The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
282
|
sequence length |
807
|
structure length |
791
|
Chain Sequence |
LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Leucyl-tRNA synthetase
|
publication title |
Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb |
source organism |
Pyrococcus horikoshii
|
molecule tags |
Ligase
|
total genus |
282
|
structure length |
791
|
sequence length |
807
|
ec nomenclature |
ec
6.1.1.4: Leucine--tRNA ligase. |
pdb deposition date | 2004-05-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00133 | tRNA-synt_1 | tRNA synthetases class I (I, L, M and V) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Isoleucyl-tRNA Synthetase; Domain 1 | Isoleucyl-tRNA Synthetase; Domain 1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs | ||
Alpha Beta | Alpha-Beta Complex | Isoleucyl-tRNA Synthetase; domain 2 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain |