1WKBA

Crystal structure of leucyl-trna synthetase from the archaeon pyrococcus horikoshii reveals a novel editing domain orientation
Total Genus 282
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
282
sequence length
807
structure length
791
Chain Sequence
LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-tRNA synthetase
publication title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 282
structure length 791
sequence length 807
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 1wkbA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1wkbA01
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wkbA02
4MUHA 4MW4A 3Q4GA 4JYZA 5F23A 2QTNA 1Q19A 1JEDA 3SP1A 5TEWA 4KR7A 3TQOA 1IH8A 2GOYA 2HMAA 3FG9A 1K4KA 2X3FA 4PBRA 1O96A 3P52A 3FIUA 1Q11A 4U7JA 3ISJA 3TZLA 1NYLA 1M8JA 4MWDA 2BTEA 3CVVA 4G5YA 5AHWA 1NI5A 3GUZA 3H99A 2QUHA 4JXXA 1H3NA 4R2LA 3MLAA 4G5FA 3DLAA 3H9CA 1N1DA 3SYTA 3FDXA 1HYBA 2VXOA 2Z3VA 3HL4A 1J1ZA 2IELA 2QTRA 1KQPA 3M5WA 1JMVA 3CLTD 3ND6A 4DDMA 2QTMA 2WFDA 1N2OA 1GZUA 1O97D 2WB2A 3TZEA 1WK8A 2E21A 2J07A 4ZT2A 4K48A 4ZT5A 1GLNA 3P0IA 1Q15A 1G8GA 1XNJA 4ZCSA 4EG4A 5HUJA 1I2DA 3IMCA 2PIDA 1WXFA 3X1MA 3A04A 4P2BA 2CYBA 3MXTA 2R5WA 4BWVA 3ND7A 1OWPA 1O0CA 1X8XA 2WQ6A 3CVWA 3KT0A 1PFUA 4L2IA 4MW5A 2JA2A 1F7UA 4ZCQA 3O0AA 1TYCA 4NZPA 2Z08A 3IODA 3CVYA 2HZ7A 1WOYA 1N2BA 3I05A 4RPIA 4MW0A 2DXIA 5DEOA 1KQOA 4MVYA 4NAUA 1R6XA 4ARIA 3ELBA 1G8HA 1VLHA 1EXDA 2QUJA 2E18A 4KPUB 3RBAA 1WJGA 1M83A 1JIIA 3L93A 1OBCA 4EG6A 1ILEA 2GKSA 4U8HA 4R2MA 3SEZA 2V0CA 2AJHA 1VBNA 1O94C 3DV2A 3IVCA 5J5AA 3A2KA 3C8ZA 3D6VA 4K0RA 4MUEA 1T6XA 3N8HA 4CQNA 5DASA 1K97A 1N2JA 1PG2A 1KP3A 1T9GS 4OUDB 2PZ8A 3AFHA 3FETA 4GRIA 5AGTA 1X6VA 1IRXA 4EG3A 1KKUA 3Q12A 2IP1A 3PRHA 1IFXA 1TYAE 4J75A 1V47A 2AG6A 4XFJA 4DE5A 1WY5A 1N3LA 1NZJA 3ZJTA 1YUMA 4ND6A 1WK9A 1JGTA 4EG1A 1OWLA 3VGJA 3AKZA 5AGJA 2CV1A 3N9IA 1YIDA 1O5TA 1FFYA 3PZ0A 4ZT6A 2A1UB 4MWBA 1O94D 2PFSA 2YXNA 3HV0A 3KFLA 4KKVA 1TEZA 1QRTA 2A7XA 1GN8A 3MLBA 1EFPA 3UC5A 3RK0A 1GPMA 3UK2A 3KT6A 2V0GA 4DJAA 1MB9A 1EJ2A 3TNJA 2WFGA 1RQGA 5EKDA 3ZGZA 1H1TA 2QJOA 3RJZA 1QRUA 1GAXA 1WNZA 1JECA 5AGIA 3IUBA 1O0BA 1WQ3A 1NP7A 3IDFA 2EJCA 3CLTC 3BL5A 1U0BB 1F7VA 3X1KA 1WXGA 2A84A 4MW9A 3PZ6A 1O97C 4MAFA 1PFWA 1U3DA 4S1OA 4PBSA 3N05A 5H16A 4YP5A 3KT8A 3SDBA 4ZT7A 3AL0C 1KAMA 4I6JA 1U7DA 1TYBE 4KPUA 5DB4A 1PG0A 3N2YA 3D6UA 3IOBA 2QJTA 3TQIA 2J5BA 4JFAA 4HPWA 1JZQA 3RK1A 1OWMA 1N2IA 1R6UA 2B7LA 4MUIA 1T9GR 1QNFA 5KWVA 4DLPA 2O8VA 1MAWA 2J08A 4MQ6A 4OUDA 1CT9A 1H3EA 5AGSA 1NUUA 1YUNA 3VRHA 1DNPA 1T6ZA 1M8KA 4HJRA 3P0JA 1K4MA 5BNZA 1ZUNA 3COVA 4UZFA 2DR2A 1KORA 4TS1A 1EUYA 1JZSA 2ZUEA 1OD6A 2JAXA 3OTWA 4MVWA 3ZJUA 4DDHA 1TQ8A 1NSYA 3AG5A 1A8HA 4HK4A 1KQNA 3HMQA 3IVGA 1KH2A 3H05A 1H3FA 3IVXA 5JBNA 4EGAA 4K03A 1QRSA 4DNXA 3U1VA 3IH5A 1YI8A 1LI7A 3FHJA 3CVXA 4QREA 4MUGA 1G8FA 2QJFA 1NUTA 4ZCPA 1O6BA 3IMGA 4ZCRA 2X1MA 4EG7A 3P0HA 1S4MA 4MUJA 4Q93A 2DERA 3ZXSA 1V8FA 3INNA 2AJIA 1TYDE 1I6KA 3QTBA 3CLUD 2A1TS 3UY4A 1N2EA 5LFAA 3F3MA 1KAQA 4PBTA 3UMVA 1ULHA 3TS1A 2PZBA 3K32A 4NDAA 1I6LA 3CLSC 3IOCA 2DEUA 1MC1A 5J59A 4HJXA 4YBRA 3PXUA 5TGTA 1KH1A 1IHOA 1XJQA 3AG6A 3DPIA 3OP1A 3QE4A 2RE8A 3LCJA 3IMEA 3ND5A 1M8PA 4Q16A 3KT3A 2A86A 5K0SA 3K9WA 1OBHA 2C5SA 4RUKA 1IQ0A 5K0TA 4XFDA 1VBMA 2E89A 3ZJVA 2J4DA 4F4HA 3ZUGA 1F4LA 1WXIA 4MVCA 4CDMA 3COZA 4MW2A 5DK4A 4KR9A 2XRZA 1YULA 3COYA 3CLSD 3GMIA 1YIAA 3H9BA 2EL7A 5KHAA 1P7PA 2ZUFA 4MW6A 4MWEA 4J76A 3NBAA 4EFKA 4ZT4A 2Z09A 3A4IA 4R0NA 5IHXA 2G36A 5HG0A 1O95C 3PZ5A 3ZXIA 1IVSA 1MRZA 3CLRD 1IQUA 1NURA 3X1JA 3FWKA 4QBTA 1J1UA 4EG8A 5FO0A 1LI5A 1IQRA 2CFOA 2PZAA 1B6TA 3H97A 1OWOA 3HGMA 2TS1A 2QUKA 5IJXA 1U3CA 1MOPA 4K47A 2A1TR 2DLCX 4I6EA 2NSYA 2PXHA 4EG5A 4YP7A 4NX2A 3Q10A 2OQ2A 5LM3A 1OWNA 1LW7A 3DO8A 1WZ2A 4EF6A 1PFYA 5HUHA 4MWCA 1NUPA 1JHDA 4MLPA 2I1LA 1M8GA 5FNZA 1J09A 1O95D 2ZP1A 4DDKA 1EE1A 2E0IA 1MJHA 3LE8A 3VU8A 1MBZA 2CYCA 2DPLA 3HFJA 1UDZA 1JIKA 4GU5A 5KCMA 3ZIUA 3FI0A 4YP6A 3G6KA 2BYTA 4PY2A 1EFVB 2IJGX 3SZGA 1UFVA 4KR6A 1N77A 1M1ZA 1BS2A 3CLUC 1N78A 1QJCA 2XRYA 4ZCTA 1D2RA 1QTQA 1TFUA 4MULA 2NZ2A 2D5BA 4AS1A 5TS2A 2WQ7A 2D54A 1ZH0A 4ND7A 1MB2A 2A1UA 4QRDA 3FH0A 4XSVA 1XNGA 1KH3A 3CR8A 2X1LA 1WXHA 1QU3A 1N75A 1FYDA 1R6TA 1COZA 1EUQA 1J21A 2QUIA 1EFPB 1I6MA 2JANA 3E27A 2X0KA 2YWCA 4MVXA 1T6YA 2AKEA 2CUZA 3CVUA 3UOWA 4YMIA 2VTBB 2J09A 1NUSA 2AJGA 4F3RA 3PNBA 4UZEA 3PNVA 5FO1A 4AQ7A 1SURA 5TEVA 3G5AA 2H2AA 3MUEA 1QU2A 4NAHA 1O96B 4ZT3A 3SZ3A 1WKAA 1VBKA 3MMXA 5AGHA 3PNYA 2WSIA 3A05A 4CDNA 3FOCA 1NUQA 2HGZA 1G59A 3QTTA 3IOEA 5H7XA 5LLTA 4MW1A 3SEQA 1JILA 2CV2A 1JEEA 2CYAA 4MUKA 1KR2A 2CSXA 2YWBA 3IUEA 3CLRC 1WNYA 4MW7A 1VL2A 4WSOA 4A91A 3COWA 1XNHA 1KP2A 5J58A 3NV7A 1MAUA 5AGRA 1J70A 3RFFA 3L92A 2AZXA 4I6GA 1EFVA 4JZYA 1M8FA 3LOQA 4X0EA 4MUNA 2O5RA 1PFVA 2H29A 3JXEA 4WNYA 4H3SA 2A88A 4ARCA 3ILVA 4FZJA 2D13A 1JIJA 2GM3A 1F9AA 1WKBA 1ZJWA 4U63A 2OV4A 1UE0A 1Y42X 3FNRA 1ZH6A 2WFEA 1N2GA 2DETA 1WXEA 3FY4A 2CV0A 2YY5A 4JXZA 1J20A 4OJMX 1WQ4A 2CT8A 4L2IB 3RHSA 2DUMA 2RD2A 3NBKA 4NATA 3AIIA 1Q77A 4CT0A 3GLVA 4MUFA 1GTRA 3G59A 4G6ZA 1N2HA 1GTSA 2PG3A 1QQTA 4E1AA 3S3TA 1U7XA 2A4MA 3CA8A 3HZRA 2VTBA 1K92A
