1WKBA

Crystal structure of leucyl-trna synthetase from the archaeon pyrococcus horikoshii reveals a novel editing domain orientation
Total Genus 282
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
282
sequence length
807
structure length
791
Chain Sequence
LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Leucyl-tRNA synthetase
total genus 282
structure length 791
sequence length 807
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 1wkbA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1wkbA01
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wkbA02
3ND5A 1JEEA 4U8HA 3E27A 4KKVA 4EG4A 1T6ZA 1I2DA 1H3EA 2V0GA 3CA8A 1G59A 1WZ2A 5LLTA 1WQ4A 3DV2A 1EFVA 1OWPA 4EFKA 3C8ZA 1TFUA 2A86A 1CT9A 3FWKA 1MB9A 1OBHA 1JECA 3TZLA 3COVA 1I6LA 1J09A 3CLTC 1FFYA 1N2GA 1F7UA 1IQ0A 3UOWA 4CQNA 1NUQA 1WXEA 4MWEA 1PG0A 1T9GR 3LE8A 2D13A 4NATA 3CLRD 3Q4GA 2AJIA 4HK4A 3SDBA 1OWMA 5AHWA 4KPUB 3I05A 2J4DA 3P0JA 1YUNA 2QUIA 4MVCA 1MAWA 4L2IB 1WK9A 1O5TA 1IFXA 3CLUD 1O97C 1PG2A 4MUFA 3KT6A 1VBNA 1YI8A 1NZJA 1P7PA 2O8VA 1OWLA 1KP3A 1EE1A 4TS1A 2OV4A 3VRHA 2QUJA 4JYZA 1U3DA 3F3MA 3TNJA 4QREA 1O94D 4NDAA 1KQPA 4QRDA 1KAQA 1YUMA 3H9BA 4HPWA 2YWCA 4PBSA 3GMIA 1Q77A 2QJTA 4EF6A 4MULA 3CVXA 1VBKA 2WSIA 3DPIA 2EL7A 4JXXA 1KH1A 4QBTA 1T6YA 3SZ3A 1MRZA 3UC5A 3RFFA 4I6JA 3X1KA 4ZT3A 1PFYA 4EG3A 3TQOA 5KHAA 1Q19A 4ARCA 2A7XA 5LFAA 1OWNA 4FZJA 1J1UA 2NZ2A 4ZCPA 2AKEA 5AGHA 1KQNA 3O0AA 1T9GS 3FNRA 3MXTA 2AJGA 1OBCA 4AS1A 4DE5A 2Z3VA 1UE0A 2JANA 3ELBA 3SP1A 5AGIA 3U1VA 4ZT2A 3CLRC 3HGMA 2DERA 4YBRA 3BL5A 1WNYA 4K47A 1QQTA 2J5BA 2GOYA 4H3SA 3RK1A 1B6TA 3Q10A 1KQOA 3Q12A 1WK8A 2QUKA 4MLPA 1M8FA 3D6UA 1R6UA 1JIKA 2YXNA 1WXHA 5EKDA 1QTQA 3ZIUA 1JGTA 1U3CA 4YP5A 2QTRA 1JILA 2IELA 5H16A 1VBMA 4DDHA 4NX2A 2PZ8A 1UFVA 4I6GA 2GKSA 2YY5A 1LI5A 3P0IA 3N05A 1M8KA 1J20A 4JFAA 1PFWA 1IVSA 3ZJVA 2Z09A 1M8JA 3PZ6A 3FIUA 3M5WA 1QJCA 3FOCA 2EJCA 1M8GA 1M83A 1WNZA 1COZA 3SYTA 4OJMX 1IRXA 1NP7A 4DJAA 1WXIA 1IQUA 4MW4A 1MOPA 5DB4A 3UY4A 1ILEA 2PG3A 3H99A 1J21A 5TEVA 1XNHA 1EUYA 5DASA 2A1TR 4R2LA 2QTMA 4F3RA 1G8FA 3P0HA 3CVWA 4ZT5A 1IQRA 1N75A 2E0IA 4MW6A 2RE8A 4MUGA 1F4LA 1F7VA 1N2JA 2A4MA 3NBAA 3A05A 1N2IA 1J70A 4G6ZA 4J75A 5HUHA 1I6KA 4WSOA 5IHXA 1GAXA 3FETA 1JZSA 2Z08A 4K48A 3G59A 3PXUA 4UZFA 1WKAA 3SEZA 1R6XA 1O96A 4S1OA 2A1UB 3NV7A 4CDMA 1EUQA 3G6KA 4R2MA 4NZPA 3IH5A 3FDXA 3AG5A 4E1AA 2OQ2A 1J1ZA 1GN8A 3ZXSA 2CV2A 4G5FA 2DR2A 2AJHA 1TYCA 1XJQA 3P52A 5AGJA 5AGTA 2PZAA 3X1JA 1OD6A 1WQ3A 3IMCA 3MLAA 4MWDA 1NI5A 2X3FA 4G5YA 1NURA 1JIIA 3KT3A 4EG5A 1M1ZA 4ND7A 3PNBA 4KPUA 2DLCX 3COZA 4A91A 5K0SA 2X1LA 1VL2A 5TS2A 4UZEA 2E21A 1WKBA 1MJHA 2QTNA 3TQIA 2DETA 2WFEA 4MAFA 4NAUA 4DDKA 3L93A 1QRSA 1JZQA 3VGJA 1TEZA 4Q16A 1K4KA 4HJXA 4MW0A 1M8PA 1I6MA 1UDZA 1IH8A 3CVVA 3IUEA 1QU2A 1MC1A 1FYDA 3SEQA 4MVWA 2B7LA 1V47A 1NYLA 4ZCSA 1MBZA 2X0KA 5JBNA 2DXIA 4MW7A 1WOYA 1WXFA 5KWVA 1N1DA 3GUZA 4J76A 4EG6A 1V8FA 4EGAA 1K92A 1ZH0A 4JZYA 3HV0A 5FO1A 4ZCTA 1BS2A 1NUUA 2BYTA 1QRUA 3UK2A 4AQ7A 2JAXA 4DDMA 1KH3A 1ZH6A 2DPLA 4ND6A 1DNPA 4KR7A 2WFDA 4U7JA 1QNFA 3HFJA 3DO8A 2H29A 2A88A 1GZUA 4MUHA 3PZ5A 3G5AA 3ND6A 1LW7A 4MUKA 1D2RA 2E89A 3CLTD 1XNJA 2A1UA 4DNXA 1EFPB 3KFLA 4MUNA 2WQ6A 3ZGZA 1QU3A 3LCJA 1O6BA 2CYBA 2GM3A 2HZ7A 3N2YA 1EJ2A 3RK0A 3PRHA 1VLHA 1WJGA 1F9AA 4RPIA 1TYAE 4YMIA 3TS1A 1LI7A 4PBRA 2O5RA 1U0BB 4MUJA 4ZCQA 1RQGA 1GLNA 3GLVA 3IOCA 3OP1A 1O97D 5AGRA 1X6VA 2HMAA 4EG7A 2AZXA 1A8HA 2PFSA 5J5AA 1NUSA 2CFOA 5TEWA 1NSYA 3IDFA 5J58A 3PNVA 4P2BA 1EFVB 3HL4A 5HG0A 1H3NA 4PY2A 1Y42X 3ISJA 2QUHA 2J09A 1MB2A 1ZUNA 1G8GA 2CV0A 3CR8A 3IVXA 4ZCRA 2NSYA 3QTBA 3AKZA 3ILVA 5BNZA 1IHOA 3HZRA 1GPMA 1TQ8A 2ZUFA 3NBKA 4K03A 4K0RA 3D6VA 3LOQA 1Q11A 5J59A 2RD2A 4PBTA 4RUKA 4DLPA 1GTSA 4MW1A 2YWBA 3IOBA 4XFDA 1O95C 4MWCA 2A1TS 3CLSC 3PNYA 1NUTA 1GTRA 3AG6A 3UMVA 1EFPA 2JA2A 4MWBA 5HUJA 2PZBA 4KR9A 1YIDA 3ZJUA 4OUDA 1ULHA 2CYAA 3SZGA 3QTTA 3IMGA 4I6EA 2CUZA 3OTWA 3IUBA 3KT0A 3ZUGA 1T6XA 2G36A 4HJRA 1TYDE 4YP6A 3S3TA 3CVYA 2QJOA 2V0CA 4MVXA 2DUMA 3AIIA 2VXOA 3IVGA 5K0TA 4JXZA 1O96B 2D54A 3K9WA 1G8HA 3A04A 4ARIA 5IJXA 4ZT4A 1N3LA 1EXDA 1O0BA 5AGSA 2VTBA 1NUPA 3FI0A 3K32A 1Q15A 3H97A 2H2AA 1QRTA 1TYBE 1H3FA 2AG6A 1KAMA 3IOEA 4EG1A 3ZJTA 2CV1A 1YIAA 4Q93A 3INNA 5FNZA 3QE4A 2BTEA 3HMQA 5DK4A 2HGZA 4NAHA 5LM3A 3N8HA 1N2HA 3RHSA 3RJZA 4EG8A 3L92A 2TS1A 3AFHA 4GU5A 3N9IA 4BWVA 2WQ7A 2XRZA 3FY4A 2D5BA 5F23A 3H05A 3TZEA 1K97A 1U7XA 1N2BA 2IJGX 5KCMA 2CT8A 3DLAA 2DEUA 3X1MA 1YULA 1H1TA 1O95D 1R6TA 3CLSD 4CT0A 1KKUA 3JXEA 2J07A 5FO0A 1KORA 4R0NA 5H7XA 1XNGA 1N78A 2R5WA 3ND7A 4MW9A 2CYCA 5DEOA 3PZ0A 1KR2A 1JIJA 3RBAA 2A84A 3IODA 1K4MA 4F4HA 3FHJA 1PFUA 2PIDA 1U7DA 4X0EA 4XSVA 3FG9A 2QJFA 1MAUA 3VU8A 1O0CA 3IVCA 3A4IA 1JMVA 4L2IA 2VTBB 1N2EA 3KT8A 1WY5A 1O94C 2C5SA 1X8XA 3H9CA 3IMEA 3AL0C 4MW2A 4MVYA 2E18A 3A2KA 2XRYA 4MQ6A 2ZUEA 1S4MA 1OWOA 4MUIA 3MUEA 3FH0A 2WB2A 5TGTA 4MW5A 4OUDB 1N77A 3CLUC 1HYBA 1SURA 4CDNA 1JEDA 4MUEA 3COWA 3MMXA 3MLBA 3CVUA 1ZJWA 4KR6A 4GRIA 4XFJA 4ZT6A 2ZP1A 1KP2A 1KH2A 2IP1A 2I1LA 2WFGA 1WXGA 1PFVA 1JHDA 4WNYA 2CSXA 4YP7A 4ZT7A 1N2OA 2PXHA 4U63A 3ZXIA 2X1MA 2J08A 3COYA
