1YHPA

Solution structure of ca2+-free ddcad-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
212
structure length
212
Chain Sequence
b'SVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent cell adhesion molecule-1
molecule tags Cell adhesion
source organism Dictyostelium discoideum
publication title Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion
pubmed doi rcsb
total genus 33
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08964 Crystall_3 Beta/Gamma crystallin
A PF14564 Membrane_bind Membrane binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.20.10 Mainly Beta Sandwich Gamma-B Crystallin; domain 1 Crystallins 1yhpA01
2.60.40.1720 Mainly Beta Sandwich Immunoglobulin-like Calcium-dependent cell adhesion molecule-1 1yhpA02
2K1WA 5HT9A 1YHPA 4PSRA 3SO1A 1E7NA 2JDGA 4GCRA 4IAUA 2DADA 4NI3A 4EL6A 3HZ2A 3ENTA 1ELPA 1HDFA 1ZWOA 1GAMA 2JDFA 1DSLA 1OKIA 2BV2A 3SNYA 3SO0A 1A7HA 1YTQA 4W9BA 1PRSA 2B1OA 5HT8A 2NBRA 4W9AA 1AG4A 1PRRA 1GCSA 2K1XA 1HA4A 3LWKA 1ZWMA 2BB2A 1BLBA 2M3UA 3QK3A 4PSPA 1AMMA 1HK0X 1ZIEA 1M8UA 2G98A 2A5MA 4GR7A 1I5IA 1ZIRA 2KFBA 3ENUA 1A45A 3I9HA 1ZGTA 1NPSA 1H4AX 1BD7A 4FD9A 2V2UA 4JGFA 3HZBA 1A5DA 2M3CA 2M3TA 3CW3A 4AKAA 3SNZA 3IAJA 1ZIQA 2KP5A
chains in the Genus database with same CATH superfamily
1NGYB 3D3VD 4WFFD 2CSPA 2BP8A 2NQCA 4QRQA 2HSIA 2YARA 2EIZB 4YHZL 3A23A 3UJJH 5KVEH 4TOYH 1I7UA 3SKUD 2CU9A 4LKXA 3NSCA 5CZKA 5L7XL 4LNRA 5JIHA 1T6BX 4JN2B 4ELME 5MHSD 3AGVA 4JL1A 4KX9A 2AXGA 1P7QA 3UBXG 2APXA 3S3DB 3M7FB 5IQ7H 4TVSa 4RFEB 1SZNA 2ZWKA 3NSJA 1S8DB 1E2ZA 1FC2D 1G6VK 3NEXA 5GQBA 2BDNH 3JV6A 2NY4B 3NMEA 3QIWA 4JQIL 1KY7A 2VZVA 4PJXF 3CQFA 3QW9A 2H8PB 3CFCL 4MCZB 4PRDB 4AC4A 1JPTH 3K1DA 3KBEA 2DF3A 4KMTL 2QMJA 1J8SA 2QZ5A 3MBWA 4LGRB 1F11A 4PVLA 4K5MA 4PREB 4N6RA 4X6EA 4PJ5E 4H25A 2N3JA 1XGTA 3MPCA 3L95A 5D70H 3DOSB 1RLWA 1TCMA 4N2MA 4GO8A 3V7AG 2VSMB 3KHOA 2UXTA 3A4DA 2VLRD 1LJMA 5I1LA 5A2FA 3KPNB 3APNA 1ZK9A 5K9QG 4DK3A 2V5MA 3BQUA 4U1LA 2QKIA 3EO9L 3HFML 3X13A 5JW3H 2XN9A 4V1DD 1IAIM 3FCBA 4DOHB 1PF3A 3FB7A 2EUZA 3D4CA 1CI3M 2P8MB 3EH2A 4EEEA 3QE5A 2W9DH 5I1DB 4KKAD 2QADD 2UWEF 3PHQB 3RG1C 2QGEA 4JO2L 2LV4A 4RFNC 4QRTB 2AK4A 1ZLWK 3T3PB 3CDZA 3LN5B 2M3TA 1IGML 2IANA 4XT1C 3GYRA 4L4VB 5HI4D 4HQQL 3AFLA 1S46A 5EORL 4MNGE 3JWOC 3NCCB 4KXCA 3BVUA 4G5ZL 5EBMB 2X4QB 1ROWA 4P57A 4GEIA 3KBHE 3RJDA 3U4EA 4DKEH 3S37H 4M7ZC 4XCFH 3SOTA 3G6JB 2XC8A 4QTFA 1ZANL 4XVUC 2WSKA 1MCJA 4FFYL 4N0FA 2IAAC 4XOEA 4ISVA 5F9JA 2E6JA 1KGUA 2X28A 3ECVA 3DX0A 4KRNA 3UPAA 3MYJA 3MRIA 1B0RB 1CXHA 1TT6A 4R9HA 3K81A 4DP5X 3AB0B 4XC1L 2JVUA 5GZNC 1CLOL 4A2EA 3BP5B 2CQVA 4B9ZA 1RHFA 3RTLA 1EEZB 3QFGA 2UYLA 2Y2TA 5F70A 2NY5C 4KAQH 5BV7L 5FYJL 5F72S 1KGIA 3QJHB 2V9RA 4XNQB 4OZIB 4ZSOA 4K8RC 1W72B 4KXZH 3EYOB 4DEPB 1BX2A 5E8OB 1P2CB 2AQ1A 3WNOA 4OLYH 2OR7A 3H3BC 4B5EA 4YHLL 1I8KB 1HEHC 1U8NA 4FQ1L 4IJ3B 4PIBA 4YSPA 4MCYA 3MO1A 3OM3B 4PJXB 2H1PH 2ETWA 5TE4L 2YS4A 3X13B 2IQ9H 1UUNA 4WIQA 4OT1H 2Y1VA 3VXMA 2HA1A 2VN7A 3BFWA 1OM3L 1UZ8B 1LEIA 3DGCR 4P2OB 4JFQA 3MBXL 4F7TA 1GYWA 1S6NA 2VR6A 3M1OA 4PY8J 3D09A 1YJDC 4N87A 4Q2ZA 5LCVL 3CFCH 5C0DB 4JY4A 2A1WH 1MAML 4UM9D 4FXTA 1KV7A 2ZPKH 4PB9H 4QRFA 4S10A 2HT2C 4ZD3H 1BFOA 4Z3HA 1SEQL 4M7LH 3MRJB 1Z0MA 3RVWC 3FO2A 2C1OB 3FQ4A 2WLNA 1QA9A 2ZUUA 1NAMB 4LZKA 4ABUA 3ZYOA 4AEHH 4CVZB 5IMOA 2OV0A 2KYIA 2ADFH 1G6RA 1DQDL 2NT0A 1YUHB 2BSTB 5HYQB 5C0AD 4ATWA 2CAKA 1MHPH 4AE0A 4WO4B 5DC2A 4W9BA 2J5LC 1E3ZA 1SHMA 2NNCA 1TJHH 4TULL 5CLTA 5CEZD 2BIIA 3TYFA 4F2MB 2FUTA 5L9DH 5KSAC 5I1EH 1G9MC 2Y25A 2DQHH 1ASOA 4M1CD 3CPUA 5FA4A 4WW2F 3L3DA 4FQQB 1HI6B 2EXWC 3P4MA 5F7BA 3T4YA 1PLCA 4YQXL 4QWWD 1OCCB 4FTVB 5ANHA 1AO7D 1G7MB 2W9LA 2XA8H 3IETA 3OR6A 4HJGA 3DUUA 1OGAB 3BEVA 4JG9A 2PO6B 3NA9L 4P8QA 4X4XA 5DVMA 1UD3A 5LNDA 4XPHL 2QQLH 3QIUB 3FUJA 3OJMB 4ODSH 1ZLSL 2Z64C 4ZFZA 3FHEA 2D7QA 2UX7A 2AJ3A 4M61B 5FIEA 2WWOA 2WLHA 2BSCA 3BAEH 4IEFA 1PS3A 1W91A 2DQIH 3QO0A 3IN2A 2YQGA 1K8DA 1YEHH 1UH4A 2DM7A 2ZXQA 3O6KL 2VWEC 1WIOA 3GJFB 1G7PB 3QA3B 4Q89A 2ZF9A 5KSUA 5E4AA 5ETUA 3KCPA 2YO3A 4Q9RH 5D4JA 3E0GA 3DO7B 3KM1A 4HWZA 4X2UA 2YQ3A 3I2CL 1MG2C 5JIPA 1AC0A 5C0JB 4TNWK 2X3AA 3L3GA 1VACB 3MUUA 3PWNB 1WWBX 2QT6A 1J9RA 3DHMA 4KK9C 1JXKA 3HI6L 5IMOB 1D5RA 4XXWC 1JYXA 5DQJB 1P4LB 1D5MA 4N28A 4F9LC 3KPSA 2CRZA 1O9VA 3VFGH 1AI1L 1DJWA 3HI5H 1U95A 3ZR5A 1WWCA 2HVKB 3TBYB 1UATA 3U0PB 3IDMB 3GI9H 5D7IB 2IPKA 1EO8H 5HJ3A 5EG6C 4PJ7A 4G7VH 2YZ8A 4EUPH 3V4PA 1I7TB 2XZCL 2ZUYA 3F85A 2OR9H 4Q2ZB 4FXKA 3BLKA 4QRUA 2Y7LA 5D7LD 2CJUL 5A7BA 4X0KB 1AOZA 4UQ3B 4JREC 4DERA 5IBUG 3OG6B 1QSFD 4R5TA 3N1MC 2DLFH 4R8WH 4MWFB 3TONA 2Q8AH 2BNRA 1EVTC 4M1CC 4D94A 3MRNB 2YBRA 1W0WA 3P3TA 5CINL 4LIQH 1ETZB 3LMJL 2CLZB 3T3PF 4D9QD 2HFFB 1C16A 2GPZA 1JXDA 4ZDHA 35C8H 1VESA 3GMQB 32C2B 2NCMA 3HS8A 1YC8A 5HI5D 1JWUB 1TZIA 1IILE 1TENA 4LLMA 1NJ9B 2PW2A 3RFZC 1EZVY 3CFEB 5AG8A 1WKTA 3GDCA 3GNML 4FDWA 2F8XC 1OM9A 1I7ZB 2R0KL 2XRAH 1AIFA 2FYYB 5FX3A 1G7QA 4YUEL 1AS6A 2DQDH 1RLBA 3RWJB 1DQDH 1NGZB 4HCFA 1MFDL 3C5SB 5G5DA 2WYHA 4YDIH 2XWTA 4PLKC 1IM9B 3D52A 2YMXL 1L0XA 3HZMA 1U8CA 1PZDA 1TJHL 3TTSA 2GIMA 4ISVB 4NKIL 4U1MA 3IF1A 2EIDA 5ICXA 1NCBL 3HMWL 2GAZA 2WVUA 1OALA 4WI0A 3GXIA 2FK9A 5AW1B 3HEIB 1AD0A 4R26L 3U46A 4P57B 4XGZB 2UZYB 2X9ZA 5CCJA 4JY5L 5AW8B 3EOTL 5ESVB 2ZSWB 5TQ0L 2YXWA 5IVXF 1MVFA 4XBMA 4NHCH 1P84J 1G7IA 3ROLB 4P06A 3SBPA 4N2LA 4E9SA 3TJPA 4HS6B 5DZAA 1TQUA 4Y7MA 5AW7B 4M03A 1N10A 1DQIA 3LIUA 2XJKA 4G2AA 4MB4A 3ULVD 4PRBA 4IBTA 1LTXA 4W9LC 1UXWA 3B1TA 1YEKH 3JWDC 4N85A 3RWGA 5D2NC 2JI1A 2JTYA 3KJ4B 5HD8C 1KEGL 2FEEL 5JIIA 2YPVL 3ORJA 4ZZFA 5I0XA 1P7KA 5HDOA 4S0TD 1TETL 4MA3B 3T3MF 3N43B 5D2LB 4S1SL 4NX0A 2DTML 1SYVA 1RCYA 3F05A 2IH8A 1KB5A 3AG1B 5KVFL 1FBIL 3JWNG 1XGUA 1T1YA 4JG1L 1ZXQA 4ONHA 1EO8L 2X4RA 4YBLB 1CD8A 3D69A 4W70A 4F93B 1QBAA 2CLZA 3NT0A 5C7XH 4WUKL 2XLLA 4EIZC 1EGJL 2M83A 4CU8A 1F4WL 1JMZA 1FSKC 2B15A 3OJDB 5CIPA 1GKEA 3W5NA 4KMTH 1D9KB 1FGNH 4L1DA 3WS6A 4Q4IA 2WTRA 2EILB 2EDRA 4JG5A 4NJ9H 5IM7B 1E40A 2GB2A 3DX9A 5GHWL 3TO4A 3MJ6A 2NY3D 4XBEL 4PJCB 1FA4A 4LIQL 3RX8A 1EAPB 3BZ4B 3HHMA 1T5XB 3IU4L 3KPOB 3SDDB 8CGTA 2BY0A 3FQ2A 4WKZB 2ZX5A 4PD4K 1BEXA 3EFDH 5F1KC 2AC0A 4H40A 1O9WA 3EO9H 4KK6C 5IHHA 5E08H 3BN9C 4NGHH 1XTMA 4NZFA 3PDOB 1FDLL 2BXZA 4GH7B 1J9SA 1WBXA 2OCJA 2R27A 3D2UA 1RP9A 2VW4A 2CCVA 4F8NA 1OP9A 3IMTA 2AV7A 2VDQL 1OAJA 4JLRB 1T89C 5AZUA 1M42A 3C12A 4IRZL 5EZOH 4AC2A 2XSKA 4Z7UA 4GXVH 4C4BA 4U6HB 5DVOA 1KLGB 2GHZA 2Q6WB 1U8KB 4V33A 2C9QA 2OI9B 4GKOA 2PP8A 1CG9B 1CZ8L 4NZUL 4QGYA 2GYSA 4HVBA 3QI9C 3AMLA 1S3RA 2DM4A 3MJGX 4PWGA 3SIKA 1PLBA 1QSFE 4DKEL 3MYZA 1R5IA 2EYRA 4HJGB 3UGEA 3FTSA 1OF2A 4FFYH 3BUQA 4DK6A 1FL5B 2IOMA 3MBEC 3S7GA 4RMBA 3UDWC 3UCQA 1NMAL 3NN8A 2BNQD 1LEGA 1JF5A 1U8MA 3CSGA 3MJ9H 3NACL 2P52A 1GL4B 1YNKL 2A83A 2VXQH 4IIQC 2GSMB 4LOUD 2CRIA 4F7KA 2O30A 3ROLA 1SLVA 4LCVA 4OLEA 3U83A 5SX5H 3IS0X 2FD6L 3ESPA 1O5PA 2QSTA 4NNYA 4J7RA 3F7RA 3N43F 2E7HA 4K94H 5E9DB 3GFUA 2FATH 3MV7B 4PB0L 2VL5A 2GTZA 1P5UA 2SODB 4ZZKA 4PJGE 1F41A 5IB1A 3RVUD 2R8SL 1UZ6E 2EVFA 1J9TA 4FOMA 2X4OA 1MFVA 4AWJC 2YAOA 1NDMB 4OUUA 1ZDQA 2XFXA 3UAJC 1ACCA 1NCAH 4LBAA 4GSDH 4NZTL 4PJFE 3MNZA 4EPSA 5DC9B 4BZ1L 4YDNA 1WICA 3V5KB 3ZMRA 1FL6B 1KLUA 1ZIBA 4Z95H 4I0PC 5MHSE 5EZIL 2AW2A 5J6GB 2BWIA 4MX7A 3FTGB 4AQ1B 3D50A 1FNGA 4E9YA 1RH8A 3PJSA 2C3VA 1GJUA 4MXVF 3UL4A 3FMGL 3ARZA 2KQMA 1E4WL 1D6VH 3ECBA 3RWFA 2HTKC 1NSNL 3E6FA 3GHBL 2MCG1 3GK8L 2W65B 2XN0A 3EO1A 3MXVL 4GMSH 2OSWA 4N5UA 3MRQB 5FKAB 4KKCD 3QHTC 3OMAB 3DSNA 5F1IB 1UYWH 2E7LC 3NIFF 1PZBA 4FZ8H 2Y5EA 3OR7B 3T0AA 1EAPA 2RAMA 4RQQA 5MEPB 1I8KA 4YGVB 4WWKD 4X83A 3UAAA 2UZXB 1KFGA 5FECB 1PX8A 3ZTCC 1VZHA 3HZVA 5B7MA 1BDYA 3AQZA 3LEXA 2VDPH 1IGCH 4GI6A 2Z7YA 4AT6A 4IBWA 2RFXB 4BD4A 3DKHA 1ECYA 4PJBF 5HDRA 4OTXH 4QHLB 1XF4A 4XWOC 3V0HA 3ARPA 3HS9A 3IU3A 4ILDA 4O00A 5HHOA 4MSWB 4NPJA 3MA7B 1DR9A 3FU8A 2GABA 3LKQA 5BS0A 3KYOA 3Q5TA 4BINA 1GYVA 3D7PA 1TOXA 3B43A 1I3VA 1GJWA 1HA4A 2VDNB 3QXAB 4XXWA 3ZDYE 1BAWA 1GOHA 1FNHA 4ZO6A 2ICEC 2AJSL 5EC2A 5FYKE 2OK0H 5EA0H 4FD9A 5TTRA 2CHZA 2F7RA 1X3DA 4BGDA 4GLRH 2DQTL 2NLJA 5TDPA 4R3SA 1DVTA 3FTUA 3S5LG 3GS7A 3V0GA 1ZY9A 1JRHH 3QG7L 4L9LB 4GMTL 3V6ZA 4XNYH 2BIQA 2C3XA 3DO7A 2Z9TA 2ESVD 4JMXA 4XNZB 2A9DA 2X89A 1KGYE 1A5FL 1R3HA 5KBMA 3V4PH 1CF1A 4QRTA 4RH4A 5DK3A 2N0MA 1HHJA 4X6DA 1U93B 2IFGA 3STZB 2G2PA 1X5YA 3REVB 2HN7B 1QBML 4U4IA 2ED8A 4H26B 4EOWL 1B6DA 3FYEB 3ZW3A 3BE1L 4NT6A 5C0RL 1W2KT 2DYPA 4LAQH 2ADIA 3CN1A 3IVKB 3MUGB 4NNPH 1U8IA 3ZHNA 3ZT5A 1X9LA 4AQZA 1YEWA 5A3IC 4WI2A 4FQJL 2Q5BA 3JQOB 1E4KC 1OXYA 3KPNA 1AZRA 1JJUA 4IJ3C 5C6WH 3MRBA 2BCKA 3OKDB 2CIIA 4JRWA 5GRJH 3BHBA 4L37A 4BKLA 4RRPM 4PJ8B 3L6FB 4A2HA 5K33A 4MZRA 4NWUH 3O0RL 2BCMA 1ZSHA 5E8NA 2VW6A 5LUMA 1UFGA 1JXGA 2MPVA 3QJTB 4CU7A 5J06A 4N86A 2YGVA 1U8JB 2V3FA 3JUZA 2DH2A 3L5XH 4KH2A 1GZPA 2BJMH 5BZWA 1AQDB 1J8HB 5IVXB 2AHIA 2XPYA 3DJRA 4XVTH 4N2IA 4L3CB 1RJLA 3K5SA 2VDRH 3L4XA 3TH3T 5MEOA 2FGZA 2GY7B 4LCIH 2Z34A 2H45A 3N5AA 5FA3B 1L9RA 1A9EB 1AQKL 3NP4A 3PQYA 1A22B 1NGPH 4JFYA 3D1MC 4GMSL 1HQRB 3IYLW 3OX8B 5D1QB 3LJ3A 3ZRFC 4J4PD 4M48L 5F7KC 3VNYA 4FQHB 4ODHL 1R75A 4TPRL 1WZMA 2NMSA 2GBAA 4BRJA 3AVEA 1WFOA 5EOQH 1XGZA 2IXQB 3MBEA 4F58L 3SJVE 3ZE1B 3S96B 1MFDH 2BP8B 2XVLA 2QKSA 1CTNA 2YPLE 3Q2VA 3FOMA 4JJ5B 4UQ3A 3LIZL 3NIDE 1WP6A 3GJFH 3V4PB 1MF2L 3ZO0A 3N85L 4HAGA 2HLAB 2WP3O 1ZHNB 4U31A 4LARH 4WNQB 5E2VH 4P2CG 1BD2E 4URTB 4QAMB 1A6WH 3CFBA 3QIUD 5K1VA 3EAKA 4W9JC 3HG1A 4HP5A 2PO6D 1KMGA 1GGCL 3CTTA 1ORSB 5EA0L 1E9QB 3FQTB 3CLFH 1JGEA 3MLZH 1GW6A 3DVGB 5F7EH 1A7OL 2ENSA 2VERN 2O5YH 3FSVA 3K7UA 3MQIA 4UQDA 3WXWL 4HPHA 1D5IL 4JZNA 2NY1C 2AXFB 3VRLE 2WLIA 2M26A 3F6LA 1P4IL 3GIZH 4L3ED 4NP4L 2WQ8A 3H7BA 3N6YA 3QJRB 3VFTA 5IOPB 1PJWA 1JZ6A 3BN9D 1H3XA 3LPWA 5HPOA 4HT1H 5DS8B 1PFCA 4M8QA 2WLJA 1NUFA 3CHRA 3ZMNA 4ETYA 4BBWA 2ORBH 5C86A 2OTUB 2ZWYA 5F71A 2H6OA 3HB3D 4JHAH 1X5GA 2WAQA 4H5SB 4N0CD 4YHIA 7FABL 4PLNC 4QCIB 4GG6A 1HKLL 4HLJA 1XH3B 5I1GH 1U8OA 5DJXA 2PO6A 2K8QA 2K7QA 1DBJH 3C75A 4XOCA 3C08H 1WG3A 3CCHB 1N8ZB 3L3IB 4OZFA 3SZ6A 1GSMA 3QAQA 4N8VG 3NCBB 5KVFH 4XB7A 1NAKL 3P4MB 4JEGB 5CSZB 3T4YB 4P23A 4PW4A 5FCSH 2P9RA 2N1KA 4XNZC 