chains in the Genus database with same CATH superfamily
2WQZA 5AR1A 3LP8A 3Q7SA 1I36A 4D56A 3R24A 5F23A 1JEDA 1EGVB 4KDFA 2IKQA 3D3KA 3RKUA 4G1UC 2OKCA 1G5RA 4QXQA 3B5IA 3JQQA 1C0IA 3T6KA 1CP3A 4C04A 5CB4F 3RAEC 1RPAA 4CR6A 5BVGA 1NLYA 1BRMA 1XHFA 3P2OA 3RGGA 4IX1A 2QD1A 4F45A 3GLQA 2ZBVA 4IIXA 4LJAA 5DNAA 4MDEA 3ELDA 1TMGE 1Y7IA 5FDFA 5GOZA 4MROA 1H4SA 2LUOA 4DV4B 3B6IA 3F96A 3QIAA 3SIPA 3GD5A 4KQHA 4EGJA 2C97A 4RQTA 5BN5B 1VPDA 3MILA 3TYXA 2Y99A 1L7BA 1YVPA 1GNTA 1A76A 4NPCA 1U6KA 2ZSDA 4KITB 2C9MA 3MLAA 2IZ7A 3QFRA 4JVSB 4HNQA 3SR3A 4XRGA 4KQ1A 3SVLA 1QBKC 1KYZA 1UR5A 4LTDA 3U3OA 3WDSA 4AF8A 3MWLA 3INTA 5AKHA 4F96A 3TJZA 3FDXA 5M29A 4PYLA 2QBYA 1HYBA 3PV0A 1W5SA 5ED4A 2QL9A 1K6IA 4PLWA 4XVHA 2JRLA 4DEVA 3OTHA 5BNWA 3KPWA 2VQSA 4PQGA 4O5OA 4BU1A 3KQSA 2JZOA 1U8ZA 2YV1A 3OHSX 2VDRB 3MW8A 3AY3A 5G0TA 1LQTA 3ANXA 3FPLA 2G5TA 4RS3A 4BQIA 4D74A 1OZGA 1T3GA 3F46A 2C8JA 3PEEA 3NBFA 3LDAA 1FLNA 3TSZA 1E62A 2QL7A 2PUJA 4DVGA 5E38A 5B3LA 4DWVA 4OK5A 4RFSB 3MHTA 3WSTA 1KI2A 1N57A 1M1UA 3Q8KA 2ZLBA 3TG2A 2FMUA 2PUGA 5K09A 3FJOA 2GYVA 2FLVA 1ZM9A 4FINA 2E48A 1PR1A 3HS3A 2CLSA 5JMPA 2WWVD 2D1RA 4Q1BA 2OUKA 1K6XA 4G56A 4CQLB 2O14A 3DFFA 3WLLA 3I09A 5DTEA 1Q3KA 3CG0A 3D4BA 4N3GA 4WA7A 1PFUA 4NIMA 5HEKA 3NB0A 3VM6A 1SWVA 4PRKA 2I29A 4N8DA 2DPGA 4PZPA 4RU1A 4UATA 3JALA 4EPTA 1ODSA 2PVCA 2IDKA 3I1YA 4QNNA 1WB9A 3UJHA 3ZEAA 2IPLA 1Q3TA 5TPWB 1YRQA 3I30X 2GCEA 4MJ3A 1I4WA 1VG9B 2JFXA 4X1IB 3E0QA 2DUWA 1U2PA 3KQVA 3CC8A 1GUBA 4PLYA 1NV8A 4KRXA 3U4MA 3E15A 2P9TA 3B2NA 4G1FA 4N8SA 4C5CA 1ORVA 2GJ4A 1YR2A 3DLIA 3OTQA 1P31A 1VHTA 5T67A 2J9FB 3ITNA 4RGVA 4JI4B 1ILEA 1ADFA 1M2VA 3I3SR 4XIFA 3SEZA 1DFHA 3UUWA 3RFVA 5H82A 1D5WA 1QH0A 3GC6A 2YVKA 3FMFA 3DV2A 4O4JF 3VZCA 2Y27A 3DA8A 5TE9A 3PL5A 3V7FA 4S04A 2GRUA 1EVJA 3QWHA 5M7EA 1GSIA 3NALA 4MP6A 5CVEA 1A7UA 1DEOA 2EOAA 5TVGA 2OCKA 3C74A 1F5NA 4QOHA 2OMKA 3CE6A 1OA1A 2BFFA 1TPZA 3M3PA 3OPYI 5IANA 2HFKA 2JJYA 4FEAA 1XD9A 4KFRA 2BTQA 1U8XX 3BJIC 4CKXA 3T3NA 5EMJA 4C0HA 2GNPA 2GFQA 2QSZA 4G1MB 4KMSA 4XSGA 4DDVA 4LZJA 2G76A 1V4VA 3IO3A 3N7AA 4JROA 3WMFA 3PUZA 1T2NA 1PZXA 2CNNA 3IS3A 3UMSA 1IZ0A 2IGBA 2OB1A 1QIFA 2QTTA 5DI3A 5ELMA 3AR6A 3ZHBA 4DIMA 1R10A 3VR0A 3EPLA 5AGJA 3PFHA 5HIAA 4OI4A 3GO4A 2H2GA 4Q3CA 4BV9A 5JH7F 1PGOA 6AT1A 2I7CA 3LT0A 4RYLA 1Y3CE 2JCBA 1DPGA 1QCCA 1SXJB 2C1ZA 4DA7A 4MUAA 1TLFA 2V6IA 3A6LA 4MUBA 4AZ0A 3O84A 3EQ9A 5CGQB 5A7HA 5LOVF 4NDZA 2IXDA 4QQRA 2F64A 4XVRA 2BFBB 1PVVA 4Y2RA 3ZGYA 3PE3A 2E4ZA 1GFZA 4E46A 3HYCA 5AVRA 3IDSA 3LH5A 3EG5A 3WADA 2VSOA 5L3SB 3OZSA 2ZDHA 3C41J 4J91A 1A8UA 1IK4A 2QHXA 1MFPA 1QANA 1P3Y1 2R11A 3HKCA 4JI8B 1L4EA 1EA7A 5I7AA 1NMSA 2DULA 3IKVA 3OX1A 1MA3A 4DRYA 2JCVA 3PZ6A 4MAFA 3ENWA 2VTDA 3B6JA 3E9MA 1NVVR 4UUAA 2GO1A 4UOEA 2DBYA 1QG0A 5KYYB 4OQLA 1RKBA 4DSUA 2ZI6A 2NQ8A 4ZOLF 1YQUA 5KTKA 4IVRA 1TJ4A 5JXJA 5A3RA 3AL0C 5LYJF 3ONVA 3KO8A 1T9BA 5DVZA 2Q6OA 4KPUA 2ZT6A 4YRDA 3OZVA 2FSVC 1ST2A 3K5IA 5DM2A 2QLJA 5LQMA 1ENZA 2OZLB 4Q9DA 3QJYA 1YAHA 4QO7A 3TFQA 2P5UA 3IOBA 1JHOA 1FNCA 3F98A 2JW5A 1X80B 1QV6A 1Z35A 5KOIA 1OJLA 1QFXA 3IUPA 4E3ZA 2F1KA 2QOEA 3C1UA 3DHYA 2F4NA 1QZZA 2C03A 3QVMA 3W6ZA 4ZYTA 1L7MA 5TMBA 1OPXA 4CLOB 2KI5A 4N7RA 1L7DA 3SXUA 3ES9A 5CP8A 1G5PA 2PQMA 1UBHS 1UINA 2JAPA 2V5UA 4R8KA 4HJRA 1TMKA 2R7KA 2E4VA 2O5EA 1X38A 4J2TA 1E2UA 3ZCRA 2XODA 4FR5A 2ZSUA 4KRGA 3SICE 3V4RA 1U1FA 5A1JA 2XKBA 4RK7A 4NV3A 3EAQA 2OY0A 2WDPA 4Z9BA 2ZUEA 1GG9A 1MT3A 3JD1A 2GNOA 2NSJA 3OY7A 1M1NB 4OLAA 3TX2A 5I4BA 2W2PA 4I55A 3AYZB 3KZCA 3RJ5A 4BFSA 2QN8A 3OQJA 4Y2VA 3K0BA 3QUCA 2QAGC 4JGGA 3LP5A 4KLZA 4OQNA 4CHGA 1UJ6A 4CLDA 5HCUA 3AXSA 3CT4A 1A7AA 2IQ5A 4H60A 5AI9A 1Z5UA 2VWQA 3HDVA 1YC2A 2JIBA 3V2HA 4QREA 2HRQA 5HF6A 2AA3A 3R5KA 5LZ9A 3L77A 1WSBA 4QLOA 3V9PA 2HIAA 2HADA 1BHJA 3LKBA 2JAWA 2ZSHA 4OXRA 3LQYA 3SQDA 4EPWA 5ERYA 3UKDA 1H66A 2YFHA 3KVOA 1CYDA 3KVRA 1GCGA 1HA3A 1RC1A 3CNLA 2EZ4A 2VPIA 1W29A 3F9IA 3MXOA 2TYSB 1BFKA 1G4UR 5ECGC 2E4YA 4QWWA 1DKMA 2J7KA 3F3MA 3F5DA 1BEEA 3NKFA 1HRKA 1E5LA 2BF7A 4PR0A 1LPPA 1RKVA 2JB9A 1Z2AA 3ZPXA 2PQ0A 3TKYA 3VZDA 2TSYB 3GEEA 4C7VA 4KXFB 2AV6A 1OFUX 3H6GA 4GE0A 4PYNA 2VJDA 5C5DA 5KDOA 4PG4A 5CW2A 2DWOA 4ISBA 1OQAA 3BA6A 2EC5A 2YIJA 3DYVA 3C3JA 3QE4A 1WDKA 2BDUA 1WVGA 4TVKA 1GGEA 4BMVA 2B1GA 8AT1A 2ZCUA 2YRXA 4H4CA 3IDOA 4JI2B 3B1ZA 1LDGA 3QBVA 1OBHA 3DAFA 1IM5A 3VHXA 2BY4A 1EG2A 4Q9JA 1H05A 3W5CA 2BEKA 3DOJA 4YACA 4H4DA 1DKPA 4IILA 4L0MA 4MI3A 1H93A 3KXDA 3MTGA 1G1MA 1FFGA 4KYIB 5EXTA 3WTBA 2Q3DA 1AS3A 3NTQA 2PWZA 4HB0A 4AS2A 3RJ9A 1P7VA 2ACKA 1WB4A 1WU8A 3I04A 2WIKA 4FFWA 1PJBA 1E3TA 2VRBA 1AKEA 4TKUA 2ZJ5A 2GILA 2CFRA 3JR7A 3LDUA 4R8SA 4URZR 4LJYA 4BDSA 1AH2A 2HB6A 4Q4JB 1HDCA 1M74A 1ZBDA 3RR2A 4GLBA 3UUFA 4BCDA 2R1TB 3T3MB 3EIWA 4IDEA 2ZUVA 2RGYA 1FMLA 1G7RA 2LXNA 3AHHA 3ICPA 3P2KA 5C7LO 1FMFA 2MU1A 1QUFA 3SZOA 2E87A 1L7OA 3T0FA 2YV5A 5IBCA 3EXIB 3LYHA 3MZ0A 4JBIA 1RXIA 3WRYC 5FV4A 4AF7A 3DR5A 6Q21A 4WN9B 4FWIB 4MP8A 5JJCA 2G3YA 