chains in the Genus database with same CATH superfamily
3LVFO 4D9IA 4ZWNA 5HXAA 4F6CA 4DR1B 3T3OA 2E4YA 2WDZA 4I50B 4ZU6X 4EUHA 3IRUA 3KOWA 4H7KA 3ORHA 1XVAA 1YAJA 4GIBA 3SSAA 3CKYA 5EIXA 4H7HA 1KZ6A 3C6YA 2Q8QA 2WWWA 4GWLA 3ENZA 5KAMA 4M8NE 4HNGA 2UZ1A 3TMYA 2ZBPA 3RW9A 3J80A 1QCZA 2O2DA 2NUTB 4AJ9A 3HA7A 2YN2A 3GLFE 1J22A 4EVRA 4TZ6A 4C4SA 1TCCA 2F3UA 3GCDA 2WFLA 1KA9H 3HTXA 1C4XA 1FNMA 1V1RA 2GCGA 2WHEA 3LY8A 4Z4HA 5CA0F 5AW4A 3LE8A 1L1QA 3FOAA 2YJ5A 2B1IA 5CCEA 4ZQEA 4Q3DA 1PK7A 2W00A 4HK4A 3ZD6A 1WB5A 3JSXA 3MQ4A 2AXQA 4MO2A 1OH5A 1XDUA 5IVHA 5AM1A 3VOAA 5ECYA 2R7MA 2RHCA 2XZDA 2Q3DA 2ZT5A 2DQYA 3OJ0A 2WAAA 4HSEA 3T7KA 2N9UA 2YWHA 1ES9A 1VBNA 2F1JA 4MVJI 4N49A 3KL4A 1IJBA 1Q92A 2Q3MA 2VO1A 4GC5A 5DLPA 4BOYA 1UIMA 1EE1A 2RC6A 1WD7A 3PUKA 5CM2Z 3GCXA 1Q44A 3F71A 1NUHA 1HTBA 3HPRA 2XZOA 1M6VA 2R1ZA 2B2NA 2GQ0A 1EGMB 5KJ6A 1Z6GA 4WGFA 1PR9A 1KQPA 2BI7A 1KAQA 2PFGA 2QR2A 5EFZA 4UNRA 2AF4C 4EENA 1HSOA 1U3VA 1F0YA 2Z95A 3WHLA 3WHKA 4F7DA 4NU0A 1X1DA 4BE7B 1DZIA 2JZCA 3MS7A 4QX6A 2M6KA 3TDMA 1E0AA 2J3KA 5JFGA 2FX2A 2D2IA 1JDBB 1FU7A 5KYXB 4NTZA 2DOKA 2AKAB 1NC1A 2Z3WA 4DZTA 1QFJA 3JD4A 3S2YA 5KS2A 3BILA 4XWKA 1ISIA 3KK0A 1X8JA 3W78A 3WMWA 1D04A 2ZKIA 3P4XA 3UUFA 5DBGA 5B3JC 1OTXA 1NBMD 4IJMA 2RFLA 3BB1A 4WN9A 1S8FA 2P6PA 2WUGA 1E18A 4D9MA 3DWEX 1MVOA 1QGDA 1F5SA 3MG9A 5DWVA 3WLRA 5BV0A 4INPA 3JQ9C 2A5FA 2GK4A 4Q0MA 4GPEA 4FX5A 4C4RA 1GQRA 1U8AA 4FJ1A 4CT5A 1IEXA 2P6OA 3CLRC 5KTKA 3KSUA 1T5SA 1BVRA 1QH8A 2Q45A 2WYWA 3QU5A 2DYKA 1UZAA 1HRDA 3RRJA 3SSOA 2ACWA 3ZCUA 4EJMA 4G97A 1UEJA 3FVVA 3W8RA 4XIJA 1Z5VA 4XZ3A 2GOYA 2HK7A 2OKCA 5D01A 2W4IA 3V6MA 2P2NA 5AESA 2CLHB 3Q12A 4JYCA 1SB9A 4UBNA 4W8HA 1WP9A 1KRWA 2C9BA 1R0XA 4XIGS 4YRRA 3ROQA 1G6KA 1YF3A 2WC1A 4BNHA 3FDFA 1JGTA 1E3LA 2R6R1 3HXKA 4Q3EA 3TIFA 1ZITA 3V00A 4KYTA 2WTMA 4I5FA 4C87A 3KTAA 5ICFA 1VBMA 2B2XA 5BY2A 1ECFA 3VO1A 1ZU4A 2J46A 4YMGA 3L1VA 4A7PA 4YAJA 3FA2A 4ZV9A 1FNSA 5IAOA 1EU1A 1AKQA 2A9PA 5CYGA 2Q5EA 3KLNA 3PZRA 2GTPA 3F6BX 3F4KA 4P35A 4WE3A 2B21A 5J4HA 4MYUA 2AEJA 3LC1O 4MQEB 3ZHOA 5J4YA 5DP2A 1V6SA 4YQZA 5L6MB 3OY2A 2RGXA 2D59A 1PFWA 3EGEA 3I04A 3IE2A 2P4QA 4P3NA 5LJLA 4KUGA 3QE9Y 1HM5A 2QV0A 4WOJA 5AICA 4XW2A 3IAM6 1WNZA 3ONEA 1U2TA 1Z16A 2GO1A 1E1NA 4R1OA 3VUFA 1AO0A 2ZAYA 2RJOA 1UMCB 2AJCA 4JB0A 4QFMA 1E5QA 4JLJA 1V41E 4IDNA 5FI1B 1GCIA 1Z08A 2RHGB 1T1EA 4JQYA 3DLCA 4PCUA 3AUAA 4P53A 1IWOA 1CY1A 3ZLTA 5B7PA 1PYGA 2ZRAA 1RHQA 4FDUA 1QIKA 1LDEA 3L41A 3HGQA 3MWYW 3IP1A 1EDEA 3DZKA 3CNLA 2ISSD 4LXQA 3VA7A 3U3KA 1NN1A 1F7VA 2PNJA 2XUOA 1ZUD1 2EWVA 3WGOA 3UMCA 4GFDA 1SXPA 1I6KA 1L5HB 4PWZA 3ZNNA 3G8AA 4V0OA 5CX1A 1U2DA 3SK0A 2GYWA 4RW0A 1CY4A 2M6LA 4C21A 1JZSA 4N76A 1O1YA 1G8YA 5D8DA 4XASA 3BRWD 3DVAB 2NYUA 1P2FA 4LKRA 3W05A 3N1UA 4HUTA 3HCRA 1EWVA 2GZRA 3FTQA 4OEHA 4Q4HB 4Q9JA 1H8EA 4NU5A 2Z8ZA 2Q49A 3DDOA 1KVSA 3IP3A 2AOTA 1W88B 4J9VA 1A97A 3WFZA 1EUQA 2JIRA 3TGLA 1YUBA 2V7EA 1CU1A 1GLVA 1K7CA 3EXIB 1CEYA 8OHMA 1DLJA 1UJBA 4KI0A 3L8DA 1GN8A 1DJLA 4PPQA 4PZZA 2WSMA 1WTAA 1L3IA 1WAMA 1XZEA 1DG3A 1R8XA 1OH6A 1DRJA 2A2ZA 4G41A 4KFUA 1KC3A 1GN9A 3ED5A 1OD6A 3F49S 1FTNA 4N8DA 2A0FA 5IH3A 1CRWG 2COKA 2VOEA 4YGXB 4D42A 4L02A 5CFZA 1CX9B 2FF5A 1QRRA 5DT2A 5KSZA 4RPJA 4EY3A 2XDAA 2F1OA 1S7CA 3LOUA 4KL8S 4MVJA 3IUMA 5FBLB 1IEWA 3OEHD 4CM7A 5AKZA 4EG5A 1PD1A 1Y9JA 3N59A 4J0DA 3ZQKA 4YMVA 1G7CA 2VZ9A 2PBRA 1B0ZA 4PXSA 4YLGA 3TB4A 3VU3A 1GKUB 3W9SA 1V35A 1ISFA 4DR5B 3Q9NA 3SGLA 1UC8A 2DETA 1CYEA 2R1VA 1KI1A 3SD7A 2P75A 3O83A 1KDRA 1ZGCA 1SD5A 5F77A 1XWFA 3GJ5A 1RLTA 2O20A 3JPYA 4REQB 5CW2A 3FJ1A 4UOZA 4AMZA 2IT1A 4NOMA 3NOXA 1NATA 2B1RA 2FUCA 2QA5A 2QY6A 2JLVA 4RKYA 4B0OA 4Y6RA 4ZVNA 4HAWA 2GHQA 2FSSA 1R12A 5FBHA 5TMEA 2PRIA 2PH3A 3T61A 5IVKA 2Z5GA 2P7HA 3N75A 1ISGA 4Y9RA 4W82A 5AKXA 2CBGA 4DLBA 4R68A 1WBBA 5KU7A 3IB6A 4JI8B 1VKHA 2OORA 3BREA 2E55A 1NN0A 1G0NA 2I4NA 2HHAA 1XT6A 1GG5A 2FMXA 2YWRA 3KQYA 3A6GA 1YBFA 4JBHA 5AJXA 3DZCA 3R2JA 2XWQA 3QF7A 3GPLA 1SVNA 1ZH0A 2Q9BA 2FAXA 3EISA 3IP5A 2QNIA 5FO1A 3SJCA 4QNMA 2WHYA 2BYTA 1OUMA 3GUVA 2XQFA 2CJWB 4KIUA 1S8NA 3ETEA 4UE3S 3RYFA 1ZH6A 4B46A 2WFDA 3O4FA 3KKOA 4MVJP 4ZOLB 5DGDA 4BO9A 5BSGA 1JFFB 2H29A 2TECE 2PK3A 2M9MA 3LNTA 1GZUA 2QTZA 1XVVA 1KMCA 4RF3A 3PR3A 1CETA 3LKDA 4ZCMA 4TS4A 4IIDA 3WTCA 3K1ZA 1ONNA 2O0KA 3HO1A 5IM4A 4PYIA 1GQYA 2H11A 2FUG1 4MI3A 4PS0A 2A1UA 2AVNA 1RHJA 1TA0A 4J2HA 1SO8A 4IILA 4KNWA 5EQFA 3WLKX 3ZXUB 3IUPA 5J1TB 4Y98A 1O6BA 1DHRA 4G01B 3RRXA 4BVAA 4E4RA 4BQPA 1XPJA 3SF8A 1K3TA 3UWSA 3A3KA 4IAOA 4PLYA 4S1WA 1RBZA 5DNDA 3C39A 2A3RA 2HU2A 2Y05A 3F6SA 4JLNA 2Z2ZA 1NY5A 4Y2XA 5HQJA 3DVQX 1SUBA 3BM5A 1RHRA 2R7KA 4XQGA 4CEJB 3ID6C 2AF3C 5DLEA 2VDOB 2P9YA 4UE6A 5D87A 3WMRA 5EPOA 3C5WP 4EJFA 1N33B 2CMHA 4K9NA 2JH9A 4YRZA 5FUMA 1KYIA 4XWWA 4RF2A 2N46A 1OXUA 3A3OA 2PKRA 4JOCA 3M6IA 4P8RA 2IV7A 5DTRA 4GOLD 1KVQA 1X8KA 2FSVC 3HL4A 1JHPA 3UGKA 1YOVA 2C1ZA 2IE0A 3DMNA 3N70A 4IY1A 2ORYA 4ZOLA 4I36A 2DWOA 2ZATA 1DBVO 1WDMA 3MTQA 2C8LA 1PEAA 2JLXA 4DLXA 1FTSA 4AF8A 