2HFGH 2F9BT 2QJDA 3ZDYB 1AAJA 1KN4L 3SSGA 1PZUB 1WBZA 2X4PA 4G6AC 5AENA 3MRLB 4FNLL 1PSKL 2BHFA 2CCLA 3SGJA 3QQ4B 4XPGL 4ZUUA 4OV5B 1QW9A 1XB3A 3VNZA 1P9MC 2OLDA 2WN3A 4JFDB 4ZW3A 3WAKA 4ACTA 4CC1A 3O9WD 1RMFH 4RBPK 4OJFH 1SBSL 4V2BA 5MI0C 2FT6A 2FLRT 3ROOB 4WCYL 1M56B 4ODTH 3FH5A 4RFOL 1E9PB 1OLZA 5E94A 1R4XA 2LHAA 1J9QA 2EQDA 5A2BA 2ESVE 5CZVL 3MRRB 2JXMA 3HNSL 3WS3B 4QYOA 1AVAA 2BFGA 1SXBA 5DEFB 3O4OC 1W0YT 1MEXH 3S8GB 4MHHI 2WCSA 4ODWA 4WJG3 3L6FA 1NDGA 3HCVB 4KZDH 4GO9A 1ACXA 1Q94B 2QSCH 3TX4A 3PAYA 4JM2D 2IMNA 4IOIA 2QELA 3GMMB 4DFIA 1JXFA 3K8MA 3WXVH 3QK0A 4F58H 5I5JA 4UB0H 1MHPL 1EWHA 4AZ8B 4H13C 2QPEB 4HPOL 3RURA 4P2RE 2G4GA 3HE6A 4QWWC 1U8NB 4LARL 2HG5B 4FFWD 4EN3C 2ZX8A 4DGYH 2ZNWA 2AJXH 4YXHL 1G7HB 2EIZA 1T66C 2XPGA 2AGJL 1NL0H 3KPSE 5H94B 3PNRB 3VMPA 1XCQA 2ZT9C 5B21A 3WY4A 1U92A 3FH8A 5D1XC 4KRLB 1UQSB 2AJZA 1AGFA 1NTDA 4AK2A 4P9MH 3L1OH 4MNGB 4P23C 4P5SA 5FM5O 3VFMB 3WO4C 5E24E 3NACH 4L2YA 1WBYB 2FBRA 3BEWB 5E2UL 1IBHA 1XGPB 4P3CH 4MVBC 2ITDA 4ERSH 5BV7C 2EDWA 1KBWA 4ZUVA 5CCHE 4JK0D 3SY6A 2EE9A 2VSDA 3NJMA 2DQJH 1UB5A 2H9GB 2EVGA 2GEEA 1VLXA 2DIEA 5B22A 2A6IA 4G6ML 1G1KA 1N0XH 2OZ4L 4IBVA 4YK4B 1B3IA 2CLRA 3FT9A 4XRCB 1SOSA 4C4UA 4XTRC 2J71A 4YZFF 4GPVA 4F7PB 4MSWA 1PPIA 2E9WA 1BQLH 3MV9D 1YYML 3VFUB 1K5WA 2FJHB 2JJVA 3PXHA 4Z5RB 3U7WH 3JTSA 2OSXA 3HR6A 1KPRB 4D2NA 4OZIE 4R5XA 1OAXH 1XF3B 4D0BB 1GIGL 4DCQB 4BZ1H 1CGXA 3L3KA 1Y0LA 3P0YL 4I3RL 4N1CA 4ODVH 2VE6A 5I1DA 2A4CA 4HFWA 4AGMA 1WQVT 2YJLA 2KFBA 3TA3D 4AVJA 3MRQA 4P2QA 1QTPA 3VXRB 1E28B 2ENPA 4IBYA 5GGSB 1ZT4B 4W6WB 3REWB 3MLXL 3KR3L 3ECBB 3RWFB 4HWBH 1T1WB 3EZJB 3OL2A 4AYFA 2FUQA 2IXQA 1XR9B 3MBEB 2WXOA 3VVVA 1BMGA 3DOSA 2EVIA 1A0QL 4IBQA 4DH2A 4NC1C 4GRWB 2PXYB 5C09E 5E00A 2OZNA 5DS1A 2VZ1A 1KIQB 4LEOA 4R7LA 3F7LA 3OX8A 5D1QA 2GJ6D 2XTJD 4AQAB 3UPRB 5EWIH 4MCZA 3ZOAA 2IV8A 1SEBA 4KJWD 4Y4HC 4LSRH 4UBDC 5HY9A 4D9LL 4Q6YA 1KFAH 2YAHA 1WS7A 3DI3B 3RVVC 3D85D 4HJIA 1J11A 1PLGL 2VLJB 4O5LL 2UY6A 3RTQC 2JKLA 4MQSB 2WZ6A 2FNBA 3SGKA 1ACYL 2R1YA 4HFWB 4OGAD 3A21A 4X5WA 4XMXA 1CN4A 3TZVA 5GS0H 3CZSA 4K8RH 4E5XA 4LU5L 3IMWA 4KQ3H 2BSRA 1RUPL 4N0YL 2PO6C 5DFAA 3WL9B 3RWCA 1Y6MR 4ADJA 4I0PB 1Q9KA 1JNHA 4CVXA 4LSTH 3TN0A 5JHDD 1UTDA 3OPUA 4XP5H 2I60H 4B9CA 2R56H 4NDMB 4B3VA 1IBFA 2NTSP 2XG4A 1AXTL 3JZYA 2P5EB 2HJKB 3VW3H 2BVPB 5FHAL 3ETBF 3QWQB 3HR5A 2CBTA 5DYFA 3BUYB 1FRGL 2Y2WA 3DO4A 2EE3A 4F37K 4Z8FH 3ZE1F 3LKNA 2HN7A 4B60A 3QNFA 1A9BB 3IM1A 4LAQL 3FQUB 1ZA6A 2GUYA 2JLPA 4Y4KA 1O7DE 4XO3A 1YUKB 4IM8A 1VSCA 1BBJA 4F9PC 4LSQL 1F58H 3WE6B 5F9WC 4G6MH 3MV8A 3VFWB 4F91B 4YHOH 1AHWA 1SUJA 3VXQB 3H54A 4S1RL 3ZKSD 1F90H 3M1BA 4PJAA 4Q4EA 5M7QA 1A8ZA 1BQKA 2P24B 2VRKA 3FB8A 5E5RB 2BVQA 2NLJB 5TDPB 3OKLB 4UTAL 1XCQB 3P4OB 5CSGA 5LG1A 3SCMA 3DX8A 3QRGL 4WSGA 1YN7B 4NZ8A 4AIOA 2HKAA 2AK4E 5IWLA 4A38A 3UO1L 2QGDA 3RGVB 5D93C 4IGBC 5H2BA 3V95A 3PYCA 5J12B 4MYWB 1T5XA 3TIDB 5B1AB 3O45B 3LKQB 4PG2A 3T77A 3X1GA 5C7XL 5ABAA 4MQTB 1MXDA 4ORGA 3RWDA 2R2EB 3FQXB 2CGYA 5D5MB 3TH2T 1NGQH 1F8TH 3O3BB 3GI8H 4A6YB 3LDBC 2B4CH 3KGUA 4WHYH 3RX5A 4YFLI 4IOIB 2FYVA 3TESA 4BFFA 5FECA 2YEZB 1S7TB 2K3TA 4KKAC 2RALA 3DGDA 4FF9A 1FO0L 2OMYA 4NN6B 2NYZA 2R0ZH 3D30A 4G80A 4YHPB 3Q9QA 1QQDA 1ZS2A 4EJ1C 3G08A 3VTTA 1DUZA 2FVNA 4ZMLA 3BH8A 1KIPA 1AY1L 5G4NA 3L3OC 5DO2C 3WUWA 4HZLA 3WMPA 1JZDC 2A99A 1HIMH 3GBDA 2C9RA 4YL4A 4GO6B 3NIGB 4JO8A 3CVBA 1MRFL 2PYEE 4PJFF 1FVEB 1FL3B 1AFVL 2DQCH 1LO0H 3JV0A 4LCCB 4KROC 4CJ0A 1X7QB 2NNRA 5DWPA 1PLGH 5F7DB 4OD2B 3S5LB 3ZKND 3SKOA 2Z92A 1M3IA 3X11A 3I3DA 3WE6A 2E7MA 1N68A 2F15A 3DSFH 4PP1D 5BQ7A 4K07A 4XH2B 1ZA6B 3E1F1 5E1IA 3E8UH 1O6TA 3GSQB 4O02A 2WZPA 2K6WA 3A47A 4KDWA 1NZRA 4HUNB 3AU1A 5F7EL 4M6OH 1UEMA 4FP8L 3VRLF 2ZIDA 4AENA 4NRZA 5AYQA 1A7QL 2H6UA 4G83A 1TJGL 2Y3NA 2V7NB 3GUFA 3I6LE 4TUOA 5DQ9A 5C0BB 3WFBH 4ELKA 1K4CB 4QRRA 5DSCB 4NO2A 2F54E 1I53A 2HJKA 3K72B 1OARL 3RB5A 1KJMB 3U6RA 4MGXA 1A65A 3C6SB 2XKSA 4GW4B 3QUMH 4ZTOH 1S9VA 2BSEA 3C6LB 4B96A 5ADOL 1PVHA 4LAJH 5GJTH 3RVTD 5GSVB 3KPLA 1DBAL 1MAKA 2QVMA 3ILEA 3N44F 4JFFD 4OCWH 2B8OT 4R83A 5DC0A 3QK3A 3V6BR 5MENB 3C5XA 4NM4L 4LEBA 5I2IA 3F65A 1U8MB 3DPBA 5SWZD 3RIFK 3P69A 1R3LB 4KDTC 2XTJE 1KG0B 2DYRB 2XV2A 5AVQB 3ZRCC 1PD6A 4DN3H 2YA0A 1CLZL 1JS4A 1SF3A 4LASH 3PWPA 3KG5A 5AL8A 1FCCA 5J3HC 3SGEI 3QCUL 2JF1A 2WZAA 1INQA 3GXNA 1S7WB 1S78C 1KLGA 4OLVL 2Q6WA 4Z7IA 1ZXKA 4WW1B 5C97A 4AQAA 2WMPB 3LQAC 4Q14A 1PDKA 3M46A 2G5BA 1KIQA 1NANH 3RPKA 4P3DB 1FPTL 2W9EL 3SYPA 4UAOC 2Q86B 2D9CA 4XAKE 3ARYA 3VYOA 1JTTA 5FO8B 4RVBA 4YPGB 3SODB 1T1WA 2A4EA 1G1OA 4JO1H 4WSJA 2R2HB 3GPEA 4JANB 5GGSA 4GSRA 4B3EA 3QFJA 4JFZL 3WY3A 3PQYE 4EVNA 2DWEB 2ICEA 1RIHH 1JI1A 2NXYC 2BY1A 2FSEB 2I7OA 4P4RA 4KVNH 3EYVB 2WSPA 3AS1A 4XOBA 4Z6AT 3FBQA 5DC4B 1QRKA 3QG6A 2EXTA 1UB6A 1O7VA 4CVUA 5DJ6B 1AZBA 1Z7JA 5MP6H 4ELMF 4EE2A 4PRAA 1JGDB 1IM9D 3ISYA 3NH7H 4GUPB 5M94B 4RX4D 4UB0L 3SKMB 2QR0A 4IS6B 5IW3A 3A6BH 1FFNB 4B9YA 5EU7E 2PMZA 4UT9H 5CJBA 1C08B 4TSBL 4Y2LA 4OQTH 4QRPB 1FH5H 3SDXB 4XO5A 3US9A 3BP7B 3P9LB 1GZPB 1BPLB 3M8OH 4JO2H 2NY6C 2X4RB 4YEFA 4LSSL 1JZ3A 1BG1A 