The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
217
|
structure length |
217
|
Chain Sequence |
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Studies on the Nitroreductase Prodrug-Activating System. Crystal Structures of Complexes with the Inhibitor Dicoumarol and Dinitrobenzamide Prodrugs and of the Enzyme Active Form
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| source organism |
Escherichia coli
|
| molecule keywords |
Oxygen-insensitive NAD(P)H nitroreductase
|
| total genus |
59
|
| structure length |
217
|
| sequence length |
217
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
1.5.1.34: 6,7-dihydropteridine reductase. |
| pdb deposition date | 2003-03-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00881 | Nitroreductase | Nitroreductase family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | NADH Oxidase | NADH Oxidase |
#chains in the Genus database with same CATH superfamily 4TTC A; 4BNB A; 2HAY A; 1OOQ A; 2I7H A; 2WZW A; 5KRD A; 3GE5 A; 3X22 A; 2WZV A; 4URP A; 1OO6 A; 4G8S A; 3HZN A; 3K6H A; 1VKW A; 4XOQ A; 1VFR A; 2B67 A; 3M5K A; 3N2S A; 4DN2 A; 2FRE A; 3TO0 A; 3EK3 A; 2YMV A; 2ISJ A; 3GBH A; 1YLU A; 3PXV A; 1ZCH A; 3BM1 A; 4QLY A; 4XOO A; 3GR3 A; 4QLX A; 3GE6 A; 3EO7 A; 5KO8 A; 3E10 A; 2R01 A; 1NEC A; 4BN6 A; 3GFA A; 5HDJ A; 1YWQ A; 1YKI A; 3GFD A; 3G14 A; 1F5V A; 2WQF A; 1KQC A; 4TTB A; 1IDT A; 3X21 A; 1BKJ A; 1YLR A; 3OF4 A; 4BN7 A; 1OON A; 2H0U A; 1NOX A; 1DS7 A; 3GB5 A; 1V5Y A; 3GAG A; 3BM2 A; 3GH8 A; 1ICV A; 3H4O A; 5J6C A; 4XOM A; 3KWK A; 3E39 A; 1KQD A; 5KO7 A; 2ISL A; 3EOF A; 3QDL A; 1OO5 A; 3EO8 A; 4EO3 A; 4BN9 A; 1ICR A; 1V5Z A; 3HJ9 A; 2BKJ A; 1ICU A; 2ISK A; 3KOQ A; 1KQB A; 2IFA A; 5HEI A; 3HOI A; 4BN8 A; 3TNZ A; 3BEM A; #chains in the Genus database with same CATH topology 4TTC A; 4BNB A; 2HAY A; 1OOQ A; 2I7H A; 2WZW A; 5KRD A; 3GE5 A; 3X22 A; 2WZV A; 4URP A; 1OO6 A; 4G8S A; 3HZN A; 3K6H A; 1VKW A; 4XOQ A; 1VFR A; 2B67 A; 3M5K A; 3N2S A; 4DN2 A; 2FRE A; 3TO0 A; 3EK3 A; 2YMV A; 2ISJ A; 3GBH A; 1YLU A; 3PXV A; 1ZCH A; 3BM1 A; 4QLY A; 4XOO A; 3GR3 A; 4QLX A; 3GE6 A; 3EO7 A; 5KO8 A; 3E10 A; 2R01 A; 1NEC A; 4BN6 A; 3GFA A; 5HDJ A; 1YWQ A; 1YKI A; 3GFD A; 3G14 A; 1F5V A; 2WQF A; 1KQC A; 4TTB A; 1IDT A; 3X21 A; 1BKJ A; 1YLR A; 3OF4 A; 4BN7 A; 1OON A; 2H0U A; 1NOX A; 1DS7 A; 3GB5 A; 1V5Y A; 3GAG A; 3BM2 A; 3GH8 A; 1ICV A; 3H4O A; 5J6C A; 4XOM A; 3KWK A; 3E39 A; 1KQD A; 5KO7 A; 2ISL A; 3EOF A; 3QDL A; 1OO5 A; 3EO8 A; 4EO3 A; 4BN9 A; 1ICR A; 1J6R A; 1V5Z A; 3HJ9 A; 2BKJ A; 1ICU A; 2ISK A; 3KOQ A; 1KQB A; 2IFA A; 5HEI A; 3HOI A; 4BN8 A; 3TNZ A; 3BEM A; #chains in the Genus database with same CATH homology 4TTC A; 4BNB A; 2HAY A; 1OOQ A; 2I7H A; 2WZW A; 5KRD A; 3GE5 A; 3X22 A; 2WZV A; 4URP A; 1OO6 A; 4G8S A; 3HZN A; 3K6H A; 1VKW A; 4XOQ A; 1VFR A; 2B67 A; 3M5K A; 3N2S A; 4DN2 A; 2FRE A; 3TO0 A; 3EK3 A; 2YMV A; 2ISJ A; 3GBH A; 1YLU A; 3PXV A; 1ZCH A; 3BM1 A; 4QLY A; 4XOO A; 3GR3 A; 4QLX A; 3GE6 A; 3EO7 A; 5KO8 A; 3E10 A; 2R01 A; 1NEC A; 4BN6 A; 3GFA A; 5HDJ A; 1YWQ A; 1YKI A; 3GFD A; 3G14 A; 1F5V A; 2WQF A; 1KQC A; 4TTB A; 1IDT A; 3X21 A; 1BKJ A; 1YLR A; 3OF4 A; 4BN7 A; 1OON A; 2H0U A; 1NOX A; 1DS7 A; 3GB5 A; 1V5Y A; 3GAG A; 3BM2 A; 3GH8 A; 1ICV A; 3H4O A; 5J6C A; 4XOM A; 3KWK A; 3E39 A; 1KQD A; 5KO7 A; 2ISL A; 3EOF A; 3QDL A; 1OO5 A; 3EO8 A; 4EO3 A; 4BN9 A; 1ICR A; 1J6R A; 1V5Z A; 3HJ9 A; 2BKJ A; 1ICU A; 2ISK A; 3KOQ A; 1KQB A; 2IFA A; 5HEI A; 3HOI A; 4BN8 A; 3TNZ A; 3BEM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