2IX9A 2IS2A 1ZUNA 2WJWA 3ZZNA 4ZEMA 3Q8LA 1R0LA 4MRAA 4ZZIA 2DVMA 4EELA 5FHRA 3H5VA 3I2YX 4M0FA 1ZIPA 3HWWA 1D2HA 1WUIS 3CG0A 4MV7A 4AJEA 1HG1A 1D9XA 2VUIB 2BJHA 4I50F 3FUUA 3G2PA 1C30B 1GPMA 4RXUA 1IN5A 1UK6A 5LA6B 5K8VA 2J48A 4HF7A 5F7ZA 1S6YA 3LOQA 1UMBB 1ULSA 4KU4A 3WZMA 5MFPA 5SZHB 1JMKC 1XRQA 4YJ3A 1E2FA 5BQFA 2G4CA 2KE5A 1BD4A 2VI5A 1YDMA 4KBGA 3NM6B 3FF4A 5EIAA 4B45A 3V80A 4HWTA 5EWJB 2C2BA 3UW1A 1P17A 3CEHA 3PDUA 3L7NA 4D8YA 5LNK1 1X80A 1EM6A 4XJXA 3QELA 4LV6A 2WVGA 4REOA 1ECJA 5CEFA 4TXHA 4CMCA 4DR6B 2H0QA 4HJRA 4IXWA 4ZK2A 1DQPA 2J5XA 2PGOA 2DUMA 1EP2B 4B6SA 1AJEA 3N2GA 2R7LA 2D54A 3OE4A 1QO0D 3EWAA 3AVVA 1AKYA 3KWJA 2G82A 2D1YA 2LIVA 1N3LA 3F0TA 4OQYA 4NEHB 5IJXA 2C54A 5BSTA 3RS3A 3WL3A 4EYQA 1JR4A 1Z6QA 4FNMA 3TNYA 4WK4B 4JEHA 5GJCA 1M9NA 1KWKA 1DOAA 1P77A 3K31A 3K32A 4PSAA 1YJXA 3G1TA 3CZCA 3C16C 1P0PA 2QJWA 4IHJA 2HSEA 1BGWA 4KZPA 4X71A 4B6GA 1VB5A 1ZRMA 2A67A 2OESA 1H3FA 2GXSA 3C24A 3JQCA 3KVVA 2OZVA 3ZJTA 4PCAA 2AOXA 3EEBA 4YY3B 3KUUA 2V9PA 1SHUX 2X2OA 3AKDA 4JLSA 2OO5C 3INNA 4PZPA 4FPXA 3EMBA 2D7CA 4R40A 5G4LA 1RWKA 2BTEA 2AYXA 1SKYB 4WDQA 4BMZA 4E5SA 4I5DA 4IVPA 3KKQA 3DTVA 2CXUA 1LLQA 4RGQA 1I30A 1X39A 3Q7QA 3QKRA 3IV9A 1XNQB 4UUAA 1RRPA 2YHIB 1X92A 4EB3A 1V2GA 3SX4A 4BWVA 4NBVA 4WTOA 4UPEA 5JASA 3IERA 4W99A 4U6QA 3ZI7A 2YOHA 3TZEA 4LAFA 1L8QA 1JXOA 4MUXA 3JQPA 3P94A 4ETMA 1ATIA 3BMOB 1YIOA 3HB4X 3OC6A 1CF2O 3RS5A 1YRLA 5KVQA 2IP2A 5FO0A 1EFCA 4X8OA 4MR9A 3HMKA 1KJZA 5DK6A 5FNVF 5GONF 4L3OA 4FW9A 2D2EA 5F21A 3OZXA 2MWMA 4C14A 4Q5IA 4TL7A 2VPTA 2QQGA 1FVOA 4A0RA 3VH4A 5IU6A 1ANKA 1JHUA 1O2DA 4GLOA 1DG1G 4OJTA 2CDNA 2Z1MA 4QYXA 3IUNA 4Y2JA 3SX0A 4QTUB 5HOEA 3IPCA 5KWJA 3OEHA 3ENQA 3I5MA 1NPDA 3AONB 3K70C 3QBTA 5P8WA 2IQIA 4PRZA 4YFYA 1QGED 2VNKA 3PUHA 2Q0HA 2JCVA 4LWZA 2B34A 5AM2A 5IXYA 4TMTA 1TUGA 1NHWA 3DDWA 4KFTA 3UF0A 3MGAA 4EEZA 3EPJA 4JNCA 1FU8A 4F9FA 4R7TA 3MTGA 3ASVA 4B2IA 4YLEA 4IHKA 2G1AA 3STTA 1TM1E 1UM9A 3NTUA 2HLDA 4BTEA 1YK0A 4K2HA 4BKRA 5IKXA 1ZXXA 3SXJA 1NMSA 3FH0A 5B3AA 4CIXA 3IKMB 1CP3A 4YXWA 2OXEA 3JASA 2O59A 3GRRA 4GMKA 4EH1A 4X1IA 2XUQA 3D3WB 3MJHA 1OXKB 1T9ZA 1G5TA 3UB3A 1KNQA 3K6JA 4OM7A 3RHZA 3G9XA 1C8LA 4M88A 1U90A 2IV2X 2FP4A 2OD7A 3E3AA 1SD2A 1WULS 1KH2A 1QHGA 3TKAA 1YONA 2WFGA 1GSIA 4MIEA 2JI8A 1MX9A 3VZDA 4XR4A 5CUQA 4F3NA 3ANNA 2GHIA 1TIKA 4NNPA 1TL7C 4QFDA 4JIGA 4IDPA 1RI3A 3WJAA 2Q3LA 4KH1A 1SVSA 3ZXIA 3MNFA 4DV5B 4AJHA 4XPIB 3ND5A 1LLCA 4YB8A 3FKQA 1A7AA 4M8KA 1EZZA 4B8YA 3RVNA 2VBCA 4L5AA 2D00A 1CUFA 1WSWA 2BMDA 4RHFA 5CPBA 2PZMA 1JA9A 5T4HA 1OWPA 2WD9A 5ENVA 2JLWA 3OEYA 2I9KA 1DRVA 1XJWA 2VQ3A 1ZD9A 3G8CA 4TRMA 3R7WB 4RTMA 1B0PA 4IIJB 4QASA 3U0BA 4DT1A 4FD3A 3H7IA 1I6LA 3MRTA 4TMWA 7GPBA 1V26A 3AESB 2H16A 2B94A 5JPDA 3BZUA 4NMHA 3U7FB 4KDRA 4FXOA 2OAP1 2QR5A 3ELUA 1ONBA 2GAAA 1ZAKA 4NF2A 3JQRA 5KDDA 2EBFX 2Q3JA 3FUVA 2C83A 3TQFA 5KJEA 4ZOQI 3KAQA 1L4MA 1OTYA 1UFKA 3IR6A 3Q4GA 4ND1A 3PB3A 4WCDA 3Q3IA 2QN8A 2R87A 1AQIA 3LYAA 2OECA 4KRGA 4LZAA 5DCUA 3S7TA 3WIUA 4E5PA 1T0UA 2I3GA 4KSYA 3NHRA 4Z4IA 2OQRA 1QTIA 4HEHA 4AJ2A 3IUYA 3DB2A 4BN5A 3LS2A 4GMHA 4BRWA 2ZYDA 3FCOA 3BL8A 3VKFA 3ZBPA 2J0EA 4PAWA 1YJBA 3T54A 4NCNA 3PD1A 5KOHA 2WU4A 3AFGA 1YI8A 3PI6A 4WZBB 3ADBA 4D9JA 3CMMA 3FPKA 1I94B 3CC8A 3CH6A 3L01A 2VBIA 2HM7A 5GONA 4I9GA 5ITZB 1F51E 1NVWQ 2GTIA 3NEPX 4R51A 5CLHA 1N9ZA 5JARA 1U3DA 3UV6A 3EIOA 1ABFA 2WDPA 2ID4A 1G16A 5ALVA 4BXOB 3B3FA 5HJ5A 4MK4A 4QRDA 1G5IA 2ZIFA 4DHEA 3PXBA 2ZI7A 3QV2A 2WNSA 4JLWA 1VL8A 2OZLA 5F9HA 3AJEA 3CLKA 3R3UA 4X3OA 4XAQA 3VKGA 2NTYC 2QL9A 4MYDA 2IIQA 3FMIA 1G21A 1B2LA 1Z39A 2DJ5A 3CONA 3A28A 3GAFA 1EQUA 4IVRA 2PX3A 3CRW1 4WL0A 4QYSA 1UBHS 1KL7A 1Y37A 1GG9A 1XLVA 2P0AA 1RRKA 1QFZA 3GX1A 5ESXA 4ETWA 4I5GA 4YR7A 3K70D 1EUCA 5FPPA 1OI3A 1OWNA 4Q4CA 3E84A 2QI9C 3DDUA 1CFJA 1I4LD 1LD3A 1T8RA 2PGDA 4H7EA 4UDYX 2AKEA 1DTEA 3KDSE 5AGHA 3O0AA 5H68A 4BVKA 4M1MA 4KWEA 4XDHA 3NG1A 3BMQA 1WW2A 3MB5A 5IFLA 2OHVA 4XUDA 2Y27A 3CJTA 4DE5A 4CQMB 2WT9A 3T3MB 3D43A 4I1UA 1D7OA 2L0XA 3A1EA 5IDXA 2FJPA 2XCOA 4EW3A 3I42A 5SY4A 3DL2A 2FEMA 1QF9A 2Z5LA 4MLZA 5C1IA 2NOAA 4GEGA 4FYVA 3WIEA 3OHSX 1DRUA 2ZROA 1VZ2A 2GB4A 1S2GA 3LQ1A 4IINA 2HA3A 2C4VA 2Y4OA 2O5VA 3E23A 1I5OA 1VHQA 4R1SA 2X0NA 4A2CA 3L7BA 1BE8A 3GRCA 3HUTA 4BCDA 3UBTA 2QRZA 2I4RA 3JVDA 2BJVA 3MHPA 2X13A 1XKQA 3QLUA 4U8GA 5ILGA 4EITA 4LZLA 1FJ2A 4IPTA 1CF4A 1N5JA 2BY4A 2EJVA 3GJ8A 4QGHA 3SLKA 1II8B 1KS2A 1M1YA 3K1YA 5J63A 4B32A 3HKCA 1AKVA 5BVGB 1D9ZA 3QENA 4PICA 4PE5B 1N9KA 3MT9A 1ISJA 1PLLA 1RQNA 2GA8A 2RGNA 1RJFA 3A9VA 3EXG1 2H2HA 3H2GA 2PVCA 2CNOA 3ZWNA 4CM3A 1FDIA 1ZPDA 1NULA 1NRIA 1ZN8A 4I3FA 4JFAA 3TTSA 1SHKA 3ROGA 4Q15A 4D9KA 1RP7A 3BCHA 3RSSA 4B6FA 4ILKA 1ENPA 4YAWA 1Y3CE 5IC5A 4GPZA 3PBKA 1QJCA 3ES9A 1KMIY 1ECPA 4JB2A 4HUQA 4RVUA 2V98A 5EEHA 1RW4A 3HVHA 5BQXA 4HX2A 3BIWA 4DIEA 3VOTA 3LUBA 2AFHE 1LSSA 1G3MA 5FCDA 4PR0A 2C7VA 5JO9A 3D4BA 3B5IA 1ZA2A 4D8VA 1U5AA 4NICA 4TYNA 5JYBA 3KZNA 1RWXA 4F2GA 4JBLA 3UQYS 4OKNA 1FJHA 3V2HA 1M5RA 4MRMB 2J5RA 1NKSA 1IN6A 1YBHA 4JU9A 5EHXA 2OZLB 2H0AA 1LPPA 2RONA 4BQEA 4JCOA 1G9XA 