5HDQL 3IDJB 5JOPD 1VCBC 1UXSA 2JV6A 4B7LA 3DXAE 4F8LA 4C47A 2KZWA 4RMRA 3VXUE 1C5BH 2ZP9A 4HQQH 4PQXA 2X10A 3MLTA 1SM3H 4M43L 4ZFZB 4J3SA 5D7JC 1VDGA 3RWGB 2CBQA 4KHXL 2YAPA 1ASPA 4TNWF 3MRPA 3VFSA 1GGTA 4NQSA 5K39A 4JFEA 5J56B 3V0VA 1KIRB 1UVQA 5DGRA 1PAMA 1ZE3H 3DIVA 3PL6D 1AG6A 4ZTOL 4UDTB 4IYKA 1NPUA 4YDJA 1WJ3A 3NQKA 5I76B 1ZIEA 3GC3A 1QHQA 2UWEE 1T21A 3TNMB 3V0JA 1LK2B 3S5ZA 4GIPD 5HGAB 4XC3H 1MCNA 2BRQA 4HKBA 4D8OA 4FQJH 1H3GA 2NTFA 2NY3C 1CFQB 4I2XB 2I07A 5EUOE 3F7PC 3S36X 2J8OA 5FGSA 1XXDC 3WENA 5DRNB 1ZEAH 4UZUA 3RQ3A 3O2WH 2Y1AA 3NIGF 5DVPA 4OJYA 1BM7A 4ZMXA 1HCFX 3QDAA 4P5MA 1FCGA 4AXWA 1BHUA 2EIKB 4YBHA 3HAEH 5T1MA 2SEBA 2KMWA 5C0EB 4OT1L 5BS0B 3O6LL 1A8JH 1X44A 4OCLC 1WZAA 3F12B 2FE0A 4G8GA 5D1XB 4NQUA 1BYNA 2NUPA 4HWEL 2VDRL 4QXGH 3TT1L 2MCPH 1N19A 5IB4B 4NRYB 4Z7OB 1AGEB 1TVHA 5C2BL 1RJZA 1KB5L 4JFZH 4PG9B 5AD0B 1M7DB 1JWUA 1QNZL 3RKDD 2IWKA 3LB6D 2F8VA 3E80A 5HHOE 3W82A 3OKEA 4WWPA 3IJEB 2X4PB 2EAEA 2NW2A 2PTUA 3INUL 1XGQA 3IFOA 4GR7A 3J8F7 4YHMH 3ATEA 3WFZA 4A68A 2J6EL 1RUKL 1W0WB 3CLWA 1HCZA 2ADFL 3MROA 3IMRA 2VMEA 4WO4D 3F5WB 3N44B 1CLOH 5GIRA 1V10A 5D71H 4MAYD 4FI6A 5AB9A 5JZ7D 4PRNA 4WW2B 4LSVL 5CGTA 4TSBH 2XN2A 3O6FA 4LHUA 3F12A 2NW3A 3IDYC 1OHQA 4KNSA 5EU3A 4JHZA 3WFDL 3GO1H 3QORC 3QDGA 3ATFA 3RKDC 1EVUA 2IPKB 2J43A 2OXGB 4GKSA 2WW8A 4P5MB 4XO8A 3QDMD 2J8UA 2C1PB 2BLFA 1VGEH 5D7KD 2X6MA 5C9JA 3CLFL 4APQA 1SM3L 1FFPB 3HAEA 3C2SA 3LVEA 3RL2A 4Y5YC 4LPTA 1F6AA 4HKBB 4NP4H 2DQIL 2P5WA 5IVZB 4J6RH 5B8CC 2OMWB 3SKNA 1BECA 1PNDA 3BT2H 3GDBA 5HJGA 3U2IA 4P3WA 4Q6KA 5JQ6L 1LLAA 4WWID 5ANME 3QO0B 4AI7A 3MGTA 5F7UA 1IVLA 3CMGA 1A7RL 1HH6A 2IOIA 4XCNB 4FCHA 4BJLA 1HL5A 5DGQA 3AY4A 5LN4A 1WRFA 5HHVH 3MLVL 2E9BA 3BQVA 1TTCA 2WNKA 3CD4A 2Y5TA 4GG8B 3AACA 4LCYA 2AQTA 1SHXA 4ZG1A 4JJ5A 3PHOB 2AEQH 1RULL 5I9QC 4AYGA 2Y7NA 3MRFA 4BFEA 2GY5A 5IBUB 4R84A 5DVNA 2YC1B 2OTWB 3O4LE 1KN4H 5FA4B 3O2WL 4XWGH 4F2ME 1KBGH 5AVZB 2EDBA 3BN3B 2EDTA 1XWVA 3M86A 2TRHA 5LB1A 3SDXF 1OE2A 5HGHA 5CBEB 4YHYC 1N18A 1UURA 3QO1B 3T6VA 1CIDA 3N1PC 4ANVA 5KYXA 1QEXA 1JVKA 4UQIM 4QXTB 4F27A 2BVEA 2CJTA 4KJPD 3ME0B 4XR8C 2ZX7A 2GI7A 1VAHA 2AVGA 2DQGL 3V4VB 3HAEG 3SB3A 2CGRH 3X1EA 4PRAB 4A6YL 1J1PL 5L8LB 1JWSA 3MLRH 1JZHA 1LNUB 1QRND 2DLGA 3O41B 3MA9L 5IUCA 1EFXD 3BGAA 3KPOA 3L9EA 3QQXA 4TRPL 4IKKA 4UT6H 3SDDA 4ACPA 3L7EB 5IEHA 2YEQA 4MJ5B 2OYMA 4XWOD 2ZOOA 2EEAA 2WO3B 1S3KL 2NZ1A 4MMYA 4MZ3A 3BPOC 1OAKH 4R90H 2X6AA 3P3YA 1D9KA 2F19H 5FDWB 3OAZK 4OJDH 3TH4T 1CTMA 3QS3A 3IDNB 5DMJB 2DADA 4OSUL 1KTDB 5D71L 4NZRL 4ZFOB 1LYQA 3B3BA 3GHEH 3BSZL 2LU7A 2QLVB 5HGAA 4PJXA 4RAVA 2XA3A 3S4SB 5BW7A 2DIBA 3NDZE 3U82B 4JGJA 3UTQB 5JA8B 2NXYD 4DGYL 3NPSC 1QABA 2IPTL 5J11C 3QJUB 3DUSB 2EYTA 2YA1A 3LKPA 2PWDA 3O3EA 2F1EA 1HHJB 2KDYA 3STZA 1QSEA 3P3UA 2CKBB 5IR1A 4YHNB 5E0QA 4PS8A 1T4KB 1H15A 5T3XE 3VTAA 2N1TE 3RJOA 3GMNA 3HBZA 3R7QA 5KVMC 4X7SL 1MQKH 3AT8A 3BWAA 5IBTL 3MJWA 5E6IA 3DMMD 4HXAL 3SBRA 3GXDA 5EBLB 1AR2A 3TV8A 3RUGA 1EJ8A 5C0AA 3QRBA 1B2WL 5F7YC 3T8XA 5MENA 4G42A 2OMNA 3L4ZA 2XICA 5F0LB 5HYJE 2VLJE 1RZJH 3BKMH 2ZYSA 1H6TA 5SX4H 1GJIA 2EUVA 2YPVH 3PGCA 4I4WB 4NO2B 1JHLL 4UF7C 3ZYIA 4FC3E 2NNAB 5TDOA 2OSLB 4OAWB 1QFUL 3D3VE 5T5NF 3D3VB 2VR8A 4GKZB 4GRLA 1C8PA 1H3PH 3MROB 3HZVB 4M9PA 2FEDC 4NQCB 3BMWA 3Q7JA 2H1LM 3ZT7A 3OSVA 2XWRA 4CN1A 5MERA 2D73A 1IB5A 2ZP8A 4PCKA 4IRJA 2A6DA 2CM5A 3QR2A 3SPVB 4XWGL 4BK5C 1EJOL 5DRWB 5CJOH 1UG9A 1R24B 2ZTBA 3FFDB 3RYMA 2XN9B 3FRPB 1IC4H 2H0JA 5E6SB 5DS2A 5I74C 1TTGA 3I6SA 4XMLL 3VD1A 1SDYA 2CZNA 5FYJU 2DICA 2FBJH 1AZZC 3HE6D 3BVVA 4KKBC 1BF5A 4JKNA 3ZE0F 3KYKL 3FQRA 3OAWA 4MD5B 3WUWB 4AIZA 1DBMH 3NCXA 4MX7B 3GSNA 1JK9B 2ZWLT 3BPLB 4JRXB 4RZKA 1J5OH 4H25B 1AR1B 3FAWA 2COVD 1QYGL 4PI2A 3V5KA 2VMFA 5DMKB 4Y2OB 3JUYA 4EI5C 1L7IH 2J25A 3HE7C 3KWWA 4LCCC 2PYFA 1MIEH 1S7WA 3AS0A 4YNYB 5H4YA 4R5VA 1FZMA 1NIDA 1GYUA 4PRPB 3L5JA 1WT5C 2EVHA 4A6YA 2F19L 4MS8D 3GMOA 4PN6A 2D7NA 3CIQA 4GW1A 2CHDA 4P46A 3V6FB 2PYED 1S7XB 2UY7A 3T0WA 2QVTA 4GBXC 1BIHA 2DQUL 1MG3C 1IJNA 3ABMB 2N7AA 5DEJA 5IEKB 5HI4C 4YAQB 5HJ3B 1VHPA 1UH3A 1KPUB 2F53A 3B56A 1BBDL 4HUUA 3S3PA 3VFOA 1NOLA 3RIFF 4JPIA 3TBYA 5E8DL 1DCLA 2BWDA 3KPSB 1N6QL 5JORB 4UQ9A 2YAEA 4I13B 4QRQB 1BMZA 5HHXL 5DD3H 1A64A 3UYPB 1KIRA 1UVQB 3ZYZA 1FHGA 2Z3FA 4DAGL 4AQ1C 5I1AB 3WNIA 1RPQA 5CP3A 3AWFA 3C6LC 3GMLA 4JQXA 2A77L 4NQSB 2JJSA 4M00A 3ARUA 1AP2B 2MNJB 4HWZB 5AVXB 1N6VA 2MCAA 4TSAL 3WE1A 2AQQA 3AXLB 4HOWA 1U4FA 5D4IA 5A2CA 4K5NA 1MZZA 5FWRA 2IG2H 1UOLA 3W0WB 4Q6IA 5DFTA 2YD1A 1DFBH 1TU2A 2NX5B 5SWZE 3U36A 5KYWB 3CXFA 3LAFA 4M56A 1XIWC 4TTDD 2O6FA 5GGSY 4KTDH 4YMPA 1X4YA 2OYLA 1KB9K 2EIEA 3OLGA 3O8XA 1CS6A 1GHFH 3GTTA 5ALCH 1E7VA 1L6PA 5JORA 1NBZA 1B3JA 4X4ZA 4E41A 9PCYA 3F7YB 4GSDL 2DQEH 2ENQA 4I0PA 2V3EA 2YUVA 4JM0A 1BZ8A 2P8PB 4ZX5A 3EYUL 1QQDB 4M3HA 5JNYB 5LWYL 4HWEH 4JPKH 2XDHA 4GXVL 1CDGA 1WFMA 5AW0B 2BHZA 2ICEB 3K2UH 1NLDH 3JWDH 5F44A 4B27A 4TQPA 3A6CL 3OSKA 3SE3C 4LXFA 3LY6A 5EUOA 4L8CB 4CMHC 4ZX4A 4PRPA 3R7RA 3BPNB 3KLHD 3HZKB 3D9AL 1IV8A 4FQLL 4FNUA 3TU6A 5KW9L 3IJYB 1B0GB 4W4OC 1ZE3C 3WN5C 2R0WL 3UDWA 