The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
138
|
structure length |
138
|
Chain Sequence |
AMVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAAAYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The impact of Glu-->Ala and Glu-->Asp mutations on the crystallization properties of RhoGDI: the structure of RhoGDI at 1.3 A resolution.
pubmed doi rcsb |
| molecule keywords |
Rho GDP-dissociation inhibitor 1
|
| molecule tags |
Protein binding
|
| source organism |
Homo sapiens
|
| total genus |
24
|
| structure length |
138
|
| sequence length |
138
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2001-12-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII, subunit A, domain 1 |
#chains in the Genus database with same CATH superfamily 2JHX A; 2JHW A; 1FT3 A; 2JHV A; 2BXW A; 2JHZ A; 2JHT A; 1FT0 A; 1RHO A; 1FST A; 4F38 B; 2JHY A; 2JHS A; 2JHU A; 1QVY A; 1DS6 B; 1DOA B; 1GDF A; 1HH4 D; 1FSO A; 1AJW A; 1KMT A; 2JI0 A; #chains in the Genus database with same CATH topology 4GOJ C; 3L15 A; 4JV8 B; 5ACH A; 5L7K A; 1FT3 A; 2JHV A; 5TB5 B; 4JVB B; 4F38 B; 2JHY A; 2JHS A; 1KSJ B; 4LN0 A; 1DOA B; 4ALR A; 2YOX A; 1GDF A; 5EMW A; 3T5G B; 1KMT A; 4FMR A; 5E8F A; 4GOK C; 2R5O A; 2JHX A; 2JHW A; 3EII A; 4ALS A; 4OY8 A; 4OY6 A; 2BXW A; 2BEM A; 2XWX A; 2BEN A; 2JHT A; 4RE1 A; 1FST A; 3KYS A; 3EJA A; 1QVY A; 3JUA A; 5E80 A; 5HNP A; 4EIS B; 1KSG B; 2YOW A; 4ALE A; 1KSH B; 3UAM A; 5ACF A; 5ACI A; 4ALT A; 5DQE A; 4JVF B; 4OY7 A; 4D7V A; 3T5I A; 5FOH A; 5ACJ A; 5FJQ A; 1FT0 A; 1RHO A; 4JHP B; 4MAH A; 3ZUD A; 4D7U A; 5FTZ A; 5DQ8 A; 5HGU A; 4GBO A; 4EIS A; 4EIR A; 1DS6 B; 4QI8 A; 5AA7 A; 4MAI A; 2YET A; 2VTC A; 1FSO A; 4JV6 B; 5HNO A; 3RBQ A; 2YOY A; 5TAR B; 4ALC A; 2JHZ A; 5IJU A; 5ACG A; 2JHU A; 4B5Q A; 4ALQ A; 3GQQ A; 5F2U A; 2LHS A; 1HH4 D; 1AJW A; 5EMV A; 2JI0 A; 4A02 A; #chains in the Genus database with same CATH homology 2JHX A; 2JHW A; 1FT3 A; 2JHV A; 2BXW A; 2JHZ A; 2JHT A; 1FT0 A; 1RHO A; 1FST A; 4F38 B; 2JHY A; 2JHS A; 2JHU A; 1QVY A; 1DS6 B; 1DOA B; 1GDF A; 1HH4 D; 1FSO A; 1AJW A; 1KMT A; 2JI0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...