1EB9A 4ZCLA 1YS4A 3C14C 1XKTA 3QUQA 3QWBA 4M1KA 4PQYA 5FUVA 1UPFA 3G59A 3L43A 5LCXA 4CV2A 3A36A 2EBWA 3SEZA 1R6XA 3W90A 2X77A 3IXMA 1FPQA 5AJZA 2CJYA 4CIWA 4PEVA 2XT0A 1G64A 2P40A 1GTVA 2XRFA 2OO3A 3CN7A 3NV7A 1MTOA 1OAKA 4PCLA 2WWRA 1CZNA 1XYGA 2FR1A 3CUTA 3L8GA 4JGIA 4FN5A 4WNAA 1GG8A 1UWCA 3ZW8A 4DEVA 4ZYVA 1I5EA 1IDOA 1YQXA 3B1WA 5HIIA 3I39X 1M1YE 3WLIA 9LDTA 1X1EA 2C00A 2QUAA 2FPRA 3MJEA 4H27A 1MEJA 1V4NA 2QDXA 3L06A 1KO1A 3AP3A 1R6AA 4IDOA 4LHYA 2BFEA 3PP8A 3C48A 4N5MA 3S1LA 1FF9A 5HILA 4Z4EA 5KVSA 4C3ZA 1CUEA 1M6NA 3PPYA 4L75A 1VG8A 3LT4A 4P81A 4QL3A 5KOJB 1PJQA 3RSZA 2AZTA 3L79A 3LC0A 4PQGA 3PEUA 2QAJA 3QFFA 2IOQA 2SKCA 2GERA 2YN0A 1TF5A 4QOHA 1U5BA 3WIVA 1KYZA 3O90A 4KXXA 1PGQA 5B4UA 1SHJA 4KWHA 4UHCA 1IY0A 4LXGA 2H92A 5K0SA 3OT5A 1DEXA 4KSBA 2B4YA 4ASUA 5KQSA 3VJLA 3FE2A 4FE3A 1ZI6A 3LC2O 4U2GA 5C8VA 2F1RA 3JYNA 1ORTA 3H9EO 1E2LA 2ACKA 1V48A 3STVA 1R9JA 1HBJA 1XL1A 2WHXA 1KHTA 4HJXA 3TG8A 5K3FA 3HBNA 5GONB 4M76B 1BCRB 4GP6A 5AWFC 4G5GA 2EKZA 1UDZA 5B1DA 2Y2UA 4CG3A 4PONA 3JWGA 4D8UA 4LQDA 3DLPX 4E14A 2REOA 4HX9A 3TLCA 3QFCA 1W0JD 1LH0A 4AF6A 3OQIB 2QV7A 5BMVB 1NYLA 3E2IA 2EXXA 5L4LA 3K6KA 3EPPA 3FPJA 1FS6A 1Q21A 2OQIA 2PM8A 3SZUA 4Z6KA 1D0SA 3ORRA 3R7BA 3T0FA 1Z0UA 4BJ5A 1QIDA 1W35A 1XFAA 1E8MA 4KDFA 4WOCA 2EW2A 1MMFB 2I03A 3BCUA 1NUUA 3TW4A 3ZEAA 1P4GA 1U9IA 1RAGA 1EFUA 2I29A 3LUHA 4C7XA 2JAXA 4HFJA 2ZRKA 4QUGA 2FVXA 3WYEA 5A04A 3Q6NA 4EYOA 4ND6A 1NVTA 5JSQA 5D3KA 3D3NA 4PN3A 1EWKA 4LPSA 3RT7A 3MMNA 5JFOA 1DBIA 2ZIXB 2GAFA 4BBAA 2GBPA 3BB3A 5H9WA 4R8SA 4PYKA 4O1HA 4TTIA 2PMKA 4HLCA 4BBPA 1P9WA 3OICA 3PQ7A 3KAPA 1UM9B 4F4HA 4YCDA 2RI0A 5H8WA 4TTPA 4WFJA 1M34B 4Z86A 1DKPA 1BX1A 3WL8A 1VLHA 2FB9A 1F9AA 1P0QA 1C8BA 4DMRA 2FUKA 3WLAA 5IZCC 1ZNWA 4K6FA 4MA0A 1B76A 4JJ8A 5EMMA 4TUYB 5KDLA 2C4WA 1TZCA 5AVUA 3G02A 4MKZA 4O4LA 4UFNA 1C1XB 4B33A 1ZJ4A 4D2IA 4QU9A 2WMDA 3IOCA 4CLOA 4LJ7A 1XTUA 2NU6B 4FOSA 3RVKA 2MTBA 3WNBA 3RIYA 1GP2A 4COOA 2HMAA 1GNTA 4MGIR 4UEWA 4XRGA 5HTOA 3OWXA 3PFKA 1N2SA 1V5FA 2PKYX 1RQRA 2BR3A 4YAOA 1Y7PA 1ESZA 3D3WA 4P2BA 4C20A 6AT1A 5C9ZA 3M9WA 1E1RD 2ZWOA 4FOTA 2X9VA 3HGTA 3FLBA 1XD2A 1NXTA 1T5OA 1Y42X 3AF0A 3BDAA 1DXQA 1GUFA 2C5GA 2G06A 4N7JA 3PI7A 2JB9A 4MR9B 1G8GA 1NTOA 3BJIC 3ZIDA 4AB1A 2GAJA 3L84A 4YRKA 1XA0A 4D02A 3OA2A 1G4HA 1IHOA 4E88A 4H4DA 1ADGA 3O91A 2ZSUA 1OLOA 1D07A 2PSEA 4K86A 3WK7A 3TD2A 4L3WA 1LBQA 4NLLA 4R83A 3TN7A 3P20A 4X6XA 4BVBA 1KDZA 3DEHA 6YASA 2QYHA 3DOJA 2RJNA 5C1DA 2OB1A 3UFXB 1NVFA 2CGEA 2YRXA 4FNAA 1ZD8A 3GPDG 5AOAA 2Q7OE 1RYMA 3CBGA 1RQPA 1PR1A 1YQQA 2QP3A 4RIGA 1HETA 2D5AA 3FYCA 4D97A 5FTLA 3CCCA 3OX1A 3SZGA 4NFLA 4NH4A 2J0UA 3KQTA 3QHQA 1HNWB 3PFBA 4AJNA 1BW9B 3IFSA 3KDPA 5EZSA 3GUYA 3W4IA 2C9ZA 1TJYA 1HF3A 2JI9A 4IHJB 4WVLA 1LPBB 3DT8A 3QRWA 3R75A 4V1CI 4B8ZA 2VXOA 3M82A 3OQBA 4LJ4A 3RC9A 3ZW7A 4B7XA 4B74A 1GGFA 4ZT4A 1ADFA 1Z5OA 4C4YA 2IYLD 4FIDA 2VTBA 2BGGA 4NECA 4G89A 3FTFA 3NFYA 5K0NA 5HQ3A 3G49A 3WADA 4CCWA 1H2BA 2FWPA 3VC2A 1UBUS 2GVDC 4Q47A 1XRSB 1RM5A 3VPGA 1KAMA 1VPTA 3BXEA 1X80B 4FC6A 2OCXA 2DP4E 1WVGA 4G67A 4I66A 4X1KA 4ZVUA 4U6NA 1EQ2A 3FLAA 3VZSA 3AP1A 4BMDA 4UBKA 1ZVMA 2AVDA 3DMTA 4PXAA 3WTBA 3AUYA 5IAGA 3BMCB 3D1JA 3EXEA 4G8JA 1C7ZA 1UPXA 3LZDA 4BGUA 3N8DA 4IHQA 3FIJA 3UWMA 3GZJA 6PFKA 5I7FA 1XAGA 4Y6GB 3E2PA 1VYUA 5I5GA 1H5NA 3QK7A 4AY2A 2H4WA 2VQ6A 3UJ3X 5TDHA 1G3RA 1XO1A 2IJGX 3ZBTA 3LVRE 3TQQA 5KCMA 5LU9A 5LDGA 3K0BA 5BRAA 5JRDS 1JYSA 3NIBA 2CVHA 2A30A 2WF6A 3DMTC 4DV0B 5JJKA 1UP4A 3G8BA 1UADA 3LUDA 3DAPA 3FMVA 1XNGA 2GPBA 2JA1A 2P1ZA 3IRVA 3V4OA 4JA0A 5T4FA 3DWIA 4HWSA 3PTZA 3ADPA 3L7DA 1K75A 4I1YA 4IDCA 1JIJA 2G5CA 3N6RA 2I6SA 4OGGA 3RC7A 3FHJA 3TCXB 2J3IA 1TA4A 2Q3BA 1KMHB 2AI1A 3QXJA 3PC4A 3DBHA 4CKWA 5HJEA 5CVUA 2J3MA 2ZIUB 4LGCA 3I30X 1QBGA 2GJSA 4OP2A 4BBZA 3HSYA 3KC2A 4BJHB 2VJDA 2Z83A 4PC1A 2EDAA 4QPJC 2JGFA 4TXJA 4UXIA 5DX0A 4LUCA 2B20A 1O94C 4HDKA 4XEHA 5EMLA 2HSWA 4D9EA 2DUWA 2ZJBA 3EXHA 3HRKA 4ZDKA 4HUJA 2CVFA 1E1RA 3EXFB 3PQ8A 3LGSA 3OI7A 4K05A 1PW7A 4PAOA 5FPYA 4X64B 3HEAA 2Z04A 3MUOA 4X63A 4B3CA 3PX7A 3VSBA 3DBRA 2G83A 2FJ0A 4IXTA 5BYBA 1BDBA 3I6YA 2HK8A 2I6XA 2ZJ4A 3IE0A 4BY9E 1JEDA 4ZODA 4Z9YA 2IYWA 1IG0A 2BFNA 2CL6X 2XMRA 3AKCA 2BV3A 2VUTA 5IT9A 4FYHA 3TSYA 5MN6A 3H1TA 4LQCA 1OYWA 3GEEA 1I3NA 1TB4A 1XZDA 4CIVA 1Q22A 1WNFA 2OM6A 1PCXA 3IP6A 2GMWA 3MPUA 1S8AA 5FUYA 2YV4A 1P60A 3VBEA 4MLDA 1B1CA 2YKGA 1D4FA 2RKBA 2ZOSA 3MJ4A 1YZVA 5A7GA 4ZHQA 3ITKA 1PFVA 3LIIA 3RBXA 1R64A 5WRFA 3IQGX 1KYQA 3N8IA 2VHWA 4AZSA 5F73A 1UDAA 1LFDB 2B8EA 4CIYA 5K3AA 3FPBA 2X41A 4Q9KA 2OZEA 4AJ1A 3TW0A 4UFPA 1E3DA 1NMXA 4XVUA 1OX5A 2JD0A 5BVHA 5KNCH 3SQWA 3K05A 1XMQB 4RJTA 3F6PA 2IPXA 2LXNA 2MINA 3E18A 5DF1A 4OHWA 5FA8A 1B23P 1EQAA 2XYVA 1UDBA 3S5UA 1ZUHA 1MB3A 1KETA 1MT0A 2FQWA 3X1YA 4DABA 4KYVA 3WLQA 3SBDA 1XCPA 2ZBQA 1EESA 1JECA 1WRBA 2W6IA 4RZXA 1RJGA 4W8GA 1Q0ZA 1TU4A 1BEZA 1PQWA 2ZUCA 3GAMA 5ENDA 4B6PA 1G8PA 3GXBA 4EMBA 1NWCA 1QK3A 2WJ4A 3COPA 3CX7A 4C0SA 2D2FA 3U9LA 5CDUA 2CSUA 3E81A 1NUQA 1YCHA 3I6ZA 3Q85A 1NE2A 2NXNA 1RRGA 1RLUA 3ZLBA 1ZIDA 1MH9A 3VYVA 5HSGA 4NJMA 