2BNQB 4X5PA 2EUWA 1IGCL 1WZLA 2ATKB 5E2JA 1EJFA 2YAFA 2OL3A 4U1SB 1B4TA 4RETB 4LSVH 4NKMB 2R29H 3FPYA 3KXFE 1G9NH 1JDDA 1UZ8A 1LEIB 5FB8A 3TFKD 2O1AA 2TSAA 3KM2A 4N24A 5DD0L 4ZX3A 3CZFA 5D7HA 4ZPVB 2ZP0T 3GS0A 4GUCA 4DO5A 2NY4C 5KVEL 4XNUH 3DNKA 3HKFA 4CSZA 4RISH 1MOEA 2IGTA 3TURA 4TLUA 43C9A 3E8UL 3DX1A 3FSZA 5I1HL 5F89B 5F3BA 4FNSA 2OMZA 3BKYH 3I6GB 4FMKA 5DHDA 1DANU 3ZY7A 4BFNA 1NCAL 1LE9A 1WEJH 2KZBA 3LNHA 3QUYB 4Y4FD 2BY3A 5T1LA 3RHWF 5B38G 5IQ7L 1RK0A 2N4IA 3RIAK 5ES4B 2ERJB 5E23A 8FABB 3DDFA 3LRHA 5LXGL 3OHMB 1ILSA 2UYLB 3OC5A 4XBGA 2NNAA 1FFOA 5FHBL 3BT2L 3TA3C 1ZHBB 4J8RA 2E9IA 4Q56A 1H8LA 2Y0SA 3KLSA 4LMQE 1ZCRA 1F5WA 3MYJB 4NQDE 4YSQA 2DMCA 4HIXL 3RAJH 2NPLX 1OAYL 4G42B 4KXDA 1NFDA 4AYBA 4CC4A 1UYWL 3C8HA 1IAMA 1JPGA 2B2XL 2NY3B 1U3HA 4MCMA 3MJ7A 1IU1A 5IV2A 5EF2A 1O7DC 2QL1A 4NKDB 5GGRA 4KU1A 3ULSB 2MEJB 2IO5A 3GSXB 2ATAA 1DJZA 3DYMA 5E6IB 4A1RA 1BZOA 4ZPVA 2JSFA 2D7PA 3I85A 2KUTA 1HNGA 5C09A 3JWNC 1TZHB 2VDMB 1BQRA 1S7UB 4LPYA 5AQ0A 3UBXI 3KYNB 3VXUB 1AXSA 3LNEA 3QEHB 3QS2A 2WXLA 1NJ9A 2PW2B 4HZLB 4CL7A 5CFAA 1J5HA 5D1ZB 3MOQA 1OCRB 2BNQA 1R17A 4BK4A 2F08A 4TUJA 1G7JB 4WK2B 4G80B 4YHPA 1JPSL 1UJ3C 1YYLL 4AVKA 3CDYA 4LCUA 3MLYL 2HRPH 2P8LA 1YQVL 2HFFA 1PLAA 1JGLL 1RHHA 3ARBB 3C8KB 4Z0XB 1OAUH 3CG8A 1AMXA 1UFUA 1IEAA 4NN6C 4H8QA 4MNHB 1W8EA 1GPOH 4YSOA 2EXWD 1YYCA 2D0GA 1F02I 5K1JA 3AM8A 2R2BB 4ZUTB 4TRPH 3KBFA 3B6SA 4YVUA 4L5FL 4LDEB 1CBVL 3K4ZA 1NUGA 1B4LA 1XGTB 2IH1A 1YEFH 3VCLA 4RGNE 4DSYA 1GGIL 3MV7E 3FOLA 1JUFB 2MFNA 2ZUXA 5EIVA 4QAWA 3MGAA 3OWRA 5IJKA 3UTTD 4HULB 3BE1H 4MZ2A 1SMOA 4C56D 4PJ9D 1X5XA 2X4TB 1ZWIB 3ROOA 1WAAA 3S88H 3BSZH 1QFWI 4UDUB 2GCYA 3WFHA 1G9NL 2X2JA 2AFNA 1CL7H 1CT8A 1WFIA 2YD8A 3RRQA 2EICA 2FBOJ 4P2OC 3RE0A 3FO1B 1S7SB 3LVTA 2FO4A 4N0UE 4R4BA 1CGSL 2AXGB 1G9EA 1NGXB 3AXIA 4YLBA 2H6PB 1WBZB 5ID0A 3VXRD 3GSVB 5TE4H 1LMIA 1T7XA 1MW1A 4FE9A 1A7OH 3WXWH 1TKWB 4HGMA 3C87A 3BUYA 4KKLD 2VW7A 4KHXH 3PFUA 1OM3H 1CR9H 4NKOA 2YJQA 4PWIA 1HWHB 3T0EE 5JUEH 1CFNA 3BGFC 3V55A 2P5EA 1OPGH 1U92B 2WWKO 5EU6E 5FLVA 1F4WH 2XWCA 2IAND 2R15A 2WNWA 1FIEA 2B5IC 4WUUE 5GPRA 6PAZA 2NY5L 4JL2A 2FQEA 3I9AA 4RGMC 1W16A 4YE4L 1RAMA 1G7HA 4AKPA 1G94A 3PREA 4BWTA 1T0NA 3LS4L 4K8RD 3KL0A 5DUJA 1WFJA 4Z18A 3LZLA 2C3WA 1UGKA 5ISZA 2VM3A 4X4YB 5AW9B 2XI9A 3E6HA 5JQHC 1JGUH 2ZICA 4AEHL 5ABDE 3AM8C 1GAFL 4PM1A 3W2DL 5IP4A 2WLLA 1IFHL 3HBPA 3DHPA 4OV6F 1JNNL 1Z9OA 1AXIB 2FQDA 2YFNA 3D0VB 4EUPA 2X2UA 4PHXA 1ZVYA 4DHLA 3TT3H 4U1JB 2ZCHH 1IKFH 4MA1B 3LNDA 4ZO7A 1DHKA 3QHFL 1IM3D 3W39B 1MQ8A 3ILQC 4PGBA 4Z7OF 1KDIA 1IGFH 4FQ2L 1GZHC 3L2NA 1CK0H 4RDQG 1UM5H 5BOZG 1ZIQA 2P5EE 2JJUA 4M6MH 1S78D 1FZOB 3QZBA 4P2OA 4UIKH 4IAUA 2QQLL 2FL5B 5AVVB 2YOCA 5I18H 3QCVH 3HC3L 4NZUH 4FKKA 3PPEA 4H1LB 4P2QB 1BGXL 4IRSA 4NN5B 5C07E 4IU3A 3LN9A 1HJBC 4F7MB 1MCWW 2A2QT 4KZDL 2PABA 4HT1L 4Z3IA 1U58B 3MC0A 2ZUQB 4GY4A 2AQ2A 4R7NB 4NPYA 5AL0A 1G87A 3T2PA 4MJIB 4ONGH 5E8OA 3NA4A 3Q2CA 2Y23A 5CSZA 5C08A 4WFGE 5I0YA 4JHAL 5PAZA 1YAIA 4JKLA 1S9YA 5DLML 2HWZH 1AKJA 4NAMA 1QZ1A 3T08A 4G8GB 2OSYA 4ZPTA 1U3HC 3SD5A 1NBQA 2QVIA 2Z4QB 5BVPL 4PJDB 3NJLA 5I30L 5KBLA 5AB0A 3ARFD 5DQDH 3A67H 3DV6B 3KWVA 3P0VH 5IHZB 3EHBC 1NAML 3NFSL 2YUZA 3LPOA 4KJYB 2BCKB 1PTZA 2VR9A 3RUGB 4K9EL 4NZTH 5DLLA 5LO7A 2M2DA 4A7TA 4JO4L 3SOBH 2VLLA 3U1PA 2DBLL 5EBGA 2BP3A 4WV1A 5J6HA 1SBSH 1QWUA 4KROD 2DYPB 5HSFA 4TVPE 3D48R 1H15B 1UZGA 2IBZX 3BLBA 2Q7YA 3FMGH 4MNQA 1BLIA 1E4WH 3OKMB 3MUZ1 4WWOA 1MCPH 4EO5A 3WNJA 3PWJA 5E51A 2ARJA 3NABH 1AJ7H 3QZWB 5CR8A 1FIGH 4M1GL 4M6NH 4PI0A 3HNSH 4WTZA 3RVXC 4XNAA 3CVDA 4HBCH 5CN1A 1J1XH 1EANA 1LO5B 3SYQA 4QXVA 1ZHNA 2LLNA 3RHWK 4JDVB 4JM2A 1ZPLA 2ZCLH 2BMKB 3WKQA 2QSCL 3NCYP 1UD6A 4O2EA 5DK0A 2AEQL 4H1LH 4DGUA 5E9DE 3SCMC 3RU8L 5KS9E 1GAFH 3GJEB 1Q9OA 3W2DH 4X6CB 2OP4L 2J44A 2HKHH 1YNLH 3ZGIA 4YOKA 4GT7A 1OKEA 2ATPA 1LDPH 2QHRH 1TZ8A 4NC2B 3UJIH 3FF8A 4XVUD 1MJUL 1MFEL 1XCTA 2MTPA 4P2QD 5JOFB 5IMLB 4YDVA 3VXMD 3GZOA 3GRWA 4F15B 1F3DH 4M5TA 2VQ1B 1FYHB 3FO1A 4N2GA 2FRGP 4JGMA 3RNQB 3ULUE 4CUCA 3RGVC 3ULVF 4NLAA 4AMXA 5D55A 1GSKA 5HHMB 3QH3B 3SKMA 2X4TA 1Z9SA 2PCPA 1E5UI 3HZYB 3ZPDA 3I6KB 3PP3H 4XOAA 3HC3H 2Y36L 1GS8A 1G6RH 1R3JA 1XSJA 1S2EA 4DVBA 3J27A 3VI3F 1JUFA 3ZX1A 5AB1A 3QDME 4LNRB 1KFAL 1QASA 3VWKB 1HEZB 2QFPA 3N04A 2DI9A 1NIFA 4U6VH 2DWEA 5CN2A 4L37B 4O2FB 4I3SH 1N0XL 2DAVA 3AW5A 3GMRB 1AGBA 2AXHA 3BDYH 4WV1C 4GAYA 1IAIL 2FDBP 4ZFGH 25C8H 2L7JA 3EOBA 2G2NA 4JZJA 3WAJA 1OSZA 2YSSB 4GG6E 3Q2WA 4JDVA 1ADQH 4AJVA 2P28B 2IALB 3PV6B 5CJXC 2MMXA 1JVOA 1ZLDA 3FS9A 1GC1C 2XY2A 5IK3A 4XCNA 4H26A 4Z7WF 4FZEL 1DJGA 5DD5L 1SXZA 3REVA 4FQ1H 3EYSH 3KMDA 1INQB 1PGRB 2C3HA 4NWUL 3WD5H 2YD7A 1I9RH 1FYTB 5DVLA 2I25N 5GS2H 4DPBX 1S7UA 4U4BA 3VG9B 5FCUH 1YNTB 2WLLB 1R34A 1FRGH 1KZQA 3Q0HA 4ODUA 4HIXH 1HHGB 3E6HB 1MLBA 2EDQA 2OL3H 1KLFB 4KZEL 3LPPA 4PHZA 1RVFL 3I3EA 5DVKA 5D8JH 3Q3GB 4EUPG 4X9IA 4G6FB 1T0NB 1K72A 4I87A 1WGVA 4MDIB 4PMFA 4NSKB 5DD6B 3BKML 4X6CE 3MCYA 4WU7A 1CURA 4L8SB 2VJ8A 4OF6A 4HISA 4HBCL 1DZ0A 3SCMD 1MW0A 5TJWK 4C56B 5EF0A 3O11B 3CZEA 2A74B 3SDCD 4JRYB 4ES9A 1TMQA 5DSCA 5AOZA 1JCKA 1T7ZA 1IAOB 3TEXA 4ZTEA 5C08B 2WUBL 5I82A 4OLZL 1TTAA 4UOQA 3LH2L 4N22A 3UJIL 3RTQA 3SGJC 4P2RB 1AACA 2FHCA 4WY7H 5CKGA 4WI5A 2AMUA 2V8LA 2ZOLB 4M5YH 1JV5B 3T6WA 5L88H 1G84A 4U3SA 4IK6A 5B3JE 1V7MH 3GI8L 1A45A 3P11H 4WO0A 1MCSA 5GS3A 1J8HE 1EUTA 5AD0A 2W65A 2BSSB 2WXKA 2HPTA 1JOIA 1TVHB 5FW6A 1CYXA 1FAIH 4C4KO 2FL5A 5HXMA 3NA9H 5LGYA 4YGAB 3HLAA 3WN5B 2JK5B 5K93A 2OL3B 3ZTNL 6CGTA 3FCTA 3BAKA 3BPOB 2G30A 3H3PL 5GS0D 2CO1A 3VXUD 2BB2A 3BAEL 3QZMA 2IAMB 4U3CA 2W92A 5DRZA 3V8OA 1KCLA 5AVYB 3GSRA 4TM9A 3U7YL 2A73B 3MV8D 4B0MM 1CE6B 3WNNA 5T5FA 5E6ID 1A5DA 1CL7L 4AQEA 4D8PA 4ANUA 4L3AA 2G3XA 1A1MB 5EU4A 1T20B 4ZUWA 43CAB 2JDGA 4JNXA 2E27L 2OW6A 3HFFA 4BFOA 3T9WA 4HFUL 3VXSB 1I9IL 1ZKAA 3RNKA 4PW9A 4GAGL 2P8LB 1LXMA 1XF1A 5IHWA 3RA7L 5KTEH 3M7OA 4OCRH 3QCTL 2J2ZA 4HYTB 4M6OL 3CZKA 2MWCA 3PWPE 1DSFH 4QRRD 4RGOH 1JV2B 2BERA 4YDJB 1MCQA 4Y1AA 3FW6A 5D2LA 3ECWA 4X6DB 5L6YH 4YSRA 3QNXA 3WMSA 2FEJA 3DX7B 1DVFB 4GNKB 5DD3L 1CGWA 4G8EA 4MDJA 4DAGH 4TVUA 3ZKMC 1AOHA 3FPXA 2OJEA 2X6CA 3FU6A 5EOCL 3CVHA 3ISRA 3WLWC 4L9LA 4ORZC 3V6ZB 4Y16C 1CFNB 5DHYA 2BH0A 4NUJA 5KVEE 1SPDA 3DDGA 4Q7DA 2CLVA 2XIBA 5DHXB 1DBAH 2DLFL 3HG2A 1KGJA 3CFJA 4NKDA 4TSAH 3PNWA 1P5UC 5DU7A 3ZJAA 1J18A 3QXUA 4TUKH 1ED3A 5F0MB 2APTA 1B0WA 5D70L 1VIWA 1BFSA 3MV7D 4QGTA 1PG7H 4GQZA 2Y3AA 2HT3C 2R0ZL 1ZSDA 4Y9GA 4KO5A 3AXLA 5CZVH 1CC3A 5ITFA 2ARJQ 4EIUA 1MCLA 4F2EA 3BCDA 4TMPA 1O6SB 1OTTC 1J0YA 1TLKA 2R69A 2VMJA 2WY3B 2VAJA 1EHNA 1FF5A 1PZ2A 3ML9A 1WZ1H 1GHFL 4XBGB 4PGCA 1C08A 3FQWB 2GIXA 2W9DL 3NEOA 4XPFL 3QUYA 4WWNA 3RUGF 4J3BA 2DJSA 1Y7VA 5J57B 1MAJA 3DVNB 4G9DB 3IF1B 4QT5A 4YGVA 5F3BB 1DQKA 4HUUB 2JNZA 3WEBA 5AOIA 3HZMB 4CADA 3OF6A 1OT2A 1KELH 3G04B 2K45A 4HMEA 3RFZB 4HZAA 3EBHA 1ID5I 2EIMB 4PJIE 4XXDB 1EHLL 4IU2B 1V7ML 4P46D 2XTLA 2Q10A 3I9PA 4FG0A 4JJHA 5HVHC 1MCDA 3GRBA 5ICUA 1AR1C 1ZV2A 5LAXA 4QHKI 3AADB 4PTUB 3CV5A 4UT9A 3PJSB 5H37G 2F53D 2K4AA 4KI5E 4ZW7A 2AI0H 2BSED 4JFVA 3GUTA 1MREL 1BHGA 1C1EL 1RZKL 4ZFOL 3FXIC 4K5LA 4ZOAA 2HKFL 5DXWA 2F74A 1ADWA 1KXVC 5E2UH 1MCIA 3LQAL 3VD7A 2D0HA 3NYKA 4W1TA 4WDIA 5AOKA 2ALAA 4LVOB 4HEMA 1RFDH 1BM3H 1HAWA 4MA3A 1FH5L 2V7HB 1GTFA 4G3YL 5F8RC 3AZUA 4WF7A 1VZGA 3AXHA 2OZ4H 5DRXB 3RY4A 2W94A 3G6AA 3TO4C 4PLJD 1SXNA 3V0AC 4CSSA 2EDDA 5HGDA 5HI5C 1AE6L 4O58H 2X05A 1JN6A 5CLZA 4OLXH 2IBGA 5JPMC 4HFUH 4IU2A 1E4HA 2P7TA 1SFDA 4BH8A 4PJ7B 1MCOH 1NKOA 2AXWA 4KAQL 3G04A 3X3FH 3RFZA 5I1HH 2VE6B 2IQ9L 1NFDB 3L3KB 1DLHB 2BVUA 4AY0A 4X80H 5GRXG 1FPTH 2W9EH 1TFHA 5LXGH 5TD4A 4HU2A 1TCRA 8PAZA 5IG7A 1TZOA 1BG9A 2FWOB 3O8XB 5CP7B 4PGCB 5EOCH 1UEYA 4K23H 2G9KA 1K85A 2F8OA 3FTZA 1A3ZA 1OTUD 1ZDSA 4EAEA 1AJ7L 1ND0A 1SXAA 3TO4D 5L0QC 2EDHA 4PB9L 4XNXH 5EU6D 1T83C 4I77H 5CUSH 4BCXA 4AENB 4PGEA 1LO3L 3IRZA 3OKNA 1HT6A 1C9SA 3GSUB 4PCTA 4XCYA 5E1AB 5I23A 1UB5B 4ONOA 5FPIA 4WU5A 1HILB 2GJ6E 3LYRA 5B8CB 4ZMOA 2Y6SC 4U1IB 5A16A 2WXGA 4I1NB 2A0LC 2M3CA 5DDHB 4LLDB 3S5LA 1YNLL 3B5GA 4FXLA 1JTPA 2PPAA 1AGFB 5KG9B 4LCCA 1EXHA 2H32B 2K78A 1BVKB 2AMGA 1PYWB 2C9XA 2CKBH 3DUHA 2OJEB 3HUJF 4N2EA 1T4KA 4Y16B 2VDMH 4HX1B 4WW2C 3D33A 2R39A 4H0LC 2VRQA 4KRPC 2VXVL 4G70B 4U1SA 2O6PA 4FQQA 3FT2B 4JRXD 1KIPB 3C5ZD 4UM8B 3GQFA 1EUUA 1JPSH 2JJTA 4A55A 1Z9NA 3N1GC 2CWRA 5J6SA 1I7RA 5IFHL 3MRMB 2OJ1A 4GS7B 5F97E 5LVEA 5L9DL 1T80A 2EDNA 2VLRA 2V2UA 3P73A 5CJXA 3TM6A 3K2KA 4AZ8A 1RUPH 2AANA 4N0YH 4BWUA 2P5PA 4Y8DC 1F6LL 3OGCB 4C57C 4LLWB 3GMOB 4UI2A 3EDKA 1MI5E 2BIHA 4LCWB 4MAUH 2RB8A 2AK1L 5KN5A 4D8PB 3DROA 1ERNA 1F00I 3O2VL 1AQHA 3NCMA 1E42A 1RV6X 1I7TA 3UAJA 4G8IB 4NQCD 4XO9A 4Q9RL 4AG4H 1RUKH 1XZ0A 5IB5B 1MVUA 4U6XA 3BZFB 1JWSB 1QEWB 2YEVB 5FFLA 3KYMB 4KFZC 5TF0A 3SO3B 1XO8A 3KXFB 3L5WB 1L3WA 3SPGA 1FG2B 1U3ZA 3VGBA 1D5XA 3TCXA 2P24A 4DP2X 5J1TC 2H32A 3O6MH 3QDJD 2FIRT 3LEVL 4FN0A 3GI9L 3KNBA 1IC5L 3MV01 3U2SB 2OJZL 5D1ZI 1HQ4B 1TU2B 1ZEAL 2DL9A 2H26A 2XWJB 1FP5A 1RSFA 1A9VA 4BQ9A 4FNLH 1ZMYA 3CK0H 3DHUA 1X5KA 3VQMA 1MCCA 3RDTA 5KVDH 2E46A 4MRBA 4PGEB 3TJHC 2G0KA 3MOBL 5E2TH 4GG6F 5BVJA 5MEQB 1IVTA 3PAVA 4IHBA 3LV3A 3BYTA 5FM8A 3LX9A 3E3QC 4OFIA 4Y2DA 5D8JL 3UTPE 3X1FA 1TZGL 3GMLB 3N1FC 1ECZA 1LDSA 3S3CB 2NY5H 1FYTE 2ADGB 5C7ZA 1A3LH 1A4CA 2B4CL 1V3MA 5FM5M 2YWYA 5DWUL 2EEBA 1MJ8L 3SQOH 2XACC 1ORQB 3VFVB 3X17A 3OPZL 1F2QA 2XRAL 3S3JA 1FFQA 4G9FE 4N20A 1MLBB 5AG9A 3G5YA 1GTNA 4N0UA 4Z77A 1RD6A 3RY5A 1SLXA 5I66A 1JGEB 1HS6A 3DX3A 3IPEA 2HZHA 1SMDA 1C7TA 5DRXA 1DQLL 3F7QA 2VTFA 2HRLA 4BQBA 2V4LA 4J39A 4ADGA 2P80A 1FLTX 1KYUA 4JZOA 3MMEB 2XWZA 3CHSA 2DQDL 3UTTA 3R18A 4QHPA 3EJUA 2NNFA 3EFFA 1KACB 4WEMB 5IW6A 5KYYA 4TL4A 4YPJA 1OGTB 3AITA 1QWHA 1CK0L 1FAIL 4PJIA 1X6LA 1SDAB 3JSSA 1VFAB 3FQRB 1WF5A 1K6QH 3C9NA 3K6IA 2IBBA 1GYCA 1EFXA 5FDWA 4WHTA 1MRDL 1SJVA 4P4KD 1JRHL 4ENZA 2XXCB 1L0QA 1LWHA 2NDFA 3ZKXC 4JGNA 3GBMH 2XKNA 2NW2B 1A5FH 1MHHB 3I84A 1E4XL 4I9XA 4OIAA 4TYUA 2IV9A 1Z3RA 2A6DB 3VACA 1G9ML 2W0LA 3QQDB 2D3NA 4NERA 1BJ8A 4L2LA 2XWEA 5FK9B 1KYFA 1TDQA 3CC5B 3PJLA 1BQLL 4LKCB 2EVJA 2RTTA 1BOYA 2BZDA 1I3GL 4FRWA 1F45A 3UP6A 2OSLA 2OZ4A 3M6DA 4A2FA 5D1XA 4ZYKB 5T33H 3MRDA 5E1QA 5IVXA 4K3HA 3V5HB 