TEYA 1N6QL 2CWRA 4BJLA 4LVNB 2EICA 3CDCA 4NRYA 5HYEA 3FTSA 3VWKA 4D0CB 4EI5A 2PPDA 1SPDA 3HPJB 4X5WA 4CAGA 2R0LL 2VZVA 1HNGA 2Q6WB 4MYWB 4AYGA 4NN5B 2DPKA 2OMWA 3GO1L 3ZY7A 1IIKA 1DQQB 2MQ3A 4JFSA 5AWNH 1E4XH 1UA6L 5AYQA 2EYTA 5IBTH 3G5XB 3RWEA 4K7FB 1U8QA 3BVVA 3RL2B 1RJCA 4NRYB 4CDGC 1XAUA 1KTJA 1YQ2A 1H3PL 4X5WB 3WELA 4PJ8A 1LMKA 1E42A 2NYKA 2B8OT 2ZX9A 3O3AA 4X5PA 2EYTB 1R3HA 3RWEB 1FH5L 1XH3A 2YN3A 4JVWA 1CU4L 3RVTD 2BNRD 4JO2H 1U8JA 2BS9A 3W11C 2BY2A 3D34A 4R8WH 5DQ9A 3DPBA 5DUPH 1L7TH 4A7QA 1ZTXE 4P2QD 4PJ8B 4YL9A 4YEFA 3AW5A 5IV2A 5EEZA 5FUZH 1KGXA 3IYLW 4IRZA 2WXLA 4F15C 3LN5A 4A37A 1XH3B 4JFHE 1E28A 3RIFK 3QWNA 1U8JB 4TM9A 4HSCX 2ZUQB 3HAEG 5DQ9B 4HCRL 4MJIE 4XVUC 4UQ3A 1NLBL 3DPBB 4NHCL 3GNMH 3MCLH 1EHAA 2UY6A 1JMZA 4G5ZL 2O5XL 4ZOBA 3UTSD 2EAEA 3WIFA 5IV2B 3K6NA 4K3JH 4KK9C 4BM7A 4BSWA 3LN5B 4Y19A 3CG8A 3HC4H 4WEMB 5A2BA 1TETL 2PP7A 4UQ3B 4Z3GA 1INQA 1CDIA 2EH7L 2I07B 2UY6B 4XWGH 2WTOA 2EXWD 3DBSA 1JCVA 4NKMA 3WIFB 3W0WB 2BW4A 4WY7L 3NQKA 4FHBD 3V95A 2ODHA 3ROOA 1F4WH 4BSWB 4YS4A 4PP1C 5D2LF 5EBWA 2RHEA 4XP6L 4BZ1A 4DN4H 3FQ2A 2O6PA 2WV3A 1MLBB 3UYPA 2AEOA 1JZDC 1LK2A 4NWTL 1INQB 3E2HC 5KVFL 2W80C 3LKPA 1ZK5A 5K1VA 1AHWB 4FQJL 2LU5A 3ROOB 3AWEA 1MCCA 1Z32X 2VL4A 2BWQA 5EBWB 1U33A 3MLPA 2VLJA 2J20A 2GUYA 2CXGA 3BVWA 4N28A 4JG0L 1VFUA 3VU2A 2AK4A 1TU2B 3UYPB 1LK2B 4GRLC 1QFWI 4MXWL 1Y6MR 1SJVA 3FNKA 3QQ9D 3V55A 1DJZA 4IRSD 1KB5A 3D12B 3LKPB 2ZZUT 3T3PB 3WDJA 3LNFA 1TFHA 1U8CA 1W0YT 4DUXA 1AMMA 4HF5H 3V4VL 3PAZA 5DRXA 1PZ2A 4JDVA 2J43A 3DX8A 4GAAA 5DZNA 2Z7UA 1C5DA 2VLJB 3B3IA 2AJXL 3MSPA 4WUUA 2IAMD 2Y22A 5TDOA 4FYSA 2AK4B 4LLQA 1PRRA 1RULL 1AD0A 2VDKL 4NQED 5CUSL 3T6QC 3BQUD 1AFVH 4FN0A 3QCUL 4PJGF 4F8LA 2J12B 4FFZL 1NCWH 1RLBA 2VDRH 2VUYA 2XN9A 4GSRA 4N2AA 2WQ8A 5DRXB 2XIDA 2Q8BH 2EXYD 4APXA 4JDVB 3QUGA 1T1XA 4KRPD 3SPIA 3JWDC 1C5DB 3B3IB 4WUUB 4YX2L 5TDOB 1SY6L 4KJWD 5ADOH 4AKPA 3JTBA 5IOPA 3FO0L 4QHLA 2BIIA 3IGLA 4IDLA 1S46A 1MHCB 5FGCE 4P59H 5CEYA 5C0BE 1RZJH 5D5MF 