4KPYA 2FEXA 3R6WA 3ZQ4A 2XUGA 2O14A 1CHNA 3RHTA 5FWYA 1I10A 3NIGB 4IEEA 4M9UA 3DE3X 5AI9A 4BNUA 5IKPA 2EJUA 3E9QA 1DC5A 1KI3A 1JEOA 2G4VA 2IY7A 1YUNA 3IILA 4QBGB 3TSWA 3V4FA 4HBGA 2ZI5A 3LUPA 4MV1A 4P83A 3TI9A 1IFXA 4B6RA 1X70A 3FPLA 3WHPA 3I32A 1LEHA 1JFVA 3MLEA 2WWFA 2QZ4A 4WLNA 2WYUA 5JH7F 4QWWA 2NM0A 1ZXLA 5TS3A 2FHSA 3RS7A 5F5LA 5ULLA 5F1PA 2DQ4A 2W6CX 2QXTA 3MTBA 3S44A 5JTUA 2PLRA 2X8JB 2FV8A 3HHPA 4YO8A 5BSHA 2CEAA 3KQQA 3QY0A 2ZYSA 3OQNA 3NNNA 3QTLA 1Y6ZA 2GCNA 2C8JA 4TT3A 4QREA 4QPDA 4H7PA 1IZ9A 5FFFA 3ZGXA 1SIBE 2BGKA 4NDAA 3P9RA 3IT1A 3N7AA 2YL2A 5HCIA 3ZU3A 5L3QB 4DV1B 3HDGA 3ODGA 5AVXA 3NWJA 2BDEA 4CF6A 2QJTA 4UAVA 5CFMA 5IRCD 1MEOA 1DOHA 2Z1DA 3DPIA 2YUIA 1V0JA 3R0XA 2OFXA 2GK3A 4JOBA 1QVVA 4N7RA 1YL5A 3HXTA 4NCJA 5DN9A 5JNTA 1N4AA 1T6YA 4QFCA 3U1TA 3NUGA 3QKUA 2EFYA 3QBDA 4CQMD 3AH8A 2FGKA 5JZOA 3PL5A 1WLSA 2OMEA 3T9FA 3LDHA 4GZ5A 4NJEA 2XYHA 2G9ZA 3JWJA 4O4IF 2SBTA 1X1AA 2QHXA 2ZAMA 5CH3A 4A6EA 5KIAA 3HP7A 1J1UA 4CUKA 3HADA 1DAOA 1E6UA 2VF8A 5EIBD 1H6DA 1A9QA 4NBLA 4U2EA 4CTMA 3FNRA 2DRIA 1PU2A 2HD4A 1ZBQA 3PV0A 5IYZF 1T15A 2M2IA 2FW8A 2ANBA 4ZVSA 4KQGA 2PS0A 4OPMA 2QPOA 4JUFA 3SPXA 1E2PA 3A10A 4BFTA 3THXA 5CK4A 2R4UA 4HXFB 2GM4A 2GM9A 2GJ4A 3ZGYA 4AZWA 4AN1A 3PQ2A 3QXCA 1R27A 2I7VA 4Y2TA 1FFBA 3AZQA 1KWGA 4TPKA 3H2HA 5FHQA 3O4RA 5I3ZA 4GP7A 3KKMA 1QQTA 2O9JA 3USCS 3N87A 4M8LA 1IUKA 4MV5A 3Q10A 3P19A 2QOEA 4XIFA 5ANRB 5ALNA 4DEYA 4DA7A 4YV1A 3D6UA 2EYUA 2JJYA 2XXBA 1YQDA 1PWXA 2W6PA 4W9RA 4KSCA 1EWTA 2Q2NA 2P9ZA 4FD2A 1H2ZA 3PWSA 2GCPA 3ABQB 2PBZA 3IHWA 3OJEA 1QFMA 2P5SA 4IJUA 5EIFA 1GGVA 3RSHA 4KVGA 4Q1FA 1T4BA 3KYBA 4J7XA 1DHTA 4IGFA 3O95A 3IPYA 4FEEA 4RMJA 3T7AA 3JQBA 4RPIA 4LJAA 2E82A 2YJ6A 1P5ZB 3DCIA 4CZ2A 4EX6A 1PZNA 1Q83A 1T43A 2GKSA 3KBBA 3N2EA 4YA6A 3ORFA 2OYRA 3UK7A 421PA 1AKUA 2QRQA 3Q7RA 3BD6A 3AZPA 1VYHA 1JR3D 1LI5A 2IYFA 1CZRA 2WYIA 4HWOA 4BFCA 4Y9SA 3HCWA 5ALMA 3R3WA 5CAEA 4IQFA 3UHJA 1Q95A 4HOYA 1ZH8A 1G1MA 2Z09A 1L7XA 1CUYA 1SBQA 1W49A 1PJRA 4NMLA 2FZEA 4JR2A 3VAAA 4XVCA 3QIVA 3VNUA 2EW8A 3DL4A 4MRRA 1NXXA 3UENA 1ECLA 2WIBA 3KR2A 3TAHA 1T4GA 4OJMX 3PFCA 4LDNA 5DV9A 4ZV4A 6REQB 4J07A 5K99A 5DHSA 2V65A 2G0TA 1AF4A 2NO7A 3Q41A 4NEGA 4MW4A 4C4ZA 1VIVA 4N82A 3A9SA 1BA3A 4NZYA 3UY4A 2R96A 3PU6A 1T35A 3H99A 3KJFA 1D2MA 2YWFA 1TUEA 1HDYA 2GJAA 2HX1A 4KAFA 1PSZA 1YH3A 3DD1A 1Z68A 2O0LA 3AOEA 3GRVA 4WVFA 5DASA 4RKFA 5C1BA 3ER8A 2WWTA 3MWFA 1Q20A 1XTSA 2BEJA 2JDID 3PKJA 1NG1A 4UTVA 2A4MA 2ODPA 4NDZA 5FTMA 4DLZA 4DQUA 3L8YA 1HEYA 3JAKA 3ESQA 2IOYA 3GJRA 2OCKA 1JP7A 2B5WA 3UXYA 3WGGA 2PLNA 3CZMA 3AJ8A 2R47A 3PXUA 5D7BA 5FOTA 2CF6A 1IIRA 3IR7A 4F5EA 4NBWA 3MBIA 3OAAA 3S2EA 3GFSA 2XNSA 4O0LA 3NCTA 3WYCA 2LPMA 3G6KA 3HKCB 3DT6A 3CE9A 5FP0A 3IH5A 1HE3A 3FTNA 1T10A 4E1AA 4Q1VA 3NBZC 2DBRA 3F7TA 1DMRA 1M6VB 2JGKA 1QAQA 1TEVA 2DR2A 1Q0LA 2GPJA 3K8ZA 2CDAA 1DWQA 1JW9B 2ST1A 2Y77A 1JLLB 1JQDA 2FZ5A 5AXCA 3X1JA 1TECE 3VHRA 3VAYA 3GD7A 4TMFA 1CEXA 1VP3A 3FSEA 4AKSA 5T3YA 1NI5A 5FUWA 1BXZA 1NURA 1BMDA 3REQA 2IGTA 1LNZA 4YMWA 2IUUA 3DL7A 3I8SA 4QBIA 3WLOA 2PSHA 1HQKA 3EH2A 1Q17A 1LTHR 3IXLA 4QNRA 1KBOA 2AC7A 1X1RA 5DHTA 3HYNA 1UC9A 2FVYA 5DI3B 3RAJA 3SHQA 1CIJA 1QC5B 1JLKA 2QW1A 4N3AA 4BZWA 3BQNB 4MWGA 1SR8A 2OD9A 1AZSC 1CE8B 1GLGA 2WF7A 2XB8A 4XM1A 1LC3A 5LA6F 4ZI2A 2QTNA 3KQHA 5IUNC 1QHFA 4F4FA 2WFEA 4MAFA 1E3IA 4DDKA 1QRSA 1KY2A 1B8PA 3VGJA 1Q0HA 3TLBA 1U3WA 2CHUA 1U3FA 1OOEA 1L5FA 2XUJA 3LSYA 1OJ7A 1JBEA 3R4VA 1FL9A 2JCYA 5BR7A 1EVQA 4O63O 2BM8A 2P3OA 2FFRA 3AB3A 4TTVA 1QU2A 3O47A 1IBCA 1POWA 1XCJA 3O2SB 1DO8A 4LWPA 5BO5A 2FKAA 2X8WA 4NENB 4BTVA 4MW7A 5C7OO 5C7YA 2EQ5A 4I9FA 2MU1A 3R6GA 1Q3KA 4RO0A 2WPDA 3GUZA 3AVYA 4JUIA 4EG6A 2HF8A 1Y8CA 4OFZA 2VJYA 2WWGA 4ZO8A 1NQ5A 3KE8A 2P9BA 4IX9A 5EN4A 5KYKA 3L7JA 2IBSA 4YJ2B 1Z12A 3I9V1 1CYDA 4IM7A 5JD3A 2XYRA 2D62A 2VJAA 3NTVA 3HDTA 3O2NA 4DWVA 4KO2S 4KQIA 4GDFA 3JRWA 4I5IA 3RGGA 2IEDA 1MO5A 2Y67A 2JATA 4FUQA 2QI9F 2YHSA 1GCGA 3ZVRA 4RVNA 4DA9A 3EIWA 2KQUA 1ONOA 3KYDB 3V1NA 1T8SA 4A8PA 1GYRA 4U2BA 3I9KA 3PVCA 4MUNA 4K26A 1BU5A 3TLGB 5F2NA 2YFQA 2JAOA 1P1IA 1J39A 2CUTA 2AMVA 1BX3A 1GSOA 1WCYA 2AR9A 3R3SA 1ZVJA 4MLCA 1P6UA 1X19A 1I8TA 3F4LA 3IXQA 4N0QA 4UM8B 3RK0A 1HZZA 2FSUA 3PVZA 1TYAE 2C2OA 1P45A 2CHFA 2PLAA 5JMPA 1NXWA 1ZONA 2P9HA 3RRMA 3WNCA 2ZJ1A 3QVVA 1BDIA 1NNI1 3D7RA 5EG5A 5JNUA 1ZHHA 1SCKA 4EEXA 2QD1A 4EHIA 4FCWA 4GWKA 2KS6A 5TJ9A 3S55A 1N2ZA 4WMLA 3GLFA 3VO8A 1JEYA 1A4IA 1H6BA 1UFOA 3AEZA 4XIYA 1RZRD 1Y4SA 2Y68A 2R6DA 2B9VA 1EJ0A 2E49A 1NUAA 2OK7A 2YWJA 2HQRA 2ZSJA 3G5UA 3P2KA 3QYAA 1JMYA 2YHUA 4MRSA 2OL4A 2X0IA 3CUSA 5BT9A 4YJDA 3WRYC 2YXBA 4MI9A 1JAYA 3HYCA 3JY6A 4L4SA 4CI0B 4PY2A 2VHJA 5JD5A 3OCCA 1OH7A 3TQSA 3TMAA 5CNIA 1L3BA 1K7FB 3E1GA 4I99A 4M3NA 3AU9A 3HB7A 2O3TA 2GUGA 3T9BA 1CR6A 2CLIB 1OA1A 3GHYA 4G0MA 1TYEB 3TBFA 1MV5A 5EPUA 1CUUA 2FWNA 4GT1A 4XUGB 3G0OA 4EQ6A 5AK5A 3ICQB 4MS1A 4ND5A 4QUIA 1TQ8A 3EVDA 1TJ3A 2OHXA 4K03A 4K0RA 4WFIA 4WKOA 5EKSA 3ORSA 2F3QA 1R0BA 3TSCA 1J23A 2OO5A 2KW5A 4DLPA 4MW1A 2YC2C 1KYVA 3PGKA 1NVAA 2BMFA 4AUMA 3KZXA 1R0RE 2HWKA 2Y1FA 3LAWA 