The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
138
|
structure length |
129
|
Chain Sequence |
MVPNVVVTGLTLVCSSAPGPLELDLTSFVLKEGVEYRIAISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Protein crystallization by rational mutagenesis of surface residues: Lys to Ala mutations promote crystallization of RhoGDI.
pubmed doi rcsb |
molecule tags |
Signaling protein inhibitor
|
source organism |
Homo sapiens
|
molecule keywords |
RHO GDP-DISSOCIATION INHIBITOR 1
|
total genus |
26
|
structure length |
129
|
sequence length |
138
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2000-09-11 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII, subunit A, domain 1 |
#chains in the Genus database with same CATH superfamily 1FST A; 1RHO A; 2JHV A; 1FT0 A; 1KMT A; 2JHT A; 1GDF A; 1QVY A; 4F38 B; 1FT3 A; 1DOA B; 2JHW A; 2JHU A; 1DS6 B; 1HH4 D; 2JHY A; 2JHX A; 2JI0 A; 1FSO A; 2BXW A; 1AJW A; 2JHS A; 2JHZ A; #chains in the Genus database with same CATH topology 4RE1 A; 4ALE A; 3KYS A; 1FST A; 4B5Q A; 4ALT A; 5FTZ A; 1KSH B; 4OY6 A; 4JVB B; 1FT3 A; 5E8F A; 5DQ8 A; 2YOX A; 5HGU A; 5HNO A; 5L7K A; 4ALS A; 4EIS A; 2YOY A; 4GOK C; 5HNP A; 4QI8 A; 2VTC A; 5E80 A; 4A02 A; 4D7V A; 3T5I A; 4JV6 B; 2JHV A; 5DQE A; 5IJU A; 5ACF A; 4MAI A; 4OY8 A; 3RBQ A; 4ALR A; 4GOJ C; 1GDF A; 1QVY A; 2BEN A; 5FJQ A; 4F38 B; 5EMV A; 2BEM A; 2JHW A; 2XWX A; 4OY7 A; 3T5G B; 2R5O A; 2JHX A; 2YOW A; 2JI0 A; 3EJA A; 1FSO A; 1AJW A; 4MAH A; 5ACG A; 1KSG B; 4D7U A; 1FT0 A; 5ACJ A; 1KMT A; 1KSJ B; 2LHS A; 4GBO A; 3UAM A; 5TB5 B; 1DOA B; 2JHU A; 4JHP B; 1DS6 B; 2YET A; 4LN0 A; 1HH4 D; 4FMR A; 3EII A; 3JUA A; 5TAR B; 4ALQ A; 5AA7 A; 2BXW A; 4JVF B; 4ALC A; 2JHZ A; 1RHO A; 4EIR A; 5F2U A; 2JHT A; 3L15 A; 4JV8 B; 5ACH A; 4EIS B; 5EMW A; 2JHY A; 5ACI A; 5FOH A; 2JHS A; 3GQQ A; 3ZUD A; #chains in the Genus database with same CATH homology 1FST A; 1RHO A; 2JHV A; 1FT0 A; 1KMT A; 2JHT A; 1GDF A; 1QVY A; 4F38 B; 1FT3 A; 1DOA B; 2JHW A; 2JHU A; 1DS6 B; 1HH4 D; 2JHY A; 2JHX A; 2JI0 A; 1FSO A; 2BXW A; 1AJW A; 2JHS A; 2JHZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...