4DEWA 1TPXC 2DY2A 5FF6A 4B7IA 3WTSA 3A4AA 4AKQA 2A6IB 2SEBB 5C0EA 1SQ2N 2MPAH 2COQA 1GC1L 4EIBA 2I5YL 4QO1B 2IF7A 1IFGA 2J73A 3VG9C 4N0FB 1XCTB 1GCFA 3T8XB 1D5BA 4LLVB 1ETA1 2QTVA 3AREB 4LBEA 4HG4J 5CKAA 3VJ6A 3WY2A 3DX6B 1YC7A 3MRFB 3IBOA 2L7QA 3SOBL 5GISL 1Y07A 2VC2B 4GP8B 4MNGA 1NA8A 1A4JA 4XBEH 3VSUA 3ZO9A 4AVHA 2IFFL 3BEVB 4WUKH 2VAAA 3ZZSA 5CZRA 1A3RH 2J72A 1X9RA 1D7FA 5FGCE 5DMGC 1X5AA 5KYXB 1AQMA 3MUY1 2ZOWA 1HH6B 1RUQL 2G5UA 3SE9L 5D9SB 3G9VA 3K4AA 1JZ8A 1QO3A 1J1XL 2ARJB 4M48H 3IGUA 3QDGD 4FNTA 3ZLQC 4KVNL 3SZKC 5C6PB 5ISZE 3V4VH 1FDLH 1NMCC 1BV8A 1R46A 4LPXA 3H9SB 1XDTT 5E4OA 3K8KA 1QAWA 3IDGA 2BSDA 2ZOKB 3QUGA 3UC0L 1MRCH 3KEHA 1ITCA 3ULUL 3L4VA 3GD1C 3BQUB 3HRZC 5HYJB 4YWGH 1QLRB 1XB8A 3K6DA 3BXNB 3CIAA 3MLTB 5EZOL 3VJ6B 4NZRH 4BE6A 1CICD 4V1DE 5CJOL 4ZW8A 5GS0L 1MF2H 2P5WD 2ZXWB 3Q48A 3QUXB 5CLXA 3DGGA 2G3ZA 4E36A 3ZTEA 4UINL 4U6XB 5K59E 5EF1A 3BDXA 5AOLA 4W93A 3V6OE 1U8LB 2GK2A 4IRZH 3BP7A 3P9LA 1K3ZA 4ZYKA 4ELMA 2ZD0A 2Z31D 1PW3A 4KXAA 3NCJL 3E9UA 2WLMA 3TCTA 4X98A 3N9GH 4GKNB 1AGDB 1OQXA 3CC5A 5IJVA 4LLWA 4GUPA 3FHQA 2VXQL 2BSSA 5H35A 3NAAL 5IB2B 2WOBA 4XN4A 3QIWC 4RAHA 5DJ6A 1OOWA 5TE7H 5DTFA 5A2JH 5IQ9A 1PFOA 4NNXB 4GRMA 3KL3A 3RTQD 3EFOA 4P9HC 4PP2B 3HUJB 3MACH 1MCBA 5DUML 4HD5A 2IWGA 4RESB 4HOMA 1OAZH 2NY2D 3BDYL 5DHVB 1BX2B 3V0WL 4LOUC 4UQCA 5D2LF 3VX0A 3GGWA 2ZUSA 5LGHL 4Z7VE 5CCKL 4TV3A 4OZFB 4M3JA 1I8LA 3A4EA 4RWHA 3N40F 3BUIA 4K9EC 1U8OB 2EYSB 3ARXA 2A74A 2C4XA 1SY6L 4HG4K 3GSNH 1HHKA 2GSIB 2WVVB 3FONA 3UO1H 3ZE0E 2WC7A 2H5UA 3MRIB 1XSKA 3D12B 2LFEA 1MCRA 4I7ZC 4M8QB 3SQBB 5GGVL 3VSVA 1FJ1B 4HCRH 3FQNA 5FEBA 4FFYA 4K23L 1PSKH 3H56A 4GQ9H 3GRWH 5I15L 1ZOXA 2VXTL 1CQKA 1P5UB 1WA1X 4Z95L 3HN8A 1RUAL 1QG3A 2PP9A 1C5CL 4ZS7H 1N7MH 1KBBA 4M7ZB 4WFED 3BIKA 3SDYH 4N68A 1GOFA 3SBWC 4TSCH 2BS9A 2OMVB 3UTZB 2LGNA 2NZ9D 2ISDA 1CXIA 2MCPL 5ISZB 1A3RL 1XMEB 2H2SC 3ARBD 2WN2A 2XZAH 3WNLA 4CN4A 3HPLB 3VI4F 4OI7A 5IFJA 4UNIA 1QNZH 2D03H 2CJSA 3GS4A 3DYPA 1S9VB 4ZOBA 2JLLA 5DEGB 1JGVH 4O9HL 4BH8B 4WRLA 4NEHB 1QSED 1WHOA 5FS5A 5IW1A 1WHPA 4DEPC 3VFSB 3C09C 1A66A 2J6EH 3GXTA 4BCZA 1A47A 1PX4A 1CG9A 4QXUL 1QBLH 1JWMB 3I02A 3EXJA 4JPKL 2DQUH 3NFPB 4LOEA 5JQIB 4OTXL 1LWRA 4GBXA 4EDXB 5CP3H 5DUBA 3R1GH 3VWKA 4PJFB 3LRSB 4PREA 1P84K 3KLAA 1DEEB 1KJVA 2V5SA 2Y5QA 2CD0A 1NCUA 1VGKA 4GQRA 2N56A 4XNYL 2GUOA 3LN4A 1NQBA 2WINB 5K69A 3TBSA 5FUZL 5HHME 2LVCA 1RZPA 5IFAH 1OGAE 4YHYB 1ES0A 1T0OA 3EOTH 5IB4A 1JTOA 1T66D 1JFQL 1YMHB 3QUZD 2XQYA 3AG3B 4M93B 4RA3A 1YA5A 3VDCA 4EOWH 2WQSA 3MOAL 4BGLA 4EN3B 3QUYD 2NYKA 3OZ9H 3ULVC 1EK3A 2J1KA 4OKVA 1XZ0B 1YNTF 4B9IA 3HG5A 4H8VA 4JFFA 3BSZA 3ESMA 5D6DC 4PGJA 1N0LA 4HBQA 1TSHA 4G8IA 3TO4B 4EVNB 5JQ6H 1ADQA 4UQ2A 4NXKA 3EJTA 4HPYL 4JANA 3E8VA 4DUXA 3CLEL 5ESAA 3B7RL 4KTDL 1MUJB 3O8XD 4NUGH 3HG4A 1XIWA 3IT8D 4UT6A 5CCKH 1I9IH 2WIIB 3LXCA 2KH2B 1LGVA 2QVFB 1MIML 5T1LD 3B3IB 1LK2A 4RGOL 3MOBH 2OQJA 2P47B 1HHIA 1KOAA 1AZUA 1ZA3B 2WBJD 3L7FB 3MLSL 3PWUA 3P77B 4DT2A 3QUZC 2Y72A 2KLSA 4L3FA 2K4WA 1EHKB 1X7TA 1GCYA 1SOKA 4MNQB 1NBCA 1SJXA 4X7FC 4GI8A 3RDTB 1OHZA 4OZ4B 1YMME 4JFEB 4EI6B 5L4FA 3EJQA 1XHHA 1R5WB 4PY8I 1HINH 1JDCA 3Q01A 2VLLB 3MLXH 3BVWA 4L1BA 4QRAA 4RWYL 3SE3A 2A4ZA 4Y4KD 1AMYA 1KCVL 5EB9A 4OLUH 1I1AC 2FT8A 4DKTA 3WHE0 1T5WB 4WQOA 4DP7X 2NY6B 3F64A 4UAHA 5KW9H 1UACL 3KD4A 1KCSL 1KEML 5I1JH 2J2ZB 5E5MB 3D51A 3H6AA 2HPOA 3A6BL 3PE9A 1YCSA 2WQXA 4LPUA 4RX4A 2HRGA 1BREA 4HZ1A 4R4ND 4L4JA 2BVPA 4TVPL 1TQSA 2HXAA 2UZYA 1UD8A 4Z7VA 5KVGH 2HVJA 4JVUA 5DJ0B 3VE0A 1FFRA 2VDQH 1A1OB 3H9ZA 2W07A 1M57B 4FG6D 3WL9A 3WEXB 3OXSB 4OZGE 4ESKA 2V9TA 4DETA 2X1QA 2ZXEB 4LRNH 1SVBA 1ZV9A 3EH1A 4Y4HB 4KY1H 4YC2C 3DSNB 3X11B 3CMOH 2DWYA 4P9HH 4OFDA 1MRDH 1A6WL 2JKNA 3EO1B 4GLRI 1DO5A 5EPMA 3RWJA 2WQAA 3V0FA 4NZDA 1U91B 4DKDC 3E6FB 2R2HA 4J2QA 3ETBJ 3MKKA 3H2WA 2IAMC 5DJAA 1PY9A 4JN1L 5FHBH 5FO8A 4ZX6A 2XN9E 1XT5A 3FTGA 3HBGA 5LQBH 1IBYA 4Y9CA 3RZWA 5SV4A 4JFDE 4JDEB 2ZSVB 4HW6A 4MMXB 1IEBB 6PCYA 1KJ2L 4LLYB 3GIZL 3HE7A 2V37A 3VQ1C 4HOXA 4NRXB 4Z8FL 2L7EA 2XFXB 3IFNH 4CW1A 4HAKA 5TH2B 1ZGLM 2Y1YA 4L0YA 1E6JH 4OUUB 4QOKD 3BVNA 4HSQA 2FX9H 3U2JA 2B7DT 5INDB 2MOVA 5D2LE 3T5WA 3WIFA 3FAXA 2V2XA 4A67A 4OGYH 1BMWA 2ZYRA 1EH9A 3O3AB 4JFWA 5SWSE 4XP1L 2AV1A 4BHUA 5K9OA 2FJUB 3S34H 3KJ6H 4PRPD 4QMEA 2NNXA 3NSYA 1BD2B 5EO9B 3QIWD 3DJ9A 4UUJB 5DD6A 2XETA 3WI9A 1R0AH 4XZ4A 3CZUB 3V52L 2HTKD 1EHXA 4QRSB 3AU0A 2J6WA 3ARVA 1LD9B 5DQJA 1YQVH 1GH7A 2IGFL 3C5JB 4YSSA 3K8LA 4NBZB 12E8H 3JZ7A 1J1OL 1EEYA 1VACA 5D7IF 1F8TL 3T8VA 1OWWA 1BOGB 3ZIYA 4EI6A 3VGDA 4KFMA 4LGPB 5E1HB 4XCEA 4ELKB 4XMLH 3NCFB 3OF6D 5HT8A 1S9WB 4NRZB 1OB1A 1PZAA 3JYCA 4EZJA 4DZBA 4Z78A 1FJ1A 1KGXA 4RGND 3NOIA 3MUHL 4JO3L 1NH6A 1GGIH 1KCUH 2WB7A 1F4YH 1XGYL 3QJQB 5IHUL 2OQJB 2QVKA 5SWQA 3QEQE 4G7YH 4UTBL 3SKOB 1S7SA 2B77A 3KLLA 4Y4FA 4AEEA 5I1CL 5IT2L 5I0ZA 4NUJB 1CT8B 5IJKC 2CKBL 5ERWA 2CUIA 3NJVA 1MIEL 4XBPB 5TPWH 5ESAB 1H5BA 5D6DA 2JE8A 4I48A 3U30C 1AGBB 2BHUA 3N0PB 4QIRA 1H3UA 5D96B 4O2CA 3INOA 3CHQA 5T1JA 4MDRA 2BSRB 2EEDA 3HUJA 4KQ4L 5HYIA 1BZ7A 1O6VA 1KPUA 5ADPH 1XCXA 3WU1A 4HIIB 