5K3OA 2NWQA 1FRNA 4G07A 4F1WA 4L0CA 4LYAA 8GPBA 1OV6A 4YRQA 5EWMB 4U3JA 3WJ1A 4L76A 5E7QA 1CW2B 2ZBFA 2F4NA 1JQJC 3C97A 4FKBA 4L22A 1P5HA 3GLIB 1T6XA 1W5SA 2ONJA 1E9BA 1P9RA 4RK0A 1BNCA 4XGQA 2IHYA 5K8UA 4M0UA 3CPSA 3WGUA 4EP1A 4MYHA 5CIWA 2AX4A 4LXTA 4RTNA 1I1HA 3KJEA 1H2FA 3GA7A 3ZPXA 3DFIA 4KXFB 4FILA 5L7YA 3H0EA 1PS0A 2CUNA 1QB8A 3A6JA 1Q15A 2HBZA 3TR0A 2CFSA 2AW3A 1Y98A 5HF6A 1HDXA 4O2RA 1S8OA 1EXWA 4TWIA 1JWBB 5FXMA 1RPNA 3V1LA 1R5BA 3I92A 2BDUA 5IWCA 2D3WA 4HXGA 2OFOA 3OM9A 9GPBA 3BFKA 4QXQA 5L6LB 3BXZA 3GEIA 4I4IA 1KGDA 1EHIA 3W3AA 5CT5A 4S1NA 3JQAB 3QE4A 4IIJF 3DG9A 1CR4A 2NVUB 3VPSA 1UPTA 3BMNB 3GLIE 1H2EA 2QX7A 4M9CA 2H1SA 3GFPA 3SZMA 4XB1A 1UMBA 5GIPE 4ASUD 4RK6A 4LRTB 4EVQA 5HYVA 2A9VA 2H4HA 4CE6A 3DLBA 4J6EA 4DBVO 1A1SA 1L1RA 2CFIA 2BMAA 2FWBA 1HE8B 1MOZA 2G5GX 2WKSA 2XTMA 2YBDA 3O9VA 1DDGA 4Z1MA 3L0CA 3WLTA 2FMHA 3LA8A 5AI4A 5DXAA 4S2UA 1YA4A 4JI0B 1FVXA 1CHDA 3O4JA 4G4IA 4M0LA 4ZOCA 4GH5A 1T3LA 1E1QA 3PNMA 2AOVA 4TKMA 4BUJA 2GDZA 5CG2A 3NVKI 4UUOA 4UCQA 4EYEA 1IXZA 4P7FA 3WB9A 3DA8A 3VYUB 3NAZA 4HVAA 4B6OA 2BH2A 2IEZA 2JFPA 2P6NA 1WUTA 3HB5X 1EE9A 1DJNA 1EFKA 1U2GA 2DULA 5CLIA 5B1HA 4GZ6A 2CL7X 1L0BA 4NYMR 4Y9UA 5B7NA 2RGNC 1KI8A 2ZPUA 3MSXA 3HEBA 2YV1A 3GP5A 3NI2A 3HCOA 5GPBA 4Z2YA 2C1EA 2JGAA 4MPJA 4NBTA 2IU3A 4CMJA 5IH7A 2A9OA 2ZRCA 1DGQA 4YV7A 4RWZA 2VPPA 4O5AA 1IK6A 2VTBB 1CJCA 1VHTA 1ZL2A 3C0KA 4HAXA 5BRNA 4YYZA 1ZQ9A 5HKOA 2GX6A 3FLEA 5GM1A 4NSNA 4HS4A 3UV7A 1G5PA 3R76A 4PS1A 4RETA 3SJAA 4EZEA 2XY4A 4R9VA 3NC1C 1ZIXA 5IAJA 5EGNA 3WLEA 2P2GA 2XJ4A 2F62A 3N2KB 4L4ZA 4IV0A 1NJGA 2P2YA 1OZ0A 2V58A 4ZHSA 4HNTA 2XMDA 2JDIA 3ZDFA 2QSJA 2RHWA 3C1UA 3OJOA 3OZAA 3EDRA 3PDJA 4ZGGA 1GR0A 1KP2A 1IY9A 4WXYB 3TJMA 4X8MA 2AJ8A 3K0HA 4UBMA 2B8JA 4GX1A 5CFNA 3RC3A 1OX4A 2I4MA 5DBIA 1C9EA 1SQGA 1OC2A 3HQ4O 4JLDA 4X90A 5JVDF 3V1YA 5JXIA 5M04A 3DGEC 4J0IA 1JG1A 2FMIA 3PEVA 2O4CA 1FMFA 4V0NA 5E9AA 4DV6B 3L02A 3TQHA 2YMPA 2FR8C 1GT6A 2BKXA 3KTDA 1PR5A 3G82C 1P2GA 4RZUA 4WACA 2ZQZA 1AS2A 5C32A 5DM70 1YFZA 3GFTA 2UAGA 1O77A 3F3SA 4U8HA 2W4QA 1YL7A 1H0SA 3FR8A 3IAUA 4H1TA 4J1TC 3DBHB 4DWJA 5KVAA 3ZQ6A 1T3HA 1GUAA 3UVEA 3HLKA 3EC7A 3TIXB 3SQXA 1EFVA 4BKQA 3OT1A 5BR8B 4LHVA 1XHEA 1AIPA 4TLCA 3U49A 4BMVA 4HY3A 4Q3LA 1LUAA 3PUWA 4HKTA 1B00A 1LBSA 2FI1A 4QYIA 3R5JA 4R84A 4DM4A 4F38A 3H19A 4UAUA 4QGFA 3UXEA 1D09A 3B6EA 3M4YA 4WXEA 4LOLA 2IHNA 1XAJA 4PLCA 4TLAA 5A7FA 3HBAA 2P9CA 1R1DA 3S4YA 2QL5A 3FYDA 4HQRA 3DTTA 4YT5A 2H1WA 1K08A 2OSVA 1PG0A 1DIGA 4N0MA 2VNSA 3D9QX 4UDXX 5EJ9A 2ZBRA 5IHPA 2P62A 3GEDA 1ZWLA 4ZREA 1G5QA 2BEUA 2D2VA 4EO7A 4RABA 5JZ9A 3H2ZA 1WKVA 3NHPA 4QUBA 4ROSA 3S27A 3SKYA 2VHYA 1WHTA 4U2FA 1EE2A 4I1VA 1MU0A 2AV6A 3OLWA 3L0BA 1K3UB 1USGA 2BT4A 2XGGA 3QW4B 4OATA 3ADKA 5E4JA 5EP2A 4BMPB 3T35A 1XLTC 1RAFA 3D6FA 1PYOA 3UKDA 4ICIA 1CD5A 2XEDA 2QT1A 4IWNA 4MX8A 5IJWA 1IBRA 1NZJA 2GBGA 3F1LA 4P4NA 4YJHB 2XLCA 3A6ZA 4A5OA 4LV8B 2A0YA 2JGJA 2X6TA 3RVLA 3RM3A 3I23A 1WBDA 3FBWA 3LWZA 1GQQA 3DNFA 2X1HA 3F3MA 3LQ4A 3EEYA 4J0QA 2OHGA 3LJKA 3I2KA 1NLZA 2O52A 3WKCA 4URHA 2FPUA 4YAGA 1Z0AA 2GLUA 3H9BA 2Q5JA 4N40A 4BKMA 5LKRA 5DULA 4L4RA 3CEMA 2FMKA 3NKLA 3LXMA 4RDXA 5BMVF 2O2ZA 2ZI9A 2QRHA 1OMOA 1Q77A 2GAIA 2UZ0A 3AF5A 1L5OA 1QHXA 3DUWA 2LDBA 3KAJA 2QMYA 3NHLA 5DGIA 5A5VA 2A9RA 2PO5A 1ZJJA 2J85A 4YCJA 3WO1A 1NQTA 2AI2A 2IVZA 2XBMA 3LY5A 3AVQA 3CW2A 3M1AA 1GQOA 3AWIA 4QOFA 4UVHA 1P44A 4DKXA 4YQFA 5DM4A 1MZVA 4FGKA 5LMNB 1W47A 3RLIA 4QDKA 1RZVA 4RMIA 1VCNA 5KHAA 4DANA 2Q2VA 4FHCA 3ZWCA 4QJ3A 2GNOA 5L3SA 4QYIB 2NU6A 2W2LA 3FGZA 4MUBA 1G20B 1XZQA 3L7MA 1MA3A 1RI2A 2X2FA 1P4SA 1P6XA 5E6SB 4CMEA 3O26A 4EPWA 2CLCX 3T1VA 3MXTA 1RVDA 2R00C 3HN2A 4XGRA 2XWSA 2EHJA 4DLVA 4JR1A 1NV8A 4HQ6A 2HCRA 2QTGA 1S01A 1K68A 4O4LB 3O8NA 1COWD 1E1QD 4Q9IA 4EA7A 4Y6OA 5A4FS 4FVTA 1F48A 3C3MA 2JJ2D 4HDSB 4ERNA 3B1VA 4FR2A 1H4TA 4KQJA 2CJXA 1KEZA 3BK7A 5HGXA 1PUJA 3NORA 2YWDA 1QHNA 2PIAA 4DPKA 2QUKA 2EKPA 3KEOA 1KYYA 3G8YA 2HHCA 4RV9A 5G1PA 3Q8MA 1QIEA 3VYTB 4MCJA 4BGIA 3AETA 3KLBA 3D5TA 2CNLA 3IO3A 2WIGA 3Q7EA 4JSYA 1SOAA 2WTEA 3KEGA 3WV5A 1TM2A 3BTUA 4KAAA 4ZQGA 4DLYA 4UHFA 4HRYA 4B3DA 1S7GA 4MEAA 3VR5A 1ZOIA 3VU9A 3O03A 3W5SA 3AEQA 1W36C 4DYDA 4K40A 3Q9LA 2J5QA 3FMOB 4AIIA 1D7AA 2HRCA 2NUPA 5ES4B 2RARA 3QJ5A 3DR5A 3HH8A 2PRJA 5JCJD 2FW1A 1X94A 1B73A 3EWSA 4HDRB 3OF2A 1PLKA 3FIUA 2XODA 4AO7A 3ZU2A 2B3TA 3ASUA 3KETA 2JIBA 2QU7A 2EJCA 1E6MA 3EJ6A 3ILXA 1YRYE 5A3SA 3STHA 1W73A 2QRPA 1YBMA 2WJJA 4TXMA 4R71A 1PNTA 4ND8B 3HWSA 2FK8A 1G2OA 4FCVA 4OQMA 3D6AA 3H8JA 3UB2A 1IQUA 5JATA 1O6GA 4U3JB 3BH6A 4RTPA 2BBWA 3KRTA 3SICE 3BERA 4A6DA 5HM8A 1CQPA 2W6OA 1LY1A 1W5BA 3D81A 4LYGA 2ORIA 2XMZA 3A3PA 4R2LA 2QTMA 4OQPA 2BZGA 2BZ0A 2OSBA 3U56A 3A9RA 2OCPA 1V4BA 4JLBA 1K9SA 2XKAA 4RJ2A 5K3FB 3NBAA 4D4LA 4AN0A 3P45A 1J70A 4POOA 5J4VA 3IP9A 2GKOA 5E1DA 5J3JA 2AMFA 4LF6B 2PS9A 1G8KA 3F1KA 1JQLB 2AR0A 3E61A 1U28C 2WILA 1C0KA 1EI9A 1Z8NA 2W2LD 1TZMA 4W6QA 2RG7A 4RH0A 2CB9A 2HQBA 4B43A 2C7RA 4ZEVA 3KHSA 2WWYA 1UBSB 3EVBA 3HBFA 2HIMA 2ERCA 2ICAA 3WXBA 3DO5A 4KACA 4A10A 3ZHQA 3ZTWA 5BVGA 5JYCA 