4LJLA 3SG0A 2I8AA 4G67A 1Q20A 3AI7A 3LPLA 4WDQA 3I28A 5AK0A 3KSUA 2DPHA 4L9AA 4DR4B 1Q95A 2VUIB 3H1EA 2UXCB 5F3RA 1L5OA 2ZAMA 4I4IA 4W7HA 1VG8A 3FRIA 3FGOA 4IDCA 3GP8A 2ZRKA 4Z1OA 1PTJC 1ZO8A 3GJTA 1JWBB 1NXXA 2G67A 4H0NA 3TTUA 3RNOA 3ESXA 4MVJE 3UZUA 1FFCA 3OPQA 4ZAXA 5LLSA 1UM8A 4G0UA 3H11B 1K7SN 3JWJA 4FK8A 4JB0A 3SSMA 4YRBA 1VRCA 2B21A 2VK4A 4Q1AA 1GG5A 1RRKA 3RYHB 4KXQA 3D8RA 1MT0A 3HLYA 5FNZA 4FEEA 1K68A 1YQTA 2XWBF 5KU1A 4UHFA 1ZD1A 3KTFA 1JHMA 2YDXA 3RSOA 1D6SA 1FDWA 1ZUIA 3C8DA 5DHRA 3TSWA 3HFJA 4CIDA 7ABPA 4G81A 4RH0A 2MR5A 2ZB8A 3E81A 4YJDA 1J8DA 2IEDA 3BMOB 4JGIA 3WGZA 4OI2A 5ALQA 1Y4DE 4YRJA 2CDCA 5JAMA 3G2HA 1JHXA 1KNQA 1YCFA 3UYLA 1XVTA 1LBQA 3JQ8A 1OH8A 4BAGA 1OREA 2EWWA 2Y0CA 2CHVA 1Q84A 4CQMD 1EGAA 2DPXA 5IUJC 4HP8A 1ZD2P 5TSDA 4NLLA 4YAUA 2PL3A 1E2PA 2AKYA 2Q8QA 2NZ2A 2XQVA 1OC2A 2ZBRA 3OZAA 3VR1A 1PP4A 1GQSA 2V6JA 4JR0A 3PPVA 2FPGB 4JOCA 2VUSA 1E3IA 1HLGA 1WBDA 1G6HA 2WU4A 2XGMA 4LMAA 1UAAA 1YB4A 3NVDA 2VRWA 3BXXA 4QRDA 2NUTB 5BR4A 2UZIR 4P31A 1XWIA 4LDJA 5FBLB 2GARA 4HRYA 4P3NA 1Q6YA 5L45A 5CEEA 1PZGA 3R7SA 3AI3A 3OLCX 4IJWA 4EX6A 1G6KA 1P2VA 2YYYA 3USES 2ZJ7A 2DPYA 2X1LA 2JPDA 4F2DA 2XLBA 2WF9A 5A0TA 3ZU3A 2NIPA 2GAAA 4UJ3A 1BE0A 1H5NA 4WWHA 2QAGA 1JHRA 2KB0A 4ECEA 2E4UA 4JYPA 1NBMD 1MAHA 2VKQA 2JIMA 3HVIA 3FMPB 4EY6A 3NOVA 5B1YA 4Z7JA 2G06A 5DEIA 3DMTC 3K0KA 1M0EA 2HJWA 4I1OA 3FSGD 1W2WB 4BP3A 4G26A 3L4SO 4G63A 4MP3A 4P3PA 1S1MA 3AERA 5KU7A 3A36A 4WECA 4RD4A 5JYCA 1PJ2A 4MHOA 5B58T 1SELA 3F47A 4LHVA 1XELA 5TR9A 4CDRA 4OBWA 4WESB 4UCFA 1ENPA 4ZO4A 5BVGB 1WKAA 2G80A 2J85A 3TCKA 2WIBA 3RLIA 3FOCA 3H2JA 3KB2A 1GPNA 3OE7A 4PTLA 3EB9A 1V16A 2V9ZA 1YZYA 4WBSA 1KMIY 1UDAA 4KVFA 4OIFA 4IIYA 2HBZA 3V2IA 4OMCA 2GKGA 3AKYA 2GR9A 4Q48A 1OVMA 2Z83A 2J9YB 2WG0A 3OU7A 1HEIA 2CSXA 4RELA 1P9RA 4FFBA 4MMXB 1E3SA 2GB4A 1S5PA 5JWHA 4C0QC 4W5QA 1LW6E 3AESB 1W4RA 1SRQA 5KQMA 3COWA 2XVMA 3L4EA 2IHKA 4IJ6A 4F5WA 2I8CA 1LRLA 2CDRA 3FFWA 4FFLA 3UMBA 2H0QA 2PSHA 4IIEA 4GGPA 4MPTA 2GN8A 4HVTA 4JUBA 2LKDA 3MS2A 2CD7A 3ONDA 2P35A 3AO0B 5GJBA 1YVUA 3CT6A 1XT6A 2WWIA 2OGTA 2H29A 2LCFA 3BXOA 4RPGA 1KA9H 1IAQA 1H22A 2EHJA 2Q5IA 3I72A 3JZFA 4PC2A 1EGHA 4CM4A 5AFSA 3UT5A 4BE7B 4LG1A 2R96A 3X43A 4X1KA 2ZRAA 4RMHA 1ZNXA 2DRIA 1Y1RA 3AEXA 3WMRA 1TF5A 1LGYA 1ESNA 2BGIA 2QTWB 2QTAA 2YN0A 3EAGA 3O3CA 1SCIA 4KP7A 4D0NA 3NT2A 1QCDA 5DISB 2Y1DA 3TW8A 2EFCB 1RI2A 1VLQA 2H3EA 1E60A 1DUVG 1KJIA 2ODEA 5IKXA 4OHRA 3TB6A 4MHTA 3CGGA 2R9VA 1PJQA 1V2GA 1WXDA 2EX0A 3MF4A 5B4UA 3VO2A 3O73A 2XYQA 4HL6A 1S89A 4LCJA 4MR7B 4X95A 5K3DA 3R20A 1J97A 2UZ3A 4L0CA 5LBUA 4X5OA 3JALB 1PEDA 3WRYA 5KJCA 3U60B 3Q9SA 3K1ZA 2AUTA 1MFZA 2QUBA 4GI7A 4NMWA 4MVJH 4AP6A 4KWTA 1XL1A 5B57C 3E84A 3V8NA 2B7CA 3TECE 4HATA 4OGFA 2XGGA 5LL6P 4YCAA 4A0RA 1GFIA 3LXXA 3DVSX 3KKNA 1K5HA 2NO1A 3MJVA 1LA2A 1CRLA 5FV7A 2IU6A 1F0PA 2JH8A 2DJ5A 4JWTA 2J67A 3FDIA 5FBVB 3VR4A 1FU8A 3ASZA 3MJEA 4A0HA 1O8CA 3NDBB 4EUFA 1PTJA 2XUIA 3P0FA 4MI1A 4PNHA 2JKZA 1CF9A 4J2OA 3FKSD 2WRZA 2C7GA 4J9UE 1RJGA 4NI5A 2OHIA 4G2NA 1ZP6A 4OHKA 4G5YA 2QD5A 1KQ3A 4BE4A 3MJFA 4YMSA 3KKLA 4O2AA 4FFOA 4YIHA 1DB3A 3L82B 4RDHA 1Y8AA 2VQDA 4KE6A 5E7QA 1QRRA 3DQZA 4DY6A 1J90A 4DG8A 5IVIA 2BFFB 3FJ1A 3DONA 4HX5A 6ABPA 4M1KA 3H9CA 3EEYA 4UU8A 2BTQB 4LFCB 4BLPA 1X14A 2FW1A 1P1KA 2CJXA 1SEPA 2VXOA 3LHSA 5LSAA 1J1ZA 1Z2PX 1L6IA 2DF8A 1F2UA 1T0IA 3A1TA 3IUYA 4HTFA 4I0WB 1IYZA 4ZVKA 2AQHA 4GNRA 4UEWA 3R74A 2Z1NA 1N8KA 1VCMA 2DX7A 2Y66A 1PQYA 5DI3B 5LD2B 1RQLA 2GFHA 3BL6A 3OEHA 4MAMA 3UG7A 2V7TA 2ZETA 2CZCA 2VT6A 2ZBUA 4O08A 1A2KC 2BF4A 4UVEA 1GSOA 5BT8A 2IK8A 2J7PD 3LW8A 1E64A 5CLJA 1BS1A 3D3WA 2Q3MA 1PV4A 2V45A 2WOJA 1T8SA 1SVNA 1E2KA 3DOOA 1BDIA 4JKOA 4MS3A 2OBFA 4CL3A 3KSBC 2VZLA 4GZMA 4WFIA 3JR3A 1DT5A 2CYBA 3T4EA 2DCUA 1XV5A 2OYCA 3T34A 3DB1A 2QZPA 3I58A 1PUJA 2ENWA 3DOCA 4IX9A 4KAXA 2OESA 2XW6A 3WLQA 3QXHA 4WK0B 1UZUA 3CX3A 1VYTA 2G5GX 4HFMA 3Q87B 3DOEA 5D00A 4Z3DA 3ISTA 1VL1A 1T0UA 4DBZA 1XYYA 2CXPA 1ONBA 4AZ3A 1KBQA 3HKCB 4FE4A 3F97A 4DCJA 5AKKA 2V3VA 4IWXA 2G6TA 1XDBA 2HZ7A 3D7NA 4UMFA 1PBTA 5FUWA 2MDTA 2XQKA 3OIUA 4I9UA 3IA7A 3K53A 1KQGA 1UBSB 5CIQA 2H1VA 3SR0A 1ZGAA 2A59A 2CVFA 2JIRA 3SC4A 2IVFA 2VYFA 5KJFA 2X3YA 4TYNA 1G8KA 3TB4A 3LRTA 2E18A 4KPUB 4TMTA 3VMFA 5F51A 3T3HA 3BAZA 5HQ3A 4EPXA 1B6GA 1EWYA 3LBNA 4J16C 4LYFA 5EHIA 5G2OA 3B5EA 2A5GA 4U8HA 5KINB 3TLJA 3RRNA 2JLZA 1OI4A 2GAJA 1Z06A 3DEKA 1G18A 3N8HA 2VO1A 4DB2A 2AS0A 2JFPA 4TS9A 4BFCA 4DIOA 2RHRA 4RA9A 5KTNA 1QCZA 1FW8A 1M1YA 3AM4A 3EG9B 1DAEA 3SXUB 4M9RA 3A2MA 4IUYA 5AGTA 4IO1A 1I2BA 1Q17A 2H17A 2RI0A 2Z5VA 3Q2IA 4OMDA 1NA5A 1GPWB 1KKUA 5AVUA 2IP1A 1QHSA 1YDWA 3USZA 5LIPA 1UFOA 3F67A 1Y4UA 3NXKA 3OICA 3I83A 4BBZA 3L8ZA 5JO0A 2HA2A 2J3IA 1XVAA 3CRVA 2XADA 3L8HA 4A9AA 4CIXA 2C5HA 3TEMA 2DWPA 5C37A 1ZHOA 1B6RA 2IHZA 4I55B 1WY5A 1T5IA 2CKDA 3ZJTA 2H7CA 2OCXA 3OE5A 5ALXA 3ZG6A 2R66A 1N4AA 1JQEA 1OWLA 1OYWA 3AKZA 4LF7B 3WWYA 1JTEA 1VCNA 3PQ7A 1RCUA 1M34E 2CL6X 2WPNA 5DN9A 2PX6A 3V9AA 1OXVA 1JR2A 1SCKA 4KQKA 4RD1A 5A04A 1NY5A 2ZTSA 2Q6LA 4RC9A 4OD0A 2HH9A 4J7XA 2OAQ1 3G8AA 3CH4B 1JDUA 