1FC1A 1GCYA 1TZHB 3DMMA 2C4FT 3L3GA 5C0GA 4M48L 2XN9B 1JSYA 4BGLA 3IRCA 2QADD 4M7LT 5B38B 2UX6A 1T1XB 2I24N 3DX4A 3CQQA 3R0NA 1D5XA 3DA0A 3WFBH 1CFVL 3EFDL 4KX8A 2L7UA 1IV8A 8FABB 4GUPB 5KBNC 2J1KA 2AV1A 5CEYB 2Z0UA 3T2OA 1ODUA 2QGDA 4OLZH 2DLFL 3KM2A 2HTLD 3DMMB 2HT4C 3L3GB 5FM8A 5F9AC 2KP5A 5C0GB 4HMCA 1KIPA 1EHLL 1FNFA 4HLZG 2DWEA 4EN3A 3VXUA 4ZG1A 1GYCA 1OPGH 1PLGL 4YSOA 1D5XB 5M95B 2V33A 1GPOL 1S9VA 1TIUA 2VQUA 2VAAA 3FT4A 1A6WL 3HUJA 3VMNA 2EE3A 2AV1B 1T7XA 3ZGHA 3HNSL 4HAFA 5F96L 2HVBA 1IBZA 2VDNH 4GQ9L 3X1EA 1KIPB 1CLVA 2O6EA 3ESVF 2DWEB 4N87A 4J3OG 4YDIL 4EN3B 5EF3A 3VXUB 4IRJA 2VDMB 3PXJA 4HCRA 1IC4L 4RZKA 1A6ZA 1S9VB 3NCFB 1CK0L 3US0A 3ASWA 3SNZA 2VAAB 1EXHA 3NP3A 4R3SA 1AG4A 3GSRA 5FWRA 2F18A 4KROB 2BVEA 3VFWA 3CFTA 1AGDB 3OAYK 3FO1A 1J1PL 1A45A 1R3KA 1TYRA 5D9SA 2IXQA 5SWQA 1OGAE 4S0SD 4HOXA 4N20A 2NR6D 1M4KA 4BZYA 2XPGA 3H9HB 3GSRB 2E9BA 3VFWB 2MHAA 2YKLL 1QSEE 5FM5M 3ZE1E 1LE9A 2V3EA 2JJSC 1F90L 1BCIA 3SYQA 4HXAH 4YWGL 1R3KB 2CBMA 5D9SB 3VXME 4OIIL 2IXQB 3HR5A 2A73A 1QG3A 2A77H 5SWQB 4ZXBC 1LEGA 4P0DA 3UL4A 3TBWB 5DVMA 1K9TA 3EDDA 3QI9B 1MFBL 4UOZA 2XPGB 3CUPA 4PJIE 1CGVA 4AITA 2MHAB 4OBRA 1FORL 3IDGA 1P5UA 1RL1A 4HFUL 3SO5A 3TP4A 3KH4A 3A67L 3TTYA 4LEXH 1TZAA 5TGBA 4E41E 2QHRL 3HR5B 2A73B 5LHDA 2YPKA 1LEGB 3SYCA 4EKXA 5D7KD 1JXDA 4P23B 3GZPA 1XCQA 3OD3A 4W9ZA 3DNKA 3DDGA 4GRWB 4Z23A 3CUPB 4A04A 3P54A 3V4VA 3CPUA 3KGRA 4TVUA 4ODVL 1JK9A 3IDGB 3CCHA 1P5UB 4I0CC 1S7WA 4ACPA 1T4WA 1KEMH 1CI3M 2GBAA 1XSKA 1M42A 1MVUA 3LIZH 1CXIA 1H3XA 5TGBB 2B5IB 4CRPA 2C3XA 5E6SB 4KQ3H 5FOBA 3L5XL 2YPKB 2CMRL 3KD4A 1I85A 4LLMB 1NLDL 3HLAA 3K2UL 4HFWA 3BO8A 5F97E 5F70A 3NIDB 3V4VB 1CTMA 3BCFA 4AEHH 4IIZA 4TPRH 1QATA 3CCHB 1JXJA 2WGNB 1S7WB 3HA0A 2XTSA 2HFTA 4WHCA 3Q44A 1J9RA 1SY6A 1MVUB 2YPLD 3UAJC 4I5BA 3MA7A 2A9NL 2VDKB 4FTVE 4EEEA 2OL3L 4WFGD 4X4YB 2Z4QA 1BOGA 4WF7A 3HLAB 4HFWB 3A6BL 3CLEH 4OJYA 1KPRA 1SDYA 2DQTH 5DFVC 1H0DA 5TDNA 3GXNA 1HFUA 4J27A 3RRQA 3U0WH 4W6WB 5C0JA 1MCJA 4QTIL 4OGXH 1RPUA 2MIZA 4K8RL 1WAAE 2R56L 3MA7B 4LGSB 4AGOA 3B2UD 3N0AA 4I13B 1DVXA 2JKJA 4NEHB 5D7JA 4DO5A 3TJEH 1ZAGA 2Z4QB 3WHE0 4PG9B 1EDYA 1NFDB 4X98A 2DQUL 3PJLA 2IDTA 2BDNL 4RQQA 1QRNA 1H0DB 5TDNB 3S48A 1TYEB 3L3JA 3WXVH 5C0JB 5CFHA 4FQXD 2VR6A 2WWMD 2CR6A 3O6LH 3MUGA 3O2DA 1UQSB 2FJGA 5EZOH 3QXWA 4CMHB 4LSTH 5EN2A 5JXED 4RFNB 7FABH 3FFDB 5JW5B 1KIQA 4PLKC 5IP4A 1BGXL 3EYQC 3VJ6A 4RQQB 1G7PA 1QRNB 4MMXA 2BHUA 2HP4A 4NJ9H 1UURA 1CR9L 1XT5A 3V6OA 1TXKA 4ODHH 1U42A 3D3VA 3PS6A 3ZTNL 1ZA3A 3MUGB 3VFVA 4LIQH 4ZUSA 4KY1H 5FCUH 1AMYA 3B1TA 4MB4A 1BX2A 3JVGA 5EN2B 4IDJH 4GT0A 4K9EH 1OPOA 3EF7A 1F3DJ 4GNKB 4YXHL 4JFDA 1Z9MA 4BFFA 3B9KD 3RTQC 3VJ6B 1G7PB 2AQ1A 1Y0LA 4HC1H 4PVMA 3OJDA 3FTZA 1ZT1A 3IJEA 1W6WA 5L0QC 3RHWK 4NPYA 3D3VB 5LBGA 5I75B 2IDUA 3FUMA 1ZA3B 3LB6D 4ZUSB 1U93A 3FRUA 3TWCH 2KC0A 3ECBA 3VFVB 1N70A 5I6MA 1ZKAA 4M43L 1UCTA 4IBQA 4FQIH 4X5QA 3NCYP 1BX2B 1BD2E 4QRRD 4NQSA 5D1XD 2YXWA 1MJ7L 4RBPH 4JFDB 3G5YA 1A9EA 3ESOA 4PRAA 4JKPL 1N8OE 1Y0LB 3ZR5A 4F5CE 4NLAA 2NY1C 1WDAA 4HOMA 1JZ3A 1YECH 1ZT1B 3HPLA 2VMJA 2MPAH 4PRHA 2ALAA 4LRIA 3FUDA 1JN6A 1JTPA 3FRUB 1YC7A 1KJ3H 5EF1A 5IJKC 1IBGH 5MEOA 1KBGL 5DD0H 4YSDA 4JW3A 3FKUS 4K7PL 5DUML 1QLEH 1T7WA 3G5YB 1A9EB 1DVYA 4PRAB 3ZL4H 3RDTA 1L9QA 3ILEA 5AKRA 5ISZA 5ICZA 3I6SA 4MMYA 3IDNA 3HPLB 5IVXB 3FAXA 3N43B 2EKSB 1OE3A 4PRHB 4LVEA 3WTXA 1E43A 1JN6B 3R18A 3UROR 4X4XA 5AVYB 1MCWM 3G6JA 4RRPA 5I5IA 5MEOB 1G5GA 1NBYA 2WYTA 3LQAC 2XWCA 4A2DA 4QHUA 4IIQC 5J0BA 3AWGA 2DLTA 1NCDH 1KBBA 3HG1D 5LGJA 3RDTB 5C2BL 1IUZA 4J12A 1EJ8A 5ISZB 3ZKMD 1QFWL 3GKWL 4QOKE 1WRFA 3LNEA 2X0WA 2DLIA 3BP4B 2V9TA 2APFA 2HXAA 1ANUA 2Q5BA 3D09A 1NL0L 1YZZA 3OKEB 4X4XB 4DGIL 2AXHA 3G6JB 1NBYB 2LT9A 3NJKA 3CQFA 4FZ8H 1ASOA 5AW0B 2NTFA 3BDYL 3HUJF 4N0FA 2DJ4A 2GJ6E 3VMOA 4JRWA 2XY2A 3BRGC 1N18A 3X3GH 1QNZH 2YMOA 4MVBC 1A4KA 2ZXBA 1SHMA 2GYSA 1CDGA 1A4JA 1LD9B 3ZTCC 3K1DA 5DFAA 1KNOA 2LVCA 5LN4A 5ABDE 1ZV2A 4OF5A 3ILQC 2Q8AH 1CQYA 2VLRD 3GS4A 3MJ6A 2NTFB 2WK2A 4N0FB 2C1OA 