1WNYA

Isoleucyl-trna synthetase editing domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
DPSVYVRFPLKEPKKLGLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRKLLGEGTPVLKTFPGKALEGLPYTPPYPQALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFREANRAILRDLRGRGLLFKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for substrate recognition by the editing domain of isoleucyl-tRNA synthetase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords isoleucyl-trna synthetase
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 6.1.1.5: Isoleucine--tRNA ligase.
pdb deposition date 2004-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wnyA00
2AJIA 4K48A 3O0AA 4ARCA 2BYTA 4CQNA 1QU3A 1WNZA 1IVSA 1JZSA 2WFEA 5AGHA 1JZQA 3ZJVA 3ZJUA 4K47A 2AJHA 1QU2A 4AQ7A 1WKAA 5AGSA 3ZGZA 3ZJTA 3PZ5A 3PZ6A 1ILEA 1WNYA 1H3NA 1OBHA 5AGRA 1WK9A 1WKBA 3PZ0A 2WFDA 2V0GA 5AGIA 5AGJA 4ARIA 2AJGA 2V0CA 2WFGA 1OBCA 1FFYA 5AGTA 1WZ2A 2BTEA 1GAXA 1WK8A 1UDZA 4AS1A 1UE0A
chains in the Genus database with same CATH superfamily
2AJIA 4K48A 3O0AA 4ARCA 2BYTA 4CQNA 1QU3A 1WNZA 1IVSA 1JZSA 2WFEA 5AGHA 1JZQA 3ZJVA 3ZJUA 4K47A 2AJHA 1QU2A 4AQ7A 1WKAA 5AGSA 3ZGZA 3ZJTA 3PZ5A 3PZ6A 1ILEA 1WNYA 1H3NA 1OBHA 5AGRA 1WK9A 1WKBA 3PZ0A 2WFDA 2V0GA 5AGIA 5AGJA 4ARIA 2AJGA 2V0CA 2WFGA 1OBCA 1FFYA 5AGTA 1WZ2A 2BTEA 1GAXA 1WK8A 1UDZA 4AS1A 1UE0A
chains in the Genus database with same CATH topology
2AJIA 4K48A 3O0AA 4ARCA 2BYTA 4CQNA 1QU3A 1WNZA 1IVSA 1JZSA 2WFEA 5AGHA 1JZQA 3ZJVA 3ZJUA 4K47A 2AJHA 1QU2A 4AQ7A 1WKAA 5AGSA 3ZGZA 3ZJTA 3PZ5A 3PZ6A 1ILEA 1WNYA 1H3NA 1OBHA 5AGRA 1WK9A 1WKBA 3PZ0A 2WFDA 2V0GA 5AGIA 5AGJA 4ARIA 2AJGA 2V0CA 2WFGA 1OBCA 1FFYA 5AGTA 1WZ2A 2BTEA 1GAXA 1WK8A 1UDZA 4AS1A 1UE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJI A;  4K48 A;  3O0A A;  4ARC A;  2BYT A;  4CQN A;  1QU3 A;  1WNZ A;  1IVS A;  1JZS A;  2WFE A;  5AGH A;  1JZQ A;  3ZJV A;  3ZJU A;  4K47 A;  2AJH A;  1QU2 A;  4AQ7 A;  1WKA A;  5AGS A;  3ZGZ A;  3ZJT A;  3PZ5 A;  3PZ6 A;  1ILE A;  1WNY A;  1H3N A;  1OBH A;  5AGR A;  1WK9 A;  1WKB A;  3PZ0 A;  2WFD A;  2V0G A;  5AGI A;  5AGJ A;  4ARI A;  2AJG A;  2V0C A;  2WFG A;  1OBC A;  1FFY A;  5AGT A;  1WZ2 A;  2BTE A;  1GAX A;  1WK8 A;  1UDZ A;  4AS1 A;  1UE0 A; 
#chains in the Genus database with same CATH topology
 2AJI A;  4K48 A;  3O0A A;  4ARC A;  2BYT A;  4CQN A;  1QU3 A;  1WNZ A;  1IVS A;  1JZS A;  2WFE A;  5AGH A;  1JZQ A;  3ZJV A;  3ZJU A;  4K47 A;  2AJH A;  1QU2 A;  4AQ7 A;  1WKA A;  5AGS A;  3ZGZ A;  3ZJT A;  3PZ5 A;  3PZ6 A;  1ILE A;  1WNY A;  1H3N A;  1OBH A;  5AGR A;  1WK9 A;  1WKB A;  3PZ0 A;  2WFD A;  2V0G A;  5AGI A;  5AGJ A;  4ARI A;  2AJG A;  2V0C A;  2WFG A;  1OBC A;  1FFY A;  5AGT A;  1WZ2 A;  2BTE A;  1GAX A;  1WK8 A;  1UDZ A;  4AS1 A;  1UE0 A; 
#chains in the Genus database with same CATH homology
 2AJI A;  4K48 A;  3O0A A;  4ARC A;  2BYT A;  4CQN A;  1QU3 A;  1WNZ A;  1IVS A;  1JZS A;  2WFE A;  5AGH A;  1JZQ A;  3ZJV A;  3ZJU A;  4K47 A;  2AJH A;  1QU2 A;  4AQ7 A;  1WKA A;  5AGS A;  3ZGZ A;  3ZJT A;  3PZ5 A;  3PZ6 A;  1ILE A;  1WNY A;  1H3N A;  1OBH A;  5AGR A;  1WK9 A;  1WKB A;  3PZ0 A;  2WFD A;  2V0G A;  5AGI A;  5AGJ A;  4ARI A;  2AJG A;  2V0C A;  2WFG A;  1OBC A;  1FFY A;  5AGT A;  1WZ2 A;  2BTE A;  1GAX A;  1WK8 A;  1UDZ A;  4AS1 A;  1UE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...