3FDXA 2NXJA 1TMKA 3K2EA 1DSSG 4WBXC 4CIAA 1KJ8A 3VAZA 2CV2A 1IXRC 2FPGB 4EO9A 1YFJA 5A0VA 1ZKMA 1EDZA 1ONSA 2Q2WA 5F3RA 3LC7O 4QOJA 3D0KA 3AI1A 2OCLA 1XDSA 1SVIA 3S68A 1LX7A 4DCNA 1N8TA 1PTJA 1WZUA 1D03A 3F67A 5A5GA 4IGIA 1GAQA 1KEWA 3ETGA 1Q2UA 1ZINA 2O2EA 2Y1EA 1HQYE 3A9CA 3PHGA 4IMIB 4B73A 2G3YA 2XW6A 1E3SA 3H87A 3JWPA 1OCEA 3CE6A 1BKYA 4OXIA 1TA9A 1K5HA 3RQSA 1EX6A 3JYQA 2JIZA 1M7HA 1T6NA 1ND5A 4J9UE 5TQVA 2WLSA 3T7TA 1YVDA 3D3KA 3I62A 5FBQB 4AZ3B 3AYXB 5LYJA 4TV8B 2ZI4A 5THKA 2DHDA 3C3EA 3DZGA 2Y0CA 3GROA 3QJGA 4D45A 3A3YA 5MDHA 3OCVA 4JLPA 3ZDQA 4W6ZA 4CM5A 4FFBB 2AG0A 3QVGA 5AUNB 4IQ0A 4ZZ1A 1CNMA 4H4CA 1NXPA 1ZSNA 2OYCA 4ILEA 1JHQA 2XVYA 1QGUA 2BI8A 2UYOA 4OFXA 4GGMX 2DF8A 1R6DA 2Q6KA 5ADVA 1HDOA 1NF2A 4P5DA 2QVXX 1MQAA 1WXXA 3UKJA 4O4JB 5HKLA 3QMWA 1XA4A 4QQ8A 1OY1A 4WKGA 3PIIA 2X0KA 3QX7A 1J24A 1FYWA 3GG2A 1NT2A 5AKJA 1Z6ZA 221PA 1QO9A 2Z0MA 5CGZA 2C0PA 3BHJA 4RAQA 2I1WA 3EGOA 5KQRA 5CCBA 2QBYB 3AJAA 1JA0A 4UEQA 4Q02A 1DC3A 2DJIA 4X1YA 3ZYCA 2AHOA 4BU0A 4B48A 3FNBA 1T2VA 4E3WA 4JZYA 3CWQA 1I6WA 3VC1A 4HDNB 2FUNB 4KR2A 3UPUA 1JLLA 3TLGA 3TGPA 1KH3A 1U7TA 5IAAA 4FQ8A 3BSSA 3KVRA 3OE5A 1BDHA 3Q0EA 2FUEA 4FSXA 3QVLA 5EE3A 1TLTA 3KKNA 2HBYA 2VHQA 1DMSA 1LB1B 2GZ1A 2IXTA 3P4UA 4P3PA 1BGXT 4TKLA 1WG8A 5K6TA 4E03A 5KWEA 4ZVMA 4LF7B 5D1NA 1L7QA 2VNIA 1FMCA 2IBTA 1QSGA 3AUTA 1KO8A 3RKUA 1M3SA 1UKZA 1WL8A 2C92A 1A2QA 1BMTA 2C2ZA 3O74A 3QI2A 5AXBA 4BN4A 2HZ7A 5CCDA 4BP1A 4D5GA 5K0FA 1GZ4A 5C1PA 1E2NA 5IS2A 2X7HA 2OG1A 1K6MA 3QUSA 3AR5A 2NT4A 3B38A 1AUQA 1KAHA 3KP1A 4IWYA 5DGCA 4CQMA 4EYGA 3FF1A 1C7JA 1ILWA 1JAHA 4GDMA 2G17A 4FBMA 4D7AA 2Q28A 4P5EA 1Y7LA 4RTRA 3GLVA 1GPUA 3DDCA 4C5BA 3R0VA 1PL6A 2VYVA 4B3BA 5JI2E 2J8ZA 3KSAC 3DWGA 1T8PA 2D74A 1KE2A 4YT4A 1Y48E 5AVRA 3CX8A 4JODA 4URVR 4Y1GA 1NJ8A 1O5OA 5H3HA 1JT2A 2DT8A 4K81B 4XIIA 4DIOA 1NBEA 2JEZA 3HSKA 4F4UA 4II3A 1MD9A 2GTHA 2ZWPA 5AUQA 5FQNA 3SS7X 4BS9A 1QR6A 1W2HA 1XU7A 5K4AA 3R24A 1M2WA 1YOBA 2R85A 3A8TA 1MDBA 3P0FA 3QE2A 3UH1A 3K0CC 2Q5IA 1ZK4A 2Z58A 3QMVA 3QEOA 1DC4A 4GG1A 2A9FA 1MOSA 2ZJ6A 3KJHA 3HLYA 3SSMA 1AUXA 1XELA 2V7UA 3GJXC 5BNIA 1IHDA 4MRMA 1T9DA 2AFRA 3C6XA 3NBQA 1J2YA 4QTTB 3H1PA 1P3DA 3CTMA 4HEQA 1CUXA 5HKBA 2JZOA 2R1TA 3MT7A 1C14A 3JD0A 4J49A 1HDGO 4QQKA 4KR9A 1KEEA 3NTLA 3FOZA 5CMLA 5A06A 3TVDA 5ILQA 3CW9A 1XBTA 2C99A 2GRAA 3BGIA 3L7YA 3PRJA 4GQAA 1E1KA 2HUPA 2IYVA 1QORA 1TQDA 1YZQA 2IC5A 2ZSHA 2ZW9A 3E53A 3GOHA 3OE7A 1PD0A 1YR1A 2E4WA 3V4PB 5C8DA 3ZUGA 5JVDA 1GPJA 3BFXA 3RKSA 1DQSA 3B60A 1QVZA 2GEBA 4IFTA 5HEKA 4H15A 1YO6A 4M36A 2UVDA 4G8BA 5G0UA 3WRVA 2QJOA 2H51A 2QRGA 3CSDA 1JDUA 2I54A 1QYXA 1X3LA 4MYTA 3OO0A 4UUPA 1CR0A 2FN3A 4NCXA 1DRWA 1GY8A 3D8HA 3ENKA 1T4DA 1THZA 1G8HA 2FZWA 4KGXA 3H2KA 3MD0A 4GOXA 3H8VA 3LRXA 4MP6A 2PSDA 4HLUC 4O59O 1V4VA 2JFXA 5EUBA 1U7OA 1N5DA 2VPIA 2IWHA 2HA2A 2FU5C 4LBZA 5ED0A 5JANA 5K0JA 1MABB 2F17A 2RIPA 4NZZA 2PYDA 1YTLA 3K4PA 4A9AA 3GFRA 2Z57A 1NGSA 1ZGHA 3O1JC 4HWPA 4N7MA 1JKIA 3KYIB 1Z2PX 3Q3JB 3GEGA 1W87A 3RUHA 1KDPA 1YBAA 3A3NA 1Y6QA 3KNZA 1R66A 3A4TA 5DVZA 4F8YA 3PJEA 5IP5A 3HMQA 3PT9A 1ETUA 2EW1A 5AMXA 3HN7A 3RHSA 3MIIA 1XZPA 3HBMA 4IUBS 4H7IA 2ZRBA 5HGJA 3R8XA 1PI3A 1SA0B 2PX5A 3JQEA 1FXWF 3RJZA 2IUFA 4D81A 4ZK6A 3I5AA 3N9IA 2HL6A 4PG5A 3LVQE 4J0HA 4AZ3A 1X74A 4HYEA 1V7QA 4AY4A 3DMHA 4QDXA 4CL0A 1K98A 2EQAA 4I19A 1P1JA 5CB4B 3DLAA 4B3SB 5EMNA 4DZZA 5AVWA 1FFGA 1HQDA 3AI2A 1VPWA 1V37A 3AJRA 3DTVB 5KKAA 3RU3A 1Y6RA 3NKVA 4IDBA 1H5QA 2FKNA 3LUFA 1H0HA 2AN5A 5AI6A 2R60A 4MW9A 3PE6A 2IYNA 1KDVA 1BHO1 3RFCA 5IJ0A 5ITWA 1KR2A 2ECKA 4F91B 4C04A 4YDHB 1HNNA 3H4MA 1Y6JA 4QG3A 2UYHA 4CU2A 2A5DA 2PGJA 2L18A 3OE1A 3Q7IA 4XSHA 3Q72A 1GNLA 4O08A 3UOGA 5DTQA 4NARA 4XI9A 1XNRB 1ACLA 1X7XA 3UMJA 3VKUA 5AQEA 4LE2A 1W36B 1HNZB 1XZCA 3NHMA 1DEAA 4L95C 3DWFA 5IN4A 5JAIA 3ANYB 3QI7A 2KBEA 1T8TA 1AKWA 5EP4A 4DS3A 4XGNA 2X7XA 1JKMA 3HCFA 2Y1XA 5H4HA 3NUQA 3EC1A 2CUKA 1YBVA 2OG2A 3BWVA 2H4JA 3EY4A 2JW5A 1QGAA 4IJ6A 3W5CA 2Y9PB 4D26A 1G63A 4GXRA 4DIBA 1U8YA 1UWKA 4N3GA 2QPTA 4X95A 3L6OO 3R9WA 1XXHA 3LNCA 1DAGA 1UKAA 4I4TA 4ZKEA 3I5YA 5LL6P 4AX8A 1XKXA 4TZ0A 3REFA 2FSIA 5IK2A 3F8SA 4Q1CA 5IZCA 2YYAA 1HE1C 1D0VA 1KSJA 4FYPA 4JBIA 3DFZA 3SIWA 2HK9A 3T4UA 3T94A 1TW2A 1UC5B 2H9IA 4GRIA 4P2GA 3V7NA 1ZKDA 3ZNPA 5BVHB 3CZ4A 3HHEA 2R7AA 3URMA 3A31A 3FPFA 3LX8A 1Z5ZA 2MYNA 2X23A 1SWVA 4YRBA 1JB9A 1LV8A 2G07A 3PYLA 4O4LF 4DRXA 1Y6GA 2ZIGA 1E1MA 2CNNA 3H65A 2P0EA 621PA 4Y2PA 3U61B 2EATA 1U1GA 2QVLA 4MTCA 2CSXA 4N48A 2PQMA 2JGDB 1QTRA 2GPWA 2PXHA 4DBZA 1HDRA 4E4YA 4CG1A 2JAPA 2VA8A 3PUXA 2WJYA 3GIWA 2E4XA 1DQNA 1SUPA 3C7KA 5DMXA 4DILA 1G17A 4QGSA 1U7UA 3A37A 1H3EA 2VHXA 2ID9A 4K9QA 2WF9A 2ZJAA 5IG2A 2AH5A 2WWHA 3GZ4A 1OAAA 2OOKA 2I6FA 2IPOA 3E1KA 1VIDA 3LXXA 3N39C 4DMHA 4EFKA 3C8ZA 4PZYA 1LDBA 1QVAA 1TXGA 2IGBA 1ORVA 1XVUA 4DWWA 3RKRA 2WNIA 3R5SA 2C59A 4QYWA 2NYVA 4PPGA 1ORDA 4EUKA 5JJIA 2PKEA 4LYDA 3IBYA 4W63A 5AVOA 1G18A 2ZRHA 3SYRA 4Q6BA 4BLQA 2ZANA 1E9EA 1NVDA 3QA3E 3QVJA 4LGVA 2VP4A 3KSRA 2SECE 3BSFA 2ZT8A 3ESRA 4QOSA 4BV8A 2FCRA 5BWCA 3ZE0B 1YR3A 1C3OA 2WFZA 3AVPA 