2X3CA 4PS4L 3SBWA 1AZNA 4PW4A 3WAKA 4G8GA 1A4KB 1RIUH 4JVPA 4PI0A 5EUOB 1A4JB 3T8XA 5E24E 2HX7A 5ACMA 1ES0B 4G6FB 1JHLH 3UFIA 1P84J 5KVEH 2VR8A 1KNOB 1O7VA 1T20A 4XZUB 1F6AA 1I3GH 2IBZX 4AMKL 4GS7B 2EVIA 1BZ9A 2YPVA 1S6NA 5BUGA 1PZDA 4FG0A 5DVOA 2C1OB 2Z31A 1IGJA 5ITBH 1KEGH 4TNWK 4QYOA 4DGYH 5AG9A 4MCMA 4G8GB 4TQEH 3T8XB 1IVTA 2EUXA 2EADA 4ZMYA 3T3ME 3RIAK 3CFEA 3T0VA 4O5LH 1F6AB 3VYNA 1ETB1 3IBOA 3OHMB 2FTAA 4NQCE 4H1LH 3TL5A 3A6CH 1RJLA 1WK0A 5EDSA 4KRLB 1FIEA 4ICWA 5CGYC 3TNMB 3JBG7 1VADB 2Z31B 4GRWF 1IGJB 3SDAD 4MZRA 1DBJH 4MAUL 1TJIH 2Y7OA 3UC0L 4QYOB 3UDWC 2GTZB 2ZKYA 2BNQE 3IAPA 1CGWA 1OD9A 4MSWA 4P48A 3T2PA 1N67A 5I71C 1JTOA 1TENA 4XNUH 1HHIB 1EK3A 5IROD 3CFEB 1MCIA 3NDYE 4APQC 5BUPA 4UDUA 5AOJA 3WSQH 3DO7B 4MJ5A 2J6WA 1G9ML 1YAIA 3HMWL 4G71B 1Z9OA 2R4SH 4JJHA 4R4FH 1SYSA 3MRPA 4RZCA 2E6QA 2VWEC 5C07A 3V8OA 3FCBA 3KM1A 1O5DT 1A6UH 3JV4A 4XT1C 2NDFA 32C2B 4MSWB 4AQZA 2XZAH 4U7MA 3GPSA 2BFVL 2DBJA 1E2WA 1N9PA 1T83C 3BUPA 4IJ3B 4UDUB 4EIBA 5A40E 3BKJL 2VUKA 3ASOB 5JR1L 2D3LA 1W8NA 5CM1A 1SYSB 3QWQB 3RX9A 3MRPB 1LE5A 4XE0A 4RZCB 5C07B 5F1IA 1M71A 2OW7A 2XKSA 4LMQE 4N3UA 5GXBB 3JV4B 2IANA 1LEIA 1CFBA 3T2LA 1FLTX 4BFRA 3UACA 2ITEA 3ORJA 3R1GL 1N4XH 3Q8AA 5IREA 4XMVA 3NQIA 1UACL 3LIUA 3T09A 2VQTA 2F74A 4OIBA 3C5XA 1LE5B 5DJ0B 4G7VH 4Y4HD 5H8DA 3FU3A 2X3BA 5F1IB 1M71B 1ZLWH 3QJZA 2A6JA 3LZRA 2IANB 1LEIB 1QD0A 1KCKA 3PHSA 4L8BA 3QNXA 4YN3A 1ZS8A 4U31A 3CN2A 4BV1A 3F7LA 1IIIA 1FFPA 2P8PA 3LTVA 4HZ1A 4JFHD 5D7SL 4HIEB 3TO4C 4E36A 1OB0A 3S35H 4MJID 4KK6C 3TT1L 3MV9E 3QCVH 4Z7WE 3WXWL 5F3FA 1MFDH 1X5AA 4PJCE 1OOAA 2EDRA 4KTGA 4DGVH 3UTSB 3L3KA 4MNGA 4L8BB 2DEXX 4PWHA 3NA9H 5JOPE 4IHOA 3ZE2E 4UYPA 1LWJA 5A3IC 3QIWA 4AG4H 1PZAA 1KB9J 4YDJB 5E5RB 1WIOA 3ZIMA 3IFLH 4PRIA 2XIBA 4FQQA 3O6FC 5GJSH 3IAJA 4UQIM 1BXXA 1TR7A 3S34L 2R27A 2F53E 2F1AA 4AYBA 2M83A 1UVQA 2YD8A 1CGTA 4IHOB 4GMSL 1R0AH 3QG7L 3BFQG 4YHKL 1FE8H 5AW7B 1VHPA 1V8HA 3MRFA 4AQ1C 2ZX5A 4I9WE 4NC2B 2DMKA 5CIPB 5FKAA 4F3FA 1X9QA <