3EGSA 2WVTA 2ZKHH 3MI6A 2LT9A 3D0AA 3EHBB 2MHAA 4KX8A 2MSPA 3EYQD 3ULUF 3I6KA 1J12A 1QLEH 5HGBB 1Q1JL 2C3GA 3FFCE 5HHNB 2BW5A 2FHFA 3DMMB 3ZKXB 3TJHD 3VFPA 2ENYA 5I6KA 3NZ8A 4YNYA 3DJSA 3TLRA 2VISA 3BUTA 4LF3A 3TWYA 2VDKH 3SE8L 5JW4M 4W9AA 1OPOA 1G0DA 3QIBC 5LG6A 4LCUB 1H9DA 5CMAB 3KLAB 5GJTL 4G43A 1P9MA 2CXKA 3MV9B 4JHWL 1R1CA 1E8XA 2X6UA 2VDLB 3ALPA 3ECUA 4N9GA 2HX8A 4PRHE 4NNPL 2AS5M 1S5IL 3U4BH 1RIUL 4ETQB 1F42A 3E38A 2DMKA 1KB3A 5ICZA 1BXVA 4KV5F 3KGRA 5CNHA 3US0A 1ZHLA 1IGJA 2YK1H 2XPZA 3GJEA 4A63A 2QDWA 2EDYA 1CBJA 3KPRE 4LFHD 2HT4D 1D2PA 1P7BA 3BKJH 4P4KA 4ZMQA 3GSXA 3NRPA 2QSQA 5EZPA 5T1KD 1X5HA 3VFWA 1RZIB 4HCRL 4IIZA 1Q0YL 4HEPA 4JPWL 2XV3A 4O02H 4Y4KB 3B2VH 1MFMA 2BW4A 4IRJB 3WEXA 1PX3A 2YIHA 4H1LG 1E6OL 5DJ2B 4N2AA 1QR1B 4P23B 5IMMB 2EO1A 3VYNA 1Y18A 1HSBA 3UCRA 1V3KA 3B9KD 4W9CC 3ARDC 3D25A 1BYPA 5KSAB 1BVLB 3CFIC 1ZT1A 2W60B 2F54B 2ICCA 4LCIL 4TNVF 1E65A 4FMVA 3MRKB 4QCIA 2J6EA 2MQ3A 4G5AA 1Y1DA 5D72H 1NC4A 5GSRB 3TL5A 3KR3H 2CMRL 2E0PA 3AREA 3R19A 3QB7C 5E2WL 3VD5A 4HUXB 1SYSA 2PCYA 2H9GA 2ZCLL 4OBRA 4GFTB 1XH0A 1DYZA 1TVDA 4FQIH 1KNOB 2X2IA 3FT4B 4TQEL 2X89D 2C9PA 4E5XG 5B3SB 3V5HA 5EBMA 4WKXA 2EADA 2QV4A 3W5MA 1QBLL 3QUKA 2VM4A 3P02A 3T04D 4CDGC 5GGUB 1DQLH 2IWEA 4LSRL 4PUBL 2I9LA 3UBGA 1HDFA 1I7ZA 1CFTA 4K8RL 1HSBB 4HA1A 3SDAC 4JPQA 3P40A 4Z3JA 1DTUA 1SEBB 4Q0XH 3KH4A 4G1MA 2GJZA 3CFBB 2XBDA 4U0RB 1DVQA 4JDTL 1B0GA 3BPCA 3P0VL 3ARED 3O9WB 4U33A 4YE0A 1J05A 1CLYL 5HDBF 3I75A 1P4BL 5IB2A 2AAVA 1WWWX 1V8HA 3BKYL 1KTDA 2BNRB 2WIIA 3LEYL 5F7LB 2DQMA 2FEDD 2VJXA 5B39A 3KH3A 4HXAH 5KS9F 1KTCA 4AUUA 4Y1SA 4HKZB 3Q06A 3L3HB 4YSCA 4FNPA 5JMRA 3PL6A 3O81A 4NQXA 1B2WH 1WUNT 4PRHB 3K4DA 3LZPA 1I82A 4P5TB 1X5MA 4X6EB 4Y19E 1ROCA 3CX5K 2P4AB 3AROA 3L7EA 2W59A 5DEFA 4OZFH 4HPYH 5CMAA 2XWBA 4M6NL 3EJYC 1IAIH 1FE8L 4ZFGL 5J9PA 1PD0A 5DD1H 2L04A 2H8PA 4PRDA 3THML 4K3DH 2WXMA 2V17L 3G5VA 3G5ZA 5FA3A 1Z9SB 4AKAA 4Y88A 1COBA 2B2XH 1MDAA 2R1WA 1AZVA 4OZHF 1I1AD 5FYLL 3AMKA 1MIMH 1S8DA 4AGQA 2I24N 2CBOA 2WINA 2YK1L 1NAKH 3ZSSA 2X1WL 4F7PA 4NQEB 5GRZA 1JZ7A 3ILPA 4ZI8A 2WCPA 1N26A 4W81A 2J20A 4DW2L 3C60A 3SGEH 5A7EA 3HG0A 1D2OA 2ICWB 1GA2A 2E6QA 3Q6GH 4NB7A 4J27A 4F33B 3O6LH 4G8GD 1CF8H 4L9LC 3T1FB 2WBJC 3DOHA 4NJAL 4APXB 1E3XA 4UV4L 3CBJB 1H5BB 1E5AA 2WO4A 3IE9A 3PCYA 4OJFL 1WIUA 4M7LT 4FJZA 4BH7B 3U6XS 1USZA 3QRLA 4HKJB 3APDA 1HDMB 3BOVA 5H94A 1TKWA 2ED7A 5CGYC 3WIAA 3QWRA 1B4RA 1HI6A 4HUVA 1AY1H 4TKWA 2F0CA 2YPVA 4E9RA 4KOBA 4Z7WE 2JTDA 3D4ZA 3PP4H 1W15A 1PKQA 4TNGA 4H20H 5DT1H 1NUDA 2BRRH 1TQBB 4WO4A 3CW3A 2FTAA 2X9XA 5AKVA 4XTRD 2MCMA 4AL8C 2ZX9A 5BUPA 2F53E 1R33A 4DCQA 3F6IA 3MXWL 5K9KB 1URZA 5FV1L 1JHKH 3L5WA 1WITA 4NENB 2DH3A 3LKSA 4NYLA 2B9BA 3EZ8A 5HDWA 4Y1AE 2WYTA 2OBGA 2H47C 5CGYD 4N90E 2XWBB 3ES6A 3WFBL 4I0CC 1MHHA 5B1JA 3UJJL 3PGFL 2XHNA 4OZHA 3RI5F 4PMEA 4QLRA 3EYSL 4PJIF 5E4EB 1TXKA 2O6EA 2ZYIA 3VMNA 2R2BA 4ZUTA 2MJWA 1J8HD 2A77H 2WLZA 4YR6B 5KN5B 5GIRB 2RFXA 3MKGA 1M05B 4MNHA 4Y4FC 3NJIA 1VFUA 3L4UA 1OK8A 2XWDA 2UX6A 2K1MA 2B14A 3T3PE 3QR0A 4KI5F 3WLBB 4AUYA 1UD5A 4XAWH 3U0WL 4LGSB 3SDAB 2BDNL 1OCWH 3UEZA 1LL1A 4JCLA 1R24A 3BAXA 4YBQC 3HB3C 2X0UA 3ZQXA 3MJ8B 3CUPA 3NSDA 4KTGA 2B1AL 5DTFB 5ADOH 5HYJD 1T0MA 3H7LA 4JFXB 3SGDH 2CG9X 2CO7B 5LDSA 2ZQKA 4X4ME 2OAAA 2FO8A 3EGXA 2VL4A 4RLDA 1TPXB 2EXSA 4KK8D 2J8UF 1T04A 2IVFC 2QGBA 5A43C 4FJ6A 5FYLH 4AGLA 3FJTA 1TLMA 3GSNL 2BIPA 1W6LA 1KJ3H 2VXSL 3BP5A 3D07A 4FXGC 1OVZA 4QD2E 4AQ1A 4CKVX 4N0UB 4EDWL 1AQDA 1J8HA 4M6AA 1VEOA 3W81A 1NCDH 2OTUA 2W0PA 4JR9L 1KNOA 1RZ7L 4LB8A 4QHMA 1JPGB 1KN2L 3APMA 3NIDB 5LNEA 2W07B 3IMSA 2W0KA 3T6QC 3OKDA 4IBSA 3DETC 3D0VA 1QUPA 3V2AR 5IOPA 2ADGA 5DHVH 4PJHB 1RUAH 4NQDB 2F6AA 3KLDA 4ZS7L 1ZHBA 4HS8H 3IFLL 4F3FB 3VH8B 4I18C 1YMMD 2BC4B 2ADIB 5FUCE 5J4MA 1MVYA 3ZU8A 5E5MA 1F1AA 3EKCA 3O8XC 3WFEH 2XZAL 3DYOA 3VU2A 1T21B 1EEUA 4KK8C 4YDKL 5DJ2A 4DPAX 2QPFA 1DVUA 2CA4A 2G3MA 4Y5YA 4JM4L 5JW5B 1G1YA 3HHSA 1WAAF 2PTTB 4OIIL 3M1CA 4UT9L 1A7PL 1GS7A 5JLZB 3Q2NA 4LVOC 4P05A 4RAVB 4N3UA 5H37H 1F4AA 1QSFA 3QUYC 1DQJA 2CRYA 5AKSA 5B4MD 3G6AB 4OM1H 4XC1H 1V7NH 5BO0D 2G60L 5CU5A 5HDQH 3DX2A 3OAUH 4HCGA 1ULVA 3TYGL 3AY4C 3GHEL 3X14B 3M17B 1D6EB 3WTVA 1Z9LA 3SE4A 1D5BB 2Z1KA 3NK4A 4LLVA 5KTEL 4QY8A 2ATKA 2Q2LA 2EKJA 3MV9A 4UV7L 4Y1AD 5IB5A 4KMLB 3FO9A 4EZLA 4IBUA 1HQRA 5BNXD 2FZ3A 1FNSH 2X4UB 4JM2F 5HDBE 1INDH 3DK2A 3NZ8B 3B2UD 4J3VA 4Z7WA 2H1PL 4OH2A 4KTYA 4AJYV 4X7SH 1NFIB 2IIJA 4RSVA 2B20A 3QEQA 3V9CA 5GRUL 2PR9A 4FKHA 3QIUC 3V4UH 4ZJ9A 1ZS8B 3H2PA 3NPSB 3L16A 3WS6C 4XXDA 4KUCD 4X9GA 1RFDL 1RU9H 2BXYA 4CILA 3Q8EA 4NO0D 3RBSA 4KKZA 4RDBA 4NOBA 4DGVH 3GSOB 4HIJA 3HMXL 1MAMH 1F3JB 2OKMA 1VENA 1ESOA 4A7QA 2V2TA 1A1NA 4TN9A 4HHAB 3ASNB 3RDJA 2WXPA 4WI3A 5ANMA 4B9PA 5C8JB 1E5YA 3BKJL 2CDFB 2GJ6A 2NZ9C 3PHSA 1QFPA 5GJSL 3U9PH 4KITB 1VFAA 2HT2D 4Y4FB 3MJ9A 3GLEA 3LZFH 2L3BA 4U1HB 3FRUB 3FO9B 5FO9A 1I9EA 4A7GA 2B3RA 3LRSA 1REIA 2WVSA 4LSPH 3ZDZB 1CXEA 3U1QA 3GHBH 5AUMA 2R59A 4KBPA 4QOKA 1EHLH 1DQVA 5C2BH 1J0IA 3MXVH 4ODXA 2EE0A 4N2BA 1BXAA 1C8QA 2AJUH 3FT1A 3TWCH 2N7BA 2VO8A 2J4WL 3MNWB 1LO3H