2CNWA 3DOIA 5B64A 2WINI 2QSUA 3L18A 4WOKA 3F9RA 2ZSAA 3PUYA 2H31A 3D2AA 1OWMA 1ZIOA 5EUQB 2AW5A 3VHXB 3WLNA 2CHQA 3FWYA 1SBTA 4CKEA 1CQWA 1TZKA 2QP4A 1G66A 1MV8A 4E6PA 4ZD6A 1S3IA 1OKKA 4N6GA 4R8RA 4UEKA 3VU9B 2HO4A 5AOCA 1SEVA 5IEJA 4K6CA 4O0MA 1FIUA 4RQBA 5DLQC 1PG2A 3IDAA 5I9IA 3Q40A 4TL9A 1VJ1A 1Y4DE 2QU8A 3MMSA 5CA1F 4JHLA 3L6BA 4RLFA 4U2DA 1UF9A 2QYTA 5JZMA 3UJNA 3QUBA 3AX6A 3VO2A 1TM5E 3UMBA 2ENUA 4DNPA 2ZB4A 1JEQB 5JADA 2O48X 3K92A 3LTEA 1FS5A 1GRNA 1YD7A 2RGWA 3B1FA 1OX6A 3IAS1 2C20A 1TCBA 4XYGA 5ALIA 3O8QB 3SFTA 1A3CA 2F59A 1C1DA 1B3RA 1Y1QA 2I6GA 2V6JA 3N6XA 3R7LA 3I2IA 1YRWA 3F90A 4QOIA 3WR5A 1AMUA 1Y1LA 4JJ4A 1F1JA 2ID8A 2VLBA 2XWBF 4OJQA 3VMFA 4G1UC 4QUDA 1KOGA 4RTQA 3LOPA 3PKZA 4NPCA 4DEXA 4LHSA 4D4JA 3LCUA 3N2LA 3MWLA 4ZYWA 1CBUA 1CUZA 1F3LA 3T0IA 4EEKA 4AW9A 3JQBC 1QFYA 2XDWA 1SHZA 1D2AA 1KNXA 2CK3A 4NULA 5TNXA 3SMQA 4AD8A 2M32A 3UMYA 5F1OA 4M6WA 4EG3A 1HE5A 3PGVA 4TXLA 4ZAVA 1KOLA 3DTYA 4ARCA 3DXXA 2WIFA 3DE7X 2I76A 3AV3A 5DOVA 3NRCA 5DM60 3I04M 4I9NA 4Z7JA 4HGOA 4FHDA 2ET6A 4QZVA 1FP6A 3BMOA 4DR3B 1RLMA 2AJGA 4YAEA 4A23A 5ESRA 4U9UA 1YB7A 4IJVA 3U7QB 1DRKA 5A7HA 2JANA 3DJFA 2D7DA 1ESDA 4EKEA 1NT4A 1DQZA 2B9EA 2EKQA 2GYVA 2JGRA 1YJ8A 4MEJA 1ULTA 4OH1A 4UQOA 4WXMA 4R9UC 4AWBA 1OLXB 2QT9A 4R9RA 4XOIA 4P0QB 4J3NA 2WTUA 3F46A 2WYHA 3BPSA 3HRHA 4XB2A 2F8LA 4WZAA 1M2NA 3QWFA 1WPRA 4XYLA 3JX9A 4YI3A 1F4VA 2HO5A 3W7AA 4E3ZA 3RUIA 4D0SA 5H0IA 3TH5A 1QTQA 3ZIUA 4OXRA 2HEGA 1DQYA 1SUAA 4PIVA 5SYMA 3VX4A 4MS3A 3MJSA 4XKJA 5H16A 2I7DA 2DWPA 3H4IA 1QLJA 4FWTA 2E1RA 3GT3A 1ZH4A 2PZ8A 2MMCA 4UAJA 1C9KA 3DGFC 5KSWB 2JFHA 2PGLA 3P0IA 2O1XA 3A25A 1KY3A 4PNPA 4DCTA 2WYOA 1NNEA 1Y8RA 1XMIA 2O2JA 4GPTA 1JF8A 3P9YA 3FXAA 3PZBA 4ZRNA 5EKXA 5MFZA 3G7NA 1DXHA 1M8JA 1JU4A 3G3EA 4WW0A 1HOTA 4BEWA 1RBMA 3ABSB 3ETCA 2PZLA 1IE3A 4JWKA 2R6CA 1GZSA 2RMKA 3SJZA 5JAOA 5D7NA 2YFKA 1NSTA 4WECA 1WXIA 2YVKA 2Q4TA 1YKFA 1UZMA 4RFLA 4RIHA 2XMBA 5FV7A 5FWAA 3WGTA 4DDWA 1X1QA 4AQYB 4BMSA 3O93A 4G0VA 3ABRB 1ESMA 2LVBA 3ZLUA 2QLTA 4EF4A 3DLHA 3AYZB 1EUYA 1P6QA 5JQGB 1A2KC 1GYQA 1NP3A 1TZ2A 2WIJA 1G8FA 2CJFA 2OQVA 4C7JA 3LLSA 4PLGA 3WRWA 4XM0A 2C57A 3DNPA 2ZQYA 2W71A 2OA0A 1TLFA 4RK1A 2IX3A 3FKJA 4QICA 2Q8PA 3AXSA 4YHHB 4A6XA 3JQFC 4MHOA 4ZICA 4MITA 4QXOA 2FN4A 5FYDA 1A8IA 1ZVKA 3JQ9A 3NBFA 2HKIA 3ABZA 4QDUA 1YDEA 4LFCB 2IW3A 2VK4A 1RJDA 2KMLA 2KSQA 1PSWA 3MD9A 3NYQA 4Z4CA 5L53A 4R6WA 4Q1EA 1Y1TA 1VE9A 3JTMA 3ADOA 4R7ZA 4UHEA 1ACMA 1WKAA 3ZOZA 1O96A 3HYSA 4DJEC 2OCYC 3REOA 5B53A 3VNRA 2HJHA 4OV6B 4ESEA 2HSGA 2L82A 2Z2IA 2YV3A 5H83A 3KQWA 4I4LA 4LV5B 2R8XA 3KZKA 3R4CA 1E3EA 4IIXA 3JQAA 4HEA1 2OQ2A 4DJJA 5EWLA 2V45A 4YMLA 3EVTA 2JJMA 4JJFA 5A4AA 2WA2A 3CNEA 1IN1A 4LSMA 1XJQA 4DJ5X 2ZUWA 1RI1A 1FNBA 3B2QA 1XTJA 2MMGA 4DUYB 2FRVA 2JIQA 3AEXA 3T5CA 4DYVA 4E08A 3UV3A 4JT2A 2JHPA 3B6IA 1XXLA 2BFFA 3DFUA 4RGVA 3ZZTA 4DF3A 4LF9B 3D8UA 1AZWA 4A03A 5K3DA 1LU9A 5AOVA 3U44B 3PFHA 3SS9X 2XV1A 2DLCX 1Z4PX 5LP6C 3U19A 4O1MA 1NM5A 1OROA 2PTGA 1NOKA 2ZJFA 4O4HF 1P2UA 3BAFA 1SUDA 2JIZD 2QLMA 1M34A 2K7ZA 4Z0TA 3L4KA 1YHNA 5LBUA 4QIHA 2LCQA 3W4KA 3WGLA 3QBVA 3JPWA 3GRYA 3V8PA 4AQDA 1RWQA 3VPXA 3NETA 4P7JA 1CS4C 3TD6A 1FSPA 1IH8A 1TUBB 2OGTA 4HH4A 3CVVA 4OJNA 3B3AA 4P32A 4A8JA 2FSFA 4FMCB 3D6TB 3UFXA 3FCSB 2E4AA 1XF1A 1PZEA 2IZ6A 3I1YA 1XL0A 3SQLA 4TWAA 4D3DA 2R7NA 4EUFA 4UTRA 2PU5A 3PJGA 4AJOA 3K5IA 1Z15A 2HF7A 1ODKA 4EMSA 2DKFA 2X14A 5EHIA 4A8TA 1P1BA 1UBOS 1WXFA 2QRUA 1NZDA 3I9OA 1N1DA 3FZNA 1J97A 1E89A 4R0VA 1OZAA 1RXVA 4MRVA 5ESWA 4NZOA 4LE0A 3U26A 5EERA 4C0LA 4X44A 4P58A 4O2BB 1KEVA 5HJ2A 2B99A 3ZGNA 1Z7YA 1CUVA 1LGYA 3TL3A 1DB3A 2MDTA 4B4DA 3ESAA 1BKDR 1RRMA 3B13B 1OV4A 5ICEA 2W83A 1NN3A 4CFZA 1N0VC 3RQIA 2D2XA 1FDUA 1N2CE 2QD5A 1IONA 3OPVA 1O87A 5BQPA 2VSFA 3W5HA 2NO9A 4ZAZA 3HN6A 1FUEA 2BFEB 1RXWA 3SG0A 4BX3A 4B79A 1JJBA 2HRRA 4RVDA 2EEZA 2BEWA 2YJGA 1KKMA 1U2ZA 5JJLA 1PKEA 1MABA 2H5LA 1TMOA 2FTKE 5FBZA 1M74A 2IEAA 3LCJA 2CFTA 3UO8B 1SULA 3WK5A 4BO3A 4F9EA 1QH8B 3C7DB 4AWAA 1VJTA 4DCUA 3N2YA 5LUBA 3G2HA 3FTDA 1RKUA 1M2GA 3M81A 3E8XA 3DE1X 3VOBA 3CXRA 1USUA 1LI7A 4DBLC 3CB2A 3O75A 4LHEA 2F1KA 4ZI7F 3NR2A 2P4UA 1G6HA 1PIWA 4B35A 3TRDA 4Q4DA 1BWQA 2GPAA 4GHWA 3TIGA 1DVRA 1QXSA 3IA7A 3I6QA 5I6DA 1W0JA 4IFEA 1FQOA 4XB6B 5DYWA 4M7WA 4GL2A 1NPYA 3ZZ1A 2A0KA 2HREA 1U6KA 2ZIAA 4MV0A 1F6BA 4DY4A 4EPTA 5JYEA 1WDTA 5J5AA 1ST3A 2GEJA 4MQ4A 5LMZA 1E0DA 1NUSA 4MGHA 3D5EA 1U31A 5J58A 3PE4A 2P6MA 2CMKA 2IYUA 4IYRA 5GOTA 1JDZA 1A8PA 4G37A 1T8YA 4HDQB 2J09A 3LK6A 4FWBA 4P4TA 1CZHA 2H2FA 5CJ2A 3RWOA 8LDHA 3ZDCA 4J7CA 3IVXA 1K0UA 4ZCRA 3UHAA 4C05A 3QEMA 1W4LA 5CDHA 2UYQA 4HUQB 3OZVA 2PR7A 5DISB 3RS4A 1QNLA 2JGDA 3NXKA 2Q7XA 2X2EA 4JZKA 2EGUA 1Z2CA 4NS4A 4TYYA 4OHBA 4KMMA 2B83A 2PUDA 3VDMA 4Q9NA 1N3IA 2RD2A 3O4VA 2JBHA 2O3UA 3Q3CA 3U3MA 4EMUA 2QENA 1KRXA 3RFVA 1U4SA 1SC6A 2P68A 3IOBA 3D7SA 1JHXA 4KMOA 4RY8A 2YCLA 5CBKA 1GPDG 2JA2A 1HL7A 4S04A 2XMCA 2WKQA 2P1RA 1BFKA 2UUPA 4N6OA 4FS3A 3M4JA 2WG1A 4YCMA 4C01A 4LDAA 2NTJA 1F2VA 1U2QA 3DMYA 1BC5A 3Q1LA 4RM3A 4YFVA 1DUIA 1Z74A 2H8KA 5CT4A 4Z0NA 5K51A<