3OCJA 2H4JA 4TTTS 4BMYA 1REQB 2H59A 1E5QA 1TRKA 3QVKA 2VP3A 1Z6AA 2QMEA 1RNLA 4FFPA 4LJ4A 5ALTA 3JCZA 1WBBA 2REQA 3PWTA 3WWDA 3GGDA 3UAGA 2F6RA 1A9YA 3HNRA 3ET5A 3M1IA 4D9GA 2DHDA 3FUWA 1P45A 2ZULA 3RJZA 3E3AA 3LLUA 3T7CA 3X1DA 3BE6A 2EDCA 3ZHQA 4F2WA 4L4SA 5JC1A 3IDFA 1TCAA 1HUQA 1E9FA 4MK4A 1MG0A 2Y9MB 3TAXA 1U0BB 1XTQA 3H2SA 2HA6A 1PJSA 4OHVA 5DLPA 4AKEA 3U5ZB 1JAYA 2B8JA 5DHAA 2PGJA 3K30A 4GYKA 4LK3A 3MAAC 4KFUA 4HN9A 5DYNA 3ZU5A 5EUMA 3D6HA 2J0VA 5DCLA 2VRCA 3UT6A 3WTCA 2P9JA 1GAEO 1V4NA 4NU8X 1ATZA 1Z6GA 3A10A 3PC7A 3DMRA 3HACA 2Y2VA 4ETWA 4QEKA 4OQ4A 1UJBA 3NVMB 1YQXA 4KQIA 1NBIA 4H3VA 1G5IA 1L7NA 4RESA 4YT4A 3KJZA 3QGMA 3AM1A 2DY1A 4TV9B 4ZP1A 1ONSA 5JZMA 4DMHA 5LU9A 3RSZA 1AMOA 1DBVO 3SQWA 1U81A 4IBOA 4FDTA 4CMIA 2GM5A 4FCWA 2G82A 3A58B 3C7CB 2CLHB 4MIEA 5L4NA 5EJ6A 4KX5A 2WVHA 1OWMA 1AU9A 3G23A 5D2CA 3VHXB 4UTVA 3RWBA 5JEEA 1JFTA 1R6UA 4YCMA 3H4VA 4I50B 3PTLA 1X7GA 2W0SA 3CKMA 3N0XA 1RM5A 1ECBA 1OIVA 1ZSNA 2WPDA 3N5CA 3HYTA 3PGVA 3GOHA 4PM4A 4X7BA 5A6SA 3F5QA 1DRJA 3RPEA 1NNI1 1B1CA 3S5UA 3QXXA 4EHDA 4NYIQ 3VRHA 2IYYA 2H7YA 2IWRA 3HG7A 1JQJC 4FQ7A 5ES3A 4TKUB 3AZPA 3MRTA 4XE5A 6REQA 2YS6A 1KVRA 1YFLA 1RJFA 2CVQA 1ORWA 4FNAA 4WL0A 5ALEA 4C2UA 3I4FA 5SYMA 1VE3A 2AGVA 3BWYA 2JAXA 1ZH8A 1DXHA 1K6JA 1XA0A 4OL9A 5SY9A 1L5GB 4BKOA 4DMFA 1E1RD 1PQUA 4YUWA 4ZYUA 1M2OA 4HBZA 2DKFA 1PNVA 3VKWA 2IOYA 2QG9A 3P5BA 2Q3JA 4B6RA 5EHXA 4YPFA 2NM0A 2O4UX 1NJ6A 3RLFA 3H7IA 4BN5A 4WRRA 3VR6A 1UM9B 4NXNB 1TKAA 5HF8A 1NWCA 4HOYA 1C50A 2EKPA 1U8FO 1I9GA 4GX5A 3U1BA 3SQXA 2HWXA 4POAA 4G0WA 4MUGA 3OQPA 1Z62A 2GBPA 2XKAA 1KR5A 3EGVA 1JG2A 2ZT8A 4WACA 4L5YA 1Q22A 3I3OA 3NDRA 3NFRA 1ZCZA 3PEWA 1ML3A 1VA4A 1HOTA 1OFHA 4GICA 3D7SA 2YXBA 1VPWA 1T10A 1UZAA 4PFQA 3RHFA 3ZGXA 2Z2KA 1DADA 3IPAA 4FC6A 1B0PA 2GZSA 4PV7A 4EKIA 4MIKA 3IVRA 1N2EA 5CDSA 3OFVA 4ZOEA 3P26A 1MVOA 4BEWA 1TK2A 3OZBA 3O31A 4BXOB 1QNLA 4BO9A 4OQQA 4RHUA 1YCGA 1SXQA 4PZZA 1PK7A 2O8EA 4JYCA 1NOJA 1S2NA 1D2NA 4B73A 2ZWVA 3MINA 4BQOA 2H54A 4IM7A 1RWPA 1CUBA 2QS9A 1TGVA 3LCJA 4KODA 2W71A 4G5RA 3UHPA 3T9EA 2F00A 4DABA 2IS2A 4IJKA 4QUAA 4KXLA 4DMGA 5K0SA 4DM4A 3CY6A 4S1VA 4X8LA 2VUTA 3JAWA 1DLJA 5GJVC 1DQYA 4P08A 4Q01A 4Y9SA 5LA6B 3ZVLA 5C3MA 5CBKA 2A5FA 1VKJA 3FFTA 3OO1A 4AC9A 1XEFA 4PSVA 5CURA 4YPOA 4MVCA 2H3HA 4FZ3A 1BD4A 3QELA 3E48A 1G9SA 3WL5A 4TKLA 3ZHOA 4XCVA 4W6QA 4TMXA 2KWIA 3UV3A 3THXA 1SU6A 2VK2A 3IP8A 5I7HA 1VMKA 1MGPA 1BTOA 1YIAA 3L6DA 5ALYA 4P9NA 5I9TA 3K8QA 3W5JA 3X0DA 1PD1A 3D6JA 4FYPA 3D5TA 4PLFA 4KQCA 1QDLB 1BWSA 1E20A 3N0RA 4BC0A 4BL5A 3ZDXB 5T6BA 3PGJA 4BVGA 2OPBA 1M2EA 4YV2A 1ZI9A 4HEHA 2QAGB 4COOA 1VDMA 5KC9A 5HIKA 1FUEA 2QN1A 4FKBA 1NKVA 4P5DA 1X1DA 1T5OA 2B4AA 2I22A 2XA2A 4FCTA 1RWNA 4M46A 3LA8A 4LSWA 5F2KA 4F04A 1NIPA 4GOLD 3QFTA 1EHCA 1NURA 3EWAA 3G0GA 4B46A 4RMGA 4ZVTA 1PUIA 3WDMA 5IAAA 2R8EA 3AERB 5K0EA 2XZOA 2YJ3A 3WZLA 4MEJA 1M2KA 1SIWA 2WNHA 2VEOA 2QAJA 1DI0A 4K6MA 3ZK7A 2DLCX 3HUDA 4FMDF 1US8A 2NSYA 3H83A 1XTPA 3RSCA 3TDKA 1C30A 1XK7A 2ESRA 3F4BA 5D3QA 2DUNA 1MOZA 2R87A 3EQZA 3FCUB 4ZYXA 1CVRA 4ZMBA 5JJLA 1NVWQ 4RTQA 2RGDA 2O7NA 4GZ5A 1DX6A 5HUHA 5ADHA 3U3RA 1NUPA 3IBSA 1O0SA 2A58A 4FFBB 1DG9A 5E1MA 1JG1A 1OLXA 2RONA 2E0IA 1L4UA 1COWD 5CT9A 4J7AA 3TNLA 3DBOB 1MBZA 3O38A 3P45A 5ALFA 2ZSBA 4Y7CA 4M0DA 2VBGA 5KNCH 4CEJB 3QK7A 2XUAA 3A1EA 2ZUSA 3GBPA 4F3YA 4OA8A 1FDRA 4I1YA 1CPYA 2CNBA 3ZDBA 5AI0A 4KHZA 2IYXA 2O7RA 4MCJA 5TS3A 5KYTA 3I9LA 5IM4A 1UZMA 3B3AA 3GJ7A 4DEYA 1TZJA 1BS2A 1VRVA 2AJDA 5CM9C 1QJCA 4CM4B 1D2RA 1UDRA 3UT5B 2FRDC 5I4CA 3KPYA 4P7GA 1V3VA 2DUJA 1KFEB 1GA6A 2LZ0A 4X1KB 3TQCA 4A26A 1FNMA 4BDTA 1UKCA 3QF4A 2WQ7A 4ZQBA 4CHTA 1U3FA 3RAGA 4Z53A 2IYWA 4YRSA 3CX8A 1NFQA 4W1QA 4BBJA 3TW8B 2WE8A 4ZHQF 4JX9A 4B75A 3ACDA 2VDOB 1CJMA 2VAXA 5DYGA 3VJRA 2FSFA 4R1OA 3SHOA 3A32A 4ZKEA 3CR8A 3OX3A 3VV2A 4G0XA 3VPFA 1U4NA 3CZMA 1J0DA 3RG8A 4F46A 1QYDA 3QLUA 3HM2A 4WK2B 6YASA 1GNRA 1GSHA 2FN9A 3U4HA 3E27A 3PGA1 4GC9A 4OSPA 2JBAA 4P5PA 3MMNA 4ENRA 5LP6C 2VF8A 3FPAA 1R6VA 4C4AA 3N7UA 5BXQC 1YCHA 4QARA 2WG1A 3HVRA 1SC4A 4KQJA 5GZ6A 1PSDA 2YWFA 4FOLA 3EX7C 2ZG6A 1BHO1 1CLUA 2HT1A 2BKUA 1Q0ZA 1IATA 1Y6RA 3MJDA 4V39A 1Z74A 1ESMA 2OAGA 4JJ7A 1XR3A 2X9GA 3PWSA 4X63A 5GY7A 1EP9A 1GFSA 4MTCA 3VO1A 4NBNA 5K7SA 3PUXA 3SZ3A 2BKAA 2JS7A 1EFHA 3I73A 1XCMA 1ODJA 3VJLA 1Y63A 1ZH4A 4G0VA 1AVTA 1WABA 2FSIA 5ICGA 2R0QC 3CUEF 4EGFA 5K05A 1PHRA 1J22A 1DXQA 1Z0KA 5FI1B 1DBIA 1HTTA 2V6BA 2HSDA 3O4RA 4O2AB 1ZOPA 4LDAA 4W4TA 3QFSA 1RLIA 2FHPA 4QYIA 4Q1CA 3B2QA 3RU3A 4CKYA 4P0QB 2ECFA 3H2ZA 4MUKA 3TL3A 4PS0A 3ZNNA 4ZTBA 3IUEA 2H85A 3KUCA 4IFBA 5CW1A 2NQ2C 5CIYA 1GILA 4IOMA 4QDZA 2P2GA 4E09A 1EXWA 1D6NA 1KMHA 3LBHA 5IYZF 2HPHA 5D87A 5F1PA 5K4HA 2Z9BA 2FHSA 3RRMA 1T8UA 1F2UB 2X7HA 1EX9A 3NEYA 4HTFB 4TQ9A 3N5KA 3EDRA 3SE0A 3W78A 1QH1A 1C4WA 5K03A 3MBIA 4JZYA 4L85A 621PA 3DBRB 3NDPA 3M70A 4DAOA 1YE5A 5HJ7A 1OLSB 4WLOA 2QI9C 2WZQA 4WNYA 3SBEA 2A88A 3V7UA 1B8UA 5IWCA 4ARCA 1Z0ZA 4PC6A 3GLGE 1PNOA 2BZGA 2Z2JA 2YOGA 4B3SB 2I2XB 5M3BA 3HDYA 3G3EA 4XUDA 3WIUA 1R5NA 1KZ6A 3OEEA 5EG5A 3QUBA 3N75A 2CXQA 3AKEA 4MS3B 4PE5B 1G20B 1A4UA 1WXEA 3LO8A 3L6CA 1NOIA 3T52A 2WYWA 2BKXA 5C8YF 5EE5B 2X8AA 2J9ZB 4R1LA 1S2IA 3HZOA 3LBIA 5JR3A 3GVHA 2XBUA 2X23A 1Z08A 4DNOA 2P2SA 5C0OE 2FV8A 1L9XA 1ZI6A 1J2RA 3RTCA 3W3AA 4U7FA 5L4LA 1L8XA 1OBVA 5T3UA 4A1FA 1WUKS 1QQTA 5JZVA 2UVPA 1U7XA 3BCRA 1Z2DA 4BNZA 2QPTA 1DV2A 3OQNA 3IBTA 5KCZA 2OV1A 1CLEA 3CPJB 1PFKA 1Z0IA 3LHDA 3R3XA 4KI0A 4YUAA 3PQDA 5DNYB 1C81A 1EG7A 2M1ZA 4M49A 3UFBA 2J4FA 2Y1OA 2V4MA 3LK7A 3ZD9A 1QTIA 2X3FA 5EUBA 3CF0A 3NBYC 2DHEA 4J1SA 4UVHA 5HQ3B 3J81A 3B9QA 3OIVA 2P0YA 2FNAA 3S2EA 3AP2A 2WV9A 2WUGA 4AL4A 1DC6A 3EXHC 1WVIA 3VNRA 5E7IA 2IIBA 3V6MA 3JVDA 4Q05A 1U4SA 1USIA 1IZZA 1QO0A 4RA9B 4ENVA 2X1VA 4LY3A 1VYUA 4ZI5A 4JLAA 5A4DA 4QVGA 3KYDA 4WZBE 2J46A 3MJHA 4HS4A 4LRUA 4EGSA 1FNDA 2NZVG 2VPYA 2HK8A 2ODNA 1YKGA 4G0YA 4XGRA 3W90A 4E2WA 4GXTA 4CETA 2VPXA 3SYLA 4QA9A 2GZRA 1JPJA 1ID8A 2IELA 4XW2A 3LY8A 4YLGA 1G2PA 5LBIA 5BW4A 4FYMA 1Q1BA 4IH9A 4D02A 2CY0A 4PGFA 4DDMA 1CJUC 2WFDA 4ALJA 1YASA 4BNXA 4CI9A 4MH0R 2ZWOA 3UMMA 1S96A 4JS0A 4AJOA 2ZI4A 4O2LA 1FP4A 1KVTA 2IYQA 3NCHA 5ITSA 1QLJA 2BBSA 4K48A 5LZ8A 1BMDA 1OBOA 4ZT5A 4Y9TA 1Z4OA 3U49A 4I1SA 2Z58A 1XNJA 3WKDA 4E2ZA 2PLFA 5ECWA 2WUEA 4E22A 3U4GA 5JXHA 4RVNA 2Q0XA 3Q3IA 4E6EA 1D07A 2REQB 3HMKA 3OQOA 4KDRA 2R5WA 1CB0A 4BWVA 4CM1A 5JFGA 1W85A 1YFKA 2G77B 4KAJA 4C6RA 1RABA 3HXKA 3BSWA 3UMCA 1P61B 1YOVB 4W1PA 3NDIA 4L9SA 3RREA 2ZJ4A 3CXRA 2ZCVA 4KIJA 2Q5QA 3RYFB 3O0AA 3DFZA 1W5TA 4FNGA 5J47A 1Y3AA 4EH1A 1Z2CA 2Q28A 3NO4A 1DU4A 5LP6A 1KPIA 1E9RA 1PNQA 1R0LA 2RK6A 2WSSA 1RJDA 2F9FA 1FLDA 4MRPA 2C0QA 2PFGA 3I6YA 3KVVA 1KMNA 2WTAA 1NBME 3GLHB 4S2UA 3P2MA 1RQRA 3JD2A 4EVQA 4HNAA 1GVHA 1G60A 1KF0A 2F3PA 4M21A 4PWYA 3BD6A 4D25A 4IRMA 3QVLA 4B4WA 3FHTA 2GUGA 3OIDA 2PYZA 2QPAA 2ODTX 1ZNZA 1BGVA 1M83A 2P2DA 4NP6A 1WSWA 2AEJA 2ZJ1A 3PXDA 1NF8A 4XM1A 5EXEA 2WU3A 1Z5GA 2WSBA 1T3LA 4CMIB 4R1QA 1LNSA 2FQYA 1DL5A 2PDAA 3TSOA 4IUDS 3ZQUA 1CG6A 1G3IA 4RL4A 2WD8A 3DNMA 2XTJA 2LDXA 4QTYA 4WXMA 3Q7QA 5A9SB 1ZL2A 3EC2A 1K9SA 3AVUA 3OLWA 5A6SB 1GFWA 1D5CA 1PR6A 2QXYA 3KQLA 5KNLA 3WXMA 3KUXA 1UIRA 3AFHA 1L5YA 2XCRB 1IY1A 2QD2A 5AMXA 4IMPA 4IS3A 2JFYA 3UA3A 1GQYA 4V02A 3N76A 2HIGA 1TYAE 4JLPA 2Z04A 3H1GA 1JB1A 1QB8A 4QL3A 3QMWA 3RC9A 3PL1A 5EFZA 1K5DA 3OHMA 2QENA 3GAMA 4KRYA 4QOSA 4WZAE 3W7AA 4BRWA 1YRBA 2FOXA 2HMTA 2W8ZA 3QENA 1CHDA 3B1WA 5ALPA 5EKSA 4DE5A 2X2PA 3ASUA 1E7RA 1M2OB 4AVYA 1C41A 3FPEA 1ABEA 3MWKA 2JJQA 4OO3A 2O6HA 2PT6A 2CV1A 1MB3A 2QV7A 5JS7A 5JT1A 4ZT6A 3PRYA 1I3MA 3M3HA 3HV0A 3OU6A 3PEVA 1I7DA 5CVVA 1HKUA 2CFSA 2ZJAA 3GNTA 5HGJA 4Y0AA 2VVTA 3VNUA 2PKCA 3RK0A 4C06A 5BN1A 4KWHA 4DYHA 4QOGA 1XTVA 3IUNA 3FDZA 4ZAWA 3ZI4A 2WTBA 3PDUA 4BN4A 1DIHA 3D4NA 5ALOA 2HU2A 4LY9A 2YJGA 1OHHA 1WNZA 1UMCA 1ZM4A 1TE2A 3M4NA 2CWWA 2FE1A 1LLFA 3GUHA 5HRAA 1RRVA 2H2DA 2HSJA 3IULA 1LJUA 3K0CA 4V38A 1P2BA 5IZCC 4R4JA 4PAQA 2NNWB 4J0DA 4DCCA 4F1WA 1EVYA 1KRXA 1CR1A 2ZJ6A 1P4RA 2V1XA 2QX7A 2W48A 4Y6LA 4YP5A 4CM3A 2AI3A 3ZKWB 1D8TA 3TLKA 3A9WA 1FP7A 1MX3A 3ENKA 1UKEA 1GNPA 3LBFA 1O58A 2HJ9A 3ET4A 4Y0NA 1W5AA 1USUA 1X9GA 3R4VA 1NLUA 2QB5A 2VH1A 5CTAA 2O8EB 3MINB 4RHFA 3LNCA 1XCBA 2REOA 3SN6A 3ESCA 5ITVA 3IJ5A 2BFCB 3V7YA 3WL7A 4HBGA 1S2MA 1TUEA 1ZA2A 4KN8A 3EXHA 3EVTA 3ETCA 3GN1A 3JAWB 3NMUF 1OUMA 4G01B 3L05A 1FDVA 3F9CA 4OK6A 4EJ0A 2X8BA 1X9IA 3UYKA 5BR7A 3HGQA 4A3SA 1RWQA 1ZIXA 1B93A 1NFRA 3FB4A 2MMGA 1Y89A 1KWKA 3TX6A 2VBIA 3L0SA 4TWIA 1JYFA 5AQ1A 3L41A 1VKZA 3BIOA 5B3KA 2AF4C 2GH1A 3GPLA 3QELB 1GN9A 1Y3IA 5EA2A 3RANA 2OAEA 5EC8A 1Y4AE 5LQJA 3U6KA 1TCCA 2I65A 1NVGA 2ACEA 1T8RA 2D1TA 1C3OB 3ESZA 3M1YA 4RHCA 3JSAA 4N9QA 5BXYA 2HHJA 3GZTB 3BQNB 3V7WA 4JLKA 9LDBA 1N32B 5KOYA 3ANNA 1TQ8A 2D1SA 4PIPA 5FTJA 4E7PA 4BBPA 4TMYA 1KQNA 4DCMA 3A28A 2FWNA 4X24A 4Z0NA 3KHUA 2QUAA 2WTEA 4KUGA 2J6CA 1NY6A 4C29A 2K87A 2P9FA 1FFSA 4MUYA 4OKIA 4DNXA 1K7FB 1UWCA 2ZBGA 2ODBA 5KVQA 1C8VB 5CXXA 4Q4HA 4U2GA 3NUQA 1P0CA 2QZJA 4Q24A 1ZW1A 3LX8A 1G8FA 1YIOA 3P9RA 4O0MA 4BJHB 2QJFA 1NUTA 4U0KA 2FTKE 4P2GA 3M7IA 1OAAA 3H65A 2PZKA 4XWGA 3CRMA 5A7FA 3AR2A 2E37A 1LKZA 3KR1A 1FSSA 3QEOA 4ZQIA 1US8B 2JLWA 5FFFA 4MOWA 4GI1A 1C30B 2Z8YA 5IMSA 4A2WA 1JKJA 3HVUA 3P9XA 1FNNA 4XYGA 1P2UA 1YRWA 2NSHA 4BFXA 4ER7A 1KDPA 1KL7A 2H2WA 3JQAB 4YQYA 3IAM1 4O4IF 2Q5HA 4KO4S 2X0EA 3FTQA 5H4HA 3AW8A 3D4LA 1Y8CA 2CL7X 4NDAA 1DUIA 4RSGA 3TVYA 5F78A 2C04A 4P83A 3JTEA 3A6PC 2YYSA 4QTUB 4MO2A 1KH1A 4N6NA 1P6XA 2QRQA 3DPIA 4ZAFA 5TGTA 5AVSA 2JGEA 4DLBA 1V35A 2Z6UA 2AQ8A 1SXJE 3E6AA 3LAWA 5EJ8A 1UPXA 3U2QA 4US0R 1YHYA 1RC8A 5EKXA 4LBVA 1FQOA 5JWOA 3CH5A 5CB0A 2LRHA 1VBMA 1BX3A 1IEVA 2TMYA 3IIKA 1DCMA 2FRVA 3KEGA 5TQ2B 4ZKDA 1NXTA 3BA1A 2QLNA 4R5HA 5IASA 4W99A 2FUEA 4B6FA 1OMOA 2XNCA 4PGGA 1HKHA 4C7XA 1FXWF 1L1QA 2Y1WA 1PR5A 4NFYA 4MW2A 2ZRQA 3OJLA 5EMNA 2OFXA 2K6GA 3AW9A 3GCXA 4EHHA 3HWX1 1RI4A 1SUAA 1Z38A 3QF7A 4OFBA 3COYA 2PKRA 2QMYA 2BKVA 3IDQA 2D5AA 3OPMA 1JQLB 3DVQX 1U1EA 5AJWA 1NATA 2C57A 3I9NA 3LRPA 3KEMA 3KTOA 2F62A 3CCCA 3D59A 3LWNA 3NHUA 4OXNA 4WZZA 4A10A 5I5EA 3Q41A 2OXEA 2EX4A 3T7TA 1SUBA 2YY7A 3GEHA 2G36A 2JBAB 1RYMA 3D6AA 1E5XA 1KDZA 1Q1AA 1TQDA 3V4PB 4RMNA 3RBVA 2BVNA 1MRZA 2ORVA 3O1IC 4K9SA 1NVDA 4GWKA 4MQUA 3P2YA 5F7JA 3WA6A 3DD1A 1CEYA 2DTEA 2M1XA 4GXQA 3VA7A 2PZMA 1RWOA 3K9QO 4GBJA 1V1MA 3HVKA 4E51A 5IJXA 2FEXA 3ZVRA 3IOMA 1VSTA 3TNYA 4PG8A 4LJRA 2EKDA 1O6ZA 2DM6A 1NRXA 3STHA 1B26A 1ZGBA 3D2AA 3T7DA 1DEHA 3B7WA 1ND6A 2FPPA 4DOMA 1K89A 5IZCA 2L69A 2SKCA 1EHIA 1CUXA 2GEJA 3PNPA 2NZWA 3WLAA 4DJFC 5KOHB 4K9DA 2IYTA 4OG2A 4GQIA 4KACA 3BE4A 2RGXA 1JW9B 1O8BA 2BI8A 1AF4A 4JL6A 1Z3CA 4GVLA 5G0UA 5BV2P 2BHTA 1J09A 4YJ2F 3C3XA 4Q1DA 4YWHA 4IL5A 3HJCA 1KMHB 2VDUE 3EXFA 4EDFA 1P0IA 2WC1A 2Q0HA 2HA4A 2PAAA 1T1JA 3HYSA 2HJRA 1MXHA 1UQRA 3GMDA 1ZGJA 4E0BA 1E7SA 3G6KA 2L2QA 5ELLA 5K20A 3ILXA 5KJ6A 4EO9A 1QH1B 3VR4D 4E5KA 2JCSA 3FNEA 1U0FA 4GFDA 4FLFA 3W4JA 2A0UA 2Q99A 4TV9A 5CFLA 5CDHA 3WGUA 2K4MA 3PDCA 4PWZA 4TL9A 5H4GA 2BI7A 1QTQA 5HJ2A 2QX6A 1CR0A 2A0YA 3TZQA 3G9QA 1XMVA 1OYVA 3FNIA 5D7BA 3SDZA 1M2HA 2PU5A 3HEBA 2D54A 4BFLA 2PZEA 1IL0A 5FPTA 2E6UX 1V39A 4XARA 1TK3A 2GTPA 2PUEA 4WNCA 3MTQA 4Q21A 4QUJA 4TV8F 2R8RA 3QW2A 4YT5A 3RSLA 4BECA 1SB8A 4JC5A 1J56A 5DU2A 3I9MA 1UT6A 5I8ZA 5YASA 3TQRA 3N7TA 4CF5A 1WXHA 2OCLA 2V96A 2WU1A 3PXAA 2QUIA 3U7HB 3GJ6A 4GUAA 1EFPB 3NTOA 4WASA 3HO6A 5CAEA 1Q50A 2LP4Y 3MPUA 4WOBA 4CKCA 3OEHD 2UVPB 5JZBA 2B8EA 3D1LA 1V48A 4V2UA 4UZEA 2IUSA 3RH0A 4J0KA 1PGPA 3FYUB 5K8TA 1KDYA 4BUJA 4CCWA 1IE3A 3ROZA 1P5RA 3P9YA 3E5RA 2EEPA 3ER9A 4NEHB 4UUQA 4N48A 3DM5A 1VPEA 2YMMA 1A97A 2OO7A 1KS9A 4MCHA 3KKPA 2ARKA 1T25A 1BH6A 4ER5A 1Y1KE 4M1ZA 3OLYA 4KU4A 1OBFO 3C5WP 5BN3A 1SD5A 1R6BX 3EOBI 2RH8A 2R6JA 1OC4A 4O4JA 2PMEA 5BYKA 3K8YA 3QKUA 4YMWA 4EYOA 1SBYA 4MJXA 3EQ2A 1D03A 5LLTA 2P4HX 2DECA 3A9SA 3ULKA 1P1IA 1C9MA 3AB7A 1KBOA 3HWRA 3LVQE 5DXFA 5FLKA 5JCZA 3KYDB 3OUUA 3UBMA 5L95A 5AKJA 2DBVO 4UM5A 4FP9A 5BQFA 3L1IA 1FVOA 3M4JA 1PUXA 3P9ZA 3Q8LA 2WT8A 2PGAA 4D9CA 5DM0A 1CU1A 3GJZA 1JXOA 3AJEA 5GONB 1PDVA 3RVMA 1II9A 4P3YA 2H4FA 5MFPA 1Z22A 4HEA6 4DMUB 4P98A 4QJBA 2ABWA 5JARA 4ACBA 2HQ1A 4YP0A 4P54A 4K9QA 2E5WA 1EFVA 1IBCA 5AVJA 1YDMA 2DWUA 4N54A 2JI7A 1N6IA 1HV8A 1WRBA 2VF4X 2DKOA 3CVJA 2CMGA 4WA8A 1Y82A 4KW7A 5EP1A 3WHPA 5JH7A 3G7NA 2WKQA 2Z5FA 4JZKA 4OMUA 4C22A 3E7DA 1ZJWA 2NU9A 4C21A 4DPKA 3MWDB 3AL3A 1Y42X 2BIFA 4GM1A 4JSTA 1NT2A 3DT6A 3DC2A 1AGYA 3KQPA 3V8EA 1F0NA 1WXQA 2HN9A 3AF5A 4TLBA 1HFJA 1D1PA 1THMA 2B4QA 3ABSB 2EFYA 4F11A 2PBRA 3QX8A 1ZZEA 4M0UA 1Q1QA 2DSNA 4OJMX 1W85B 4FGWA 4KGXA 2DP4E 3GK3A 2FY8A 2H31A 4PZAA 3UK7A 4CNBA 2ZTLA 3GJ8A 4W5NA 3UGTA 2PUTA 3TCXB 4BFZA 5JXWA 4MYUA 4G1EB 5KDDA 5BY2A 4PZUA 3SHQA 4XAQA 3JVVA 1I6WA 3TE6A 4L5AA 3KB1A 1ECJA 3A4TA 5LP6B 3C6QA 4TL8A 4X6YA 2L82A 5LQCA 3OWOA 4X92A 5KYNA 3NOOA 4ZOLA 4M87A 1BVUA 3OPVA 1CIVA 5CLLA 3JZMA 1R2QA 2F1RA 4OSEA 3ENVA 5LBTA 4A73A 5IJ9A 5LYJA 3HP1A 2JK0A 2QWXA 1GITA 4HNAB 4PQEA 4Z1MA 3RTGA 2GOYA 1YKSA 3QVSA 4LC0A 3FG9A 4KPEC 1A1VA 2ZT5A 1L1EA 2D8MA 1YB1A 4PC3A 4D9IA 1X8LA 2X0RA 2X5XA 3HCOA 3PHLA 5KMGA 1CP2A 1KEWA 2YWEA 5LQAA 2G71A 2H6EA 2G4VA 3A3OA 4UKDA 1AK2A 1Q3HA 1IUKA 4MWDA 2WP0A 4TT3A 5CPBA 1IHDA 3CVVA 1NI5A 1POWA 1YACA 5FL7D 4UDNA 1JLLA 4YAIA 3UATA 1JL3A 1S8NA 2JJ8A 4PLTA 4R2LA 4EBFA 3AVVA 1KETA 2XBLA 2NLOA 1FBNA 3F71A 2FZEA 3RVQA 3DYIA 1JVBA 1VIYA 2AFHA 2FUNB 2P8SA 4F85A 821PA 2EQBA 3OKAA 3KQYA 5AVXA 5F9FA 4XPIA 2VRCD 4TXHA 1JHAA 4DQKA 1SMKA 3EIXA 3TLAA 1AUQA 1UK7A 3QMMA 4P38A 3L4JA 4O4HF 4YS6A 5CA0F 1UBFA 4D97A 2P9CA 1KQPA 2B61A 2G8NA 2WHXA 1O6GA 3VBEA 4C4RA 1BCRB 2JBWA 1QHYA 3DMNA 4UD2A 4V3BA 5TT0A 5BURA 2FPRA 2ZBPA 3FPJA 1QR2A 3WKCA 4HQLA 4TLAA 2BZ0A 3O21A 3KD2A 4BX9A 1WK8A 4LHXA 3DXXA 1P1HA 4E15A 2XB2A 3K9CA 3N3AC 3GNLA 3VI3B 4B4KA 3CJTA 1KFKB 3CRW1 1ECPA 1NBOA 2WPDD 4MO9A 4QD3A 4UU0A 4Z8XA 3VSEA 5JOQA 1GUZA 5JQGA 3RU9A 2E82A 4LF5B 2RCYA 2XF2A 2GD1O 3FDZB 3HLTA 4GXRA 1UFRA 3T35A 4B2PA 3MXTA 4G5GA 1NP6A 1U7WA 4U0JA 2UKDA 1WF3A 1E96A 3EIEA 3ND7A 3OIFA 5FTMA 1ZAKA 3U4DA 4D4MA 5JHGB 2JGDA 3UH1A 2FPOA 4XZ3A 5ALNA 2Z3WA 3EIFA 1YR1A 2PKEA 1M5UA 2EW8A 3GFQA 4EJSC 5CFRA 2KPOA 4Q3DA 3FMGA 4F4CA 2AI2A 4S0ZA 4IXDA 4JXKA 1N3IA 1QFZA 1AZWA 1X3SA 3B3FA 2JIPA 3O9ZA 2Q1SA 4LYHA 3WO1A 2FEMA 3SVTA 1JXMA 4TKMA 1KOFA 3AZQA 2LR0A 4D8XA 3FFXA 4HGYA 4E2XA 3R44A 2F59A 4CCSA 1H0RA 3B52X 4FDAA 5D8DA 3Q72A 3A2NA 3QHAA 4JP8A 3VR6D 3O03A 3G5TA 2XCOA 3R3VA 2FZCA 3Q1LA 4HADA 2IW1A 3SD7A 3VUEA 2F4VB 1WJGA 5LXTF 4E5DA 4PICA 5K45A 3L93A 1KSJA 3M6XA 3IMKA 5EFOA 5HK8A 5KYWB 5C46F 5LZ4A 5I9NA 2C9BA 4GM0A 4KQ9A 4E30A 3F6CA 2Q7OE 2GX6A 1I14A 2G6BA 4RDXA 2FW0A 3DFIA 3PHJA 1GL7A 3D6VA 2NPIA 4K0RA 5AW7A 2X6TA 4EUSA 1VJ5A 2DC1A 3OPYA 1SK9A 1R8JA 2VSQA 1XMPA 3AGPA 2OD7A 1AKNA 2H4XA 3I9JA 4QOEA 1J23A 5LIRA 1CS0A 1V1JA 1C8LA 4X8MA 2XE8A 4HWTA 3ZY3A 5J4VA 3U3DA 5BSKA 5LJLA 3DOIA 1G291 4IZ6A 1OILA 3AHCA 4YHBA 3GNSA 4R01A 1FFHA 3OQIA 4OPMA 1PVDA 1WNTA 2IZ6A 4LY0A 1Y48E 4XD2A 3VH1A 4EFNA 1LU9A 2ZVQX 4OCZA 3QOXA 1J39A 4HB4A 3WGTA 1BD3A 1N5DA 4XSHA 4MKFA 4TYWA 3VAAA 4WLUA 1AGPA 3L79A 1TL7C 4ZZ1A 4O1HA 2W42A 1W49A 3BOSA 5AI8A 3DTYA 3MA0A 3PZ0A 4ZZ3A 4RBNA 4J1QA 4KKVA 5I4KA 4BUCA 2ZI3A 2XUFA 3FSJX 4Q1EA 2VS1A 1GDTA 1ORHA 2VI5A 3B3JA 2PR2A 5BR1A 3MWEA 5CD9A 2G83A 1KY4A 1VP9A 1W0CA 3OJ0A 2VJYA 5B6PA 3OHPA 3S29A 2VNJA 4N47A 1ZA1A 2YYZA 4KSYA 1UC9A 5F2NA 4BYGA 1H1TA 3PUWA 5ICFA 4DMRA 1JEYA 4PZ9A 1ZXXA 3PJRA 4I1UA 3H2BA 3D2LA 1QDUA 2PZGA 4OM8A 1Y4ZA 4YCNA 1LPSA 4U02A 4EHKA 1Y6FA 3BX1A 3GGCA 4IH4A 3VH3A 3JYHA 1JKJB 2CHQA 4YAKA 1R3UA 5PNTA 5LWQA 4HH4A 3ABOB 4JX8A 1JAXA 1JA9A 2GPAA 2JFQA 4PHHA 1VE7A 2Q8NA 3PF8A 1FL9A 3TGLA 2WYHA 3OLZA 3NTLA 5BNIA 1PT6A 4A0SA 3KFXA 3SKVA 1PS8A 3NAGA 1J8YF 4RDIA 2QUZA 2MSEB 2W2VA 4I6JA 4JUCA 5CLGA 4F60A 5ELXA 1WMDA 4HWKA 2CHGA 1KOLA 1WUJS 4GDMA 4N7BA 2P9BA 2BGRA 2FDRA 4U7GA 5AVVA 2D2VA 1H4TA 4AJHA 4YP1A 1O4VA 4R2WA 1ISFA 1U0RA 4TXMA 2ONZA 3TPCA 3OTIA 5ARCA 1JSZA 2COEA 1K75A 1B1AA 2BEJA 2OZEA 3EIHA 3MWGA 4YEDA 1C1DA 4URFA 2PNJA 4E5PA 1GPYA 2VHZA 1USVA 2GN1A 3BN3A 3L8YA 2YFYA 3HXTA 8LDHA 3J7AC 1X7DA 4DARA 1YCDA 3TAUA 1XZ8A 2CNWA 2HA3A 1ODTC 4QYWA 4X71A 1NVMB 1UL1X 1P2DA 2C2XA 4LF9B 3JQAD 4K9LA 3RTAA 4QTXA 2HWYA 1TIPA 1NR7A 2B99A 3M4XA 3QSYA 1Z7BA 2CNOA 2AEMA 1F4PA 1ZM3A 4V0LA 3O4GA 1UEIA 1M67A 2RGNC 5EVJA 2WIGA 5FLYA 1J9EA 5AW0A 1Z63A 2PUVA 3L9WA 2BZSA 4I5GA 2O2CA 3DAYA 3AG5A 1L7QA 1JP7A 3D3QA 1HQDA 4Q3EA 3SCZA 3WFIA 4QLBA 5L6LB 1N5LA 5TV2A 2BGWA 5M5BA 4G4JA 4H6PA 1P0FA 3ORSA 3BXZA 1Q2XA 4YT2A 1P74A 4DDTA 2P78A 3F3SA 2QN6A 4S35A 2X5KO 3FHJA 3KR9A 5JSYA 1V1MB 4C7JA 3ML1A 2O1EA 2RH9B 4ZC1A 5CVUA 5DN6A 1YV9A 3AL2A 3K92A 1PWYE 1QVAA 2OHVA 2Z5LA 2P62A 4GSYA 4PHFA 1S2GA 1W48A 3R0ZA 4ZODA 2GPJA 2C2OA 3KQMA 4NC9A 2ASVA 3PVCA 5DTQA 1D2AA 3AVPA 3BGSA 4NICA 2AN5A 2FPPB 1M2GA 3MTBA 4QFMA 1AGNA 3TW6A 5D7NA 2MYTA 4EJSA 5CDYA 3QTBA 3K6SA 5AW6A 3A11A 3FPCA 4RH1A 4IQ8A 2H92A 5HFJA 3SM9A 4EYGA 3FCCA 4H18A 3ZH2A 4UAUA 4QHSA 3CYFA 4W7SA 3BZWA 3LYUA 1XOIA 1FTQA 2ET6A 1ULHA 3TJRA 4JJFA 3TS1A 4Y6PA 1LI4A 2E1RA 4OH1A 1I6LA 1QVZA 4D3ZA 5BWNA 3SF0A 3LBAA 1WP4A 2V7BA 3GEPA 3PXUA 4ZOCA 3EXFB 1A5ZA 3EVCA 2Y0DA 1BMFA 3IIEA 3INGA 5JD6A 3SX2A 4Z2AA 4BUZA 5KS2A 3IURA 4GDFA 5LZ7A 4EY4A 4NE2A 4QYTA 3F8TA 4X62B 1QLWA 2AK3A 1TTQB 4N5NA 3L9XA 5LQUA 4LGVA 3F4LA 2D0OB 1WKCA 3NNSA 5B6IA 3FE2A 4LI3X 3WRWA 5DNUA 3B20A 2Z9CA 1J5PA 1E58A 1N0IA 3CCBA 3AT1A 4QPPA 4OH7A 4Q3OA 3ZWQA 4BNHA 4EG0A 5BV8A 2JLAA 4I5DA 4BFVA 3O8CA 3ZWOA 3HJFA 3TTTA 3ZUGA 3HK2A 3VVLA 2Q2VA 4GOXA 4EABA 5I7EA 4DV0B 4MR8B 3WGMA 3TINA 5FUVA 1Q83A 1MX1A 2QRVA 3GDGA 3NRCA 3R5JA 1QIGA 2IEBA 1XQ9A 5DSTA 2D2EA 1M73E 1G21A 1ADCA 3Q3EA 3X2SA 3H9BA 2IT1A 4I1RA 4LOHA 1XEWX 3HKEA 5JWRA 1T4BA 3DLHA 2MINA 4XLLA 1LDEA 2H9IA 2RHWA 4RVHA 3EAFA 1DHRA 4HAZA 2BP7A 3KIPA 3ASVA 5CT8A 5FBKA 1QFYA 5CAEB 3ZHYA 3WQHA 5FA8A 4BS9A 4D42A 1F1JA 1O95C 1UBUS 4E4TA 4CKCB 3PUIA 2R48A 4KGZA 1JDJA 4BEJA 1IOVA 1R5OA 1L5VA 2XCLA 2YXDA 4OB6A 1EH5A 2G9RA 2R6DA 3QLEA 3QMVA 4QBTA 1F51E 2QVXX 3TRDA 1GR1A 3ESAA 4R7TA 2RAVA 1XGKA 4GZLA 1E63A 5A4FS 3GVXA 1SU8A 3OEED 3RS5A 4HVLA 3MELA 3EODA 1G19A 3FTDA 4DNFA 5K2OA 4M0KA 4ZMRA 3ESRA 4U4AA 5FUQA 5BN3B 1UP4A 4BWYA 2IA5A 2JCGA 2E4XA 1ZH2A 2C2BA 2H57A 3ADPA 4O4JB 6ADHA 4JBLA 3A6ZA 1MF7A 1X1EA 1GRCA 4HYTA 4TTSA 4BIMA 5CHEA 3TK1A 2ZB3A 3C3KA 2VNSA 3EDOA 4II2A 1BEZA 3EZNA 3CURA 1U5BA 1V45E 4LBZA 1CUAA 3OJWA 4E12A 3W3AD 1GKYA 3AHFA 4ZD6A 4YUVA 3DJYA 1QZ3A 4HWGA 2NTEA 4DDKA 1H1LB 3TRFA 3AUSA 3LE8A 4GPD1 4PYRA 1G2IA 4L8VA 1CIPA 4LWZA 1SKYB 4NYMQ 5FFMA 4OHXA 4ZVVA 3WK7A 1NNLA 2VP2A 3ZY6A 2I6SA 3IXLA 1X74A 1VBFA 5JFOA 1FYFA 1FRZA 2AFVA 3E4CA 4GPTA 4AYWA 4O1IA 5G40A 5AKEA 3GHHA 3AV0B 1EFVB 3FW1A 3QWIA 3A1NA 1QJ4A 1L7AA 2C78A 3GH3A 5G3YA 1M3SA 5F1KA 3V1LA 3WWEA 2BGGA 3YASA 4M8KA 5DGXA 1JDSA 1PT9A 4LW8A 4AKGA 5JRJA 2NGRA 4JQCA 1RPJA 4XJXA 5JH7B 3T5MA 1N5IA 3CG4A 3CH6A 4HAOA 4KTVE 4KYTA 5ENZA 2NU9B 1CCWA 4MQFB 4I4TF 3HYNA 1BJTA 1QO0D 2MSKA 1N2CB 3WJ1A 1Q7GA 1OXMA 5LOVB 5JU6A 2EW1A 2Q1YA 3C7DB 3FH0A 1R50A 3ZQKA 4CU5A 5J2TA 3TOZA 2PTHA 2RGNA 2C4WA 3B85A 3S28A 3SJAA 1QQAA 4QX6A 3GT0A 1GYQA 3MGKA 4Q7QA 3SBDA 1R5JA 3O1JC 2C99A 3OZGA 1HM5A 4LJ6A 3FYCA 4CT4B 4NR0A 4UXIA 4WY8A 1HNZB 2J09A 3KNZA 3OE1A 3PSHA 4C4XA 4YIKA 3PNBA 4ZOLB 4X6XA 1U7OA 3FZNA 3GPCA 5FBHA 4KV9A 1IG3A 5LYJB 3V42A 1HRDA 3L0PA 5TEVA 4C3ZA 1JKIA 4JYBA 4PAOA 1M75A 5FPQA 1OGIA 3WR5A 1CXZA 5GMOA 4ZT3A 1T36A 1J0CA 5AK5A 3IP9A 3L1UA 3RM3A 2ILTA 1J42A 4YRZA 1AIPA 5KMGB 3ZY2A 5KX5B 4ITVA 4EF5A 3DGFC 4MQLA 4W9RA 2RB4A 3CW2A 3CPEA 5I8PA 5AXBA 2R6R1 3IGFA 2WHPA 2SNIE 1V8ZA 4C0JA 1GL9B 1NDHA 5LC1A 2NSLA 1DIGA 1JILA 2WM2A 4URYR 5CM8B 3T7KA 1H2RS 5SY6A 3C7KA 1S2DA 2D59A 1X39A 2DGDA 1TD9A 1TYEB 1ZC4A 2JI9A 4CV2A 2AFHB 4MW7A 2WSSD 2JZCA 2P30A 3L2OB 3S44A 4HFNA 4XPIB 3ZVKA 2FDCA 2B3DA 4Y8VA 4YNBA 4NHOA 1TVKA 3KZNA 1XNHA 3WBKA 4Z4GA 1J06A 1TKRA 1I4EB 1SVKA 2R00C 3OQ6A 1GPAA 1X92A 1U8EA 1V8OA 1CBUA 1CUJA 4IHJF 4I6GA 1TM5E 4UFOA 5J4LA 4UDOA 3F73A 1E2NA 4RHEA 4PHCA 3GV0A 1T2AA 1XRLA 2V59A 2FMXA 3P9QA 5CNIA 1UBNA 2XJ4A 2B82A 4RMIA 1EESA 1AUVA 2GM3A 2GAFA 2CLOB 2B4RO 3CU5A 1WKBA 3EUEA 4M1WA 4N5MA 3ICWA 1KYQA 4KQMA 4M83A 4MQ5A 4Y6RA 3ITDA 4X41A 1YL5A 5JQGB 1CUWA 3T3OA 1P8AA 1UXOA 4AJNA 3FCYA 3M83A 2W9XA 1TOAA 3IP1A 4TTPA 2CV0A 5HP4A 1XVUA 1J6UA 4UASA 4RHXA 1WU7A 2VHVA 1V8DA 2JGDB 1JI3A 1PL6A 1Q57A 3GVIA 3KKOA 3WGHA 3RHSA 3NWPA 2PMCA 1FCJA 4L72A 3GLVA 2VP9A 1YJQA 4EHLA 1QZTA 4LXXA 2PUFA 1Z88A 2XEXA 1O95A 3QWFA 4R83A 1E0KA 3HA3A 2Z0MA 3D81A 3R0VA 1PIWA 1DKNA 4MVJM 3WAKA 2RG7A 1GTSA 1TJ5A 5AJHA 1MXFA 1E9SA 5DXJA 1CE8A 2AUMA 3SYMA 1TIBA 5HKBA 3K16A 3GRRA 2A0KA 2AR0A 4ZAVA 3K4HA 1JDNA 2B30A 5TEWA 1WOMA 1DOHA 1KZYC 4A27A 4Z0PA 2CF5A 1VLMA 2WVJA 4V0RA 3WKBA 2W00A 2CMFA 3I2GA 4JA0A 4CLRA 4KLAA 1WPRA 4UJ5A 5DBGA 1N5KA 4R2XA 3DDNA 5EESA 5EE9A 3VC1A 4DJEC 3IBCA 5CG1A 1GPDG 4DR5B 5JNVA 3ONFA 4DCGA 1OHHD 4AZVA 3KYCA 4RVOA 3E7XA 4EVSA 2C7BA 2YV2A 3QVTA 4HMQA 1DWOA 3A1VA 5JSZA 3H99A 1XZGA 3OPYB 4OU4A 3W04A 1T29A 1ZLYA 3GF4A 2R5FA 3I2KA 2GZ2A 2Y76A 4TPKA 5JCOA 3JD4A 4C03A 2V1UA 1HXHA 4H6VA 3IEKA 4M99A 2R6ZA 1SQSA 1CS0B 2TRSB 5D84A 3U13A 3E8MA 3GG9A 4WKNA 4JVMA 2YDYA 5IHPA 4KFCA 4QU8A 4DIDA 5LUAA 5KOJB 1N6NA 4IJUA 2W5UA 1KARA 4OQPA 3OQIB 5HFNA 1KJJA 3BFVA 2RHJA 2JZNA 1T9AA 2ADMA 2ATVA 3C4JA 1AG9A 2F9MA 1WV1A 1GCIA 2IYOA 3C1AA 4E13A 3PQ3A 1O97D 1ILWA 2B92A 4P93A 4DKXA 1I2CA 1IQPA 1GZVA 3R3HA 3PXBA 2F55A 1V5IA 3KS9A 1YZLA 2GEDA 3AHDA 4XWTA 5DYTA 5F9MA 3LVRE 1QGED 4JCCA 3INYA 3QU2A 2YTZA 3KSDO 1YRLA 2VSNA 3ZHRA 4MA4A 1E4EB 1I2DA 1U4OA 3IMCA 3MQ2A 1NVUQ 4AUEA 1KYWA 2HTEA 2GUWA 3X1MA 4WK6A 1FX1A 3P71T 4LHYA 3OT5A 3AF4A 5DXAA 5KYVA 1JEYB 3ADKA 4GUDA 4YJ3A 4H1HA 2VAPA 1AJEA 4P36A 4MLDA 4RPLA 2Z43A 4X93A 3W2TA 4AWAA 1MABA 3QI2A 2ZRLA 4MW5A 1QIMA 4Z4IA 1RHKA 3K9GA 4A03A 1Z6PA 4DJDC 4YC7A 4ZWNA 2Z08A 3R3UA 1EWKA 4J43A 2VDLB 4CPDA 3R75A 3LCMA 4UVGA 1UXKA 5JRDS 1AZLA 1L5ZA 1J0BA 1FJHA 4DILA 3OD1A 2EFDB 1DJOA 1OTXA 3G2IA 3N0TA 4DXAA 4CMBA 4XEUA 3PFGA 2HRDA 1FU4A 3W5IA 4BLQA 2GRAA 4HXFB 4HQOA 1JIIA 1GPKA 1NFFA 2WF6A 2NTJA 3WFZA 1ZUD1 3Q88A 4GPIB 4EENA 3BK1A 2C2YA 4J0HA 4DADA 1CX9B 3NORA 4CODB 4LSGA 1G20E 4N12A 4RD6A 2Q5JA 4I8IA 4P4UA 4D99A 3OOSA 5C5EA 5LQNA 2O7SA 2WD7A 3GDFA 2ZWIA 1P44A 4RK5A 4FGJA 3OOYA 3GH1A 5CK4A 1L9KA 2C4TA 3QH4A 1AHPA 3ORRA 1PYDA 1DTEA 1JR3A 1JU9A 3F3YA 3FETA 4MGIR 5LKAA 4R1TA 2YVAA 1VIMA 1AUPA 4OP3A 3HO8A 1WHTA 3QPCA 1B7GO 4G8CA 5JAPA 4GE3A 1E92A 1Y1SA 2R00A 3LHFA 4US2R 1P18A 2UVDA 1KI8A 3H2GA 5HKAA 1O9BA 1L4NA 2GCPA 5K3EA 1EJ0A 3TI9A 1ZI8A 1X86B 3UHOA 1ZWKA 4F6CA 4PLCA 2WJWA 1X7XA 4JLOA 4NY1A 4PVDA 5E4YA 3T5GA 1A9XA 3RC2A 1G1AA 1VP3A 4JR1A 3WHLA 1XCLA 3VR3A 2WWHA 5KSWB 3WLNA 3F5FA 4PLVA 1W96A 1FFYA 2PS1A 1JJ7A 1GPLA 1SZCA 1ST3A 3CLKA 2PFSA 3U7QA 4B6GA 1DBPA 3TN7A 1TEZA 2B5WA 4RIGA 2XMPA 1NQVA 3OT1A 4BVFA 2V0GA 2ON6A 2I1VB 1EJ2A 2A78A 3D9QX 3OSUA 2DAPA 3WGVA 4EYEA 4X54A 3TEJA 1QFJA 3VH4A 1R66A 3WK8A 3O2NA 3AFOA 1DWQA 4GI3A 4LPKA 4GLOA 2O5CA 1EWTA 4HZGA 2A4KA 5EE3A 1C2YA 1UOEA 2BUBA 2PZLA 1WE2A 5K0NA 1SHKA 1N7HA 2ZYIA 2LE0A 5FTKA 3CF2A 1MZPA 3K6SB 1ONOA 3JU3A 1JQ5A 3WS7A 2PEYA 1CIJA 3EZGA 3E1KA 4BVKA 2G1AA 4GWLA 1FU7A 2FVXA 4PNZA 2HEGA 2RHDA 4U2EA 5TPZA 4UTRA 5JMTA 3H5VA 2OG2A 1U1CA 3P9CA 1P4AA 1X1TA 4XI9A 1EQAA 3SDBA 1JRLA 3R7BA 4YX9A 1M54A 3HEMA 1QVWA 4R2IA 3SJ7A 2IV2X 3UKOA 1CF4A 1RKUA 2W2XA 2GCOA 3DTTA 1QC5A 3JVIA 2X0JA 3OECA 4G09A 2ZR9A 1YRHA 4EI8A 2CXHA 1Y8QA 2PRJA 3VTKA 2PEZA 1W87A 2VHXA 2A0FA 1L3IA 1U7HA 3QUTA 3CRZA 4ILEA 1G6Q1 2EF0A 1OFTA 2YJTD 3L7DA 4MRRA 4BLRA 4D0LB 4DA6A 5IAGA 4TZ0A 4JN6B 1WDWB 2IWHA 4LZAA 2AL7A 4PX2A 4U7DA 3AIMA 5IAKA 5H80A 2J08A 1P1RA 3P9KA 3IJPA 1FTGA 3VR4H 4LF4B 1D04A 3NH6A 4DA4A 2HGSA 4Z7OB 3OWXA 1SXGA 3JPWA 3VVBA 3C43A 2J1LA 4J1TC 5EWJB 3E9EA 1GNLA 4FSXA 1D9XA 5C1PA 2DQZA 3D1VA 5KVAA 3GLHE 3GMTA 3O8NA 4M0CA 3QV1A 1UPBA 4D5EA 2GEUA 1ORTA 1XEXA 3HKEB 3ODPA 4Z8YA 4MYHA 2MINB 2NVBA 4OYLA 4B4OA 4N0EA 3S2FA 3DQPA 3SZLA 3ZHVA 1ZM7A 4OQMA 3ZE1B 3RFXA 5HW0A 2AC4A 2AHRA 2PFKA 3M8KA 3UAWA 4KMRA 1YTUA 5FOTA 5EPEA 4XTRA 4GX1A 1DQNA 2NU6A 2ZIGA 2R1VB 5IDVA 5FYQA 3UNXA 4U2BA 1GT91 1GZ7A 1LV8A 2I3AA 5BSWA 4X00A 1YI8A 1BXKA 4MV5A 3KAPA 5BWCA 4COKA 3IHTA 1NDQA 1S2LA 2ZGVA 2NXEA 2X3UA 4RK1A 3BIXA 4WZAB 1AO3A 1K2WA 3MJTA 1KQFA 3GJXC 1S3GA 4Q93A 2G70A 2CXSA 2LCIA 4K7JA 4F3TA 4HN2A 3X1XA 3V4LA 4UAGA 4E5YA 3IQWA 2G1PA 3KD3A 3W5BA 2R62A 1ZIDA 5FB3A 1AXRA 4Q4CA 4N65A 1MU0A 3ODGA 4HG2A 2BGUA 3RS8A 2C5BA 2RGCA 4YCCA 1U5BB 3WFJA 3WICA 4EJFA 5A05A 4RY0A 4RVCA 4HQNA 4CCAA 3NBUA 2K7FA 1O54A 3NVKI 3KAQA 4F3KA 4QDKA 3TKLA 1IZYA 4C4ZA 4ZXPA 5JATA 2PT9A 2H7XA 1IHOA 3EVAA 3HY3A 2BR5A 1CRZA 1W73A 3MGAA 4BVLA 5LCXA 5EIHA 2XZLA 1UC8A 4WEQA 5GGXA 4AAYA 2ZJ0A 4A2QA 5CU7A 3X1WA 4A15A 2DB3A 4BWFB 4YCLA 4E5VA 4O63O 1VJTA 4EQZA 4LKOA 1KEKA 4EI2A 2FFRA 1UQTA 3AC0A 2OENG 3NBXX 5TXGA 1T43A 3LWDA 5EXPA 1QHXA 2O1WA 1BVYF 2I3ZA 3WBJA 4CDMA 1PJ8A 3IT1A 1GSAA 3Q40A 4OF4A 5KSOA 3P5SA 5THXA 5U4QA 1YMQA 1WWKA 5BQ3A 5IF9A 4OFZA 2E7ZA 1IMOA 1VE5A 4I3HA 4DLYA 5C31A 3HKDA 1GZ4A 2IY7A 3R7FA 1VJCA 5KNBH 3TUIC 4AY5A 1GPBA 5EZYF 4FHZA 1Z4KA 4MYDA 5AXDA 3IP5A 3ZVMA 3C5VA 3JQFC 4MQMA 3K4PA 2D1QA 1L7VC 4HS9A 3T3EA 2TMGA 2E9SA 4TTAA 5H68A 1ISIA 2J6BA 3NHSA 2BSQA 1J07A 4AZWA 1ZOOA 3CX4A 3BD7A 4D8YA 4YDHB 3T1NA 2Z4RA 2XNDA 4NABA 4D5GA 1BZYA 1XA4A 4DQDA 3RIYA 3DW1X 2IUUA 1Z6YA 1YVEI 1IUNA 4HYEA 2PZAA 2VJKA 2YN4A 4I7EA 2NNLD 1NRWA 3FCXA 4IPTA 3C3PA 3D6FA 2ZE8A 4FGSA 4U2DA 3U4AA 2PXXA 4PS1A 3TR5A 5JYEA 1T36B