1WKBA

Crystal structure of leucyl-trna synthetase from the archaeon pyrococcus horikoshii reveals a novel editing domain orientation
Total Genus 282
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
282
sequence length
807
structure length
791
Chain Sequence
b'LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-tRNA synthetase
publication title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 282
structure length 791
sequence length 807
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 1wkbA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1wkbA01
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wkbA02
3H05A 4MVYA 4EG1A 1U3DA 2BYTA 2E18A 1IQ0A 3IUBA 4P2BA 5AHWA 1KH3A 2D13A 1X8XA 3K9WA 1QTQA 3A05A 5K0TA 5BNZA 1QU2A 2HMAA 1JZQA 4MQ6A 1N2GA 3AFHA 2QJFA 1QNFA 3IOEA 4I6EA 3SEQA 1TEZA 1OWPA 4AQ7A 2JANA 3ISJA 3UOWA 3ZGZA 2O5RA 1OBHA 4MULA 3CLUD 1NZJA 3H9CA 4MWEA 1NUUA 1EFPB 1Q15A 1COZA 3A04A 2D54A 1JZSA 3KFLA 3DPIA 2ZP1A 2PIDA 3PZ5A 2DR2A 4YBRA 3CR8A 1WKAA 4JXXA 4K0RA 4ZCRA 3ZIUA 3RK0A 4CDNA 2DLCX 1NYLA 3IOCA 2J09A 3N2YA 1S4MA 2AJIA 2C5SA 1M83A 1VL2A 4MUFA 1F7VA 4EGAA 3KT8A 1K92A 3RJZA 4Q93A 5LLTA 1NSYA 3ND7A 3TZLA 4CDMA 1WOYA 5AGSA 3X1KA 1GLNA 3PXUA 5LM3A 2QUHA 4YP6A 1Q77A 2QTMA 3FY4A 1WXEA 1WQ3A 3SYTA 2VXOA 3ZJTA 3HGMA 4MW7A 1J70A 1I6LA 1WJGA 4KPUA 3CA8A 4QBTA 4MVXA 3CLRD 1G59A 2J5BA 1FFYA 2A1TR 4HPWA 2OV4A 2YWBA 1TQ8A 2WSIA 4G5YA 4NDAA 1WXIA 4YP5A 3COYA 1M8GA 1O5TA 4KPUB 5K0SA 1QRUA 4CT0A 1XNGA 1NURA 1QQTA 2AZXA 3RBAA 1XNHA 5J58A 1LW7A 5TEVA 4JYZA 4ND6A 1DNPA 3FG9A 1B6TA 1ZH0A 3X1MA 2J08A 4NATA 4A91A 4BWVA 5IHXA 4EG5A 1PFUA 1XJQA 1QRSA 5LFAA 4MUHA 5TGTA 3SZGA 1T6ZA 2Z3VA 2DEUA 3UC5A 2A1TS 1VBKA 4FZJA 4KR6A 4XFJA 1YUNA 1KQOA 3RFFA 4HJXA 2RD2A 2DERA 3MLAA 1WXGA 3P52A 4MAFA 2XRYA 1PG0A 4CQNA 2WQ7A 3CVYA 1WXFA 4MUEA 2PFSA 4MUIA 4DDHA 1OWOA 1KH2A 1KR2A 2YXNA 1O6BA 4G6ZA 2DUMA 3K32A 5DEOA 2WQ6A 3G5AA 3AIIA 1LI7A 1MJHA 3FOCA 3TQOA 1OWLA 4ZT4A 3IUEA 4ND7A 4NZPA 4H3SA 4QRDA 3P0HA 5DASA 5TEWA 5HG0A 1JGTA 2QJOA 4KKVA 2CYBA 1WXHA 3OTWA 1TYCA 1XNJA 2PZAA 1NUPA 5AGRA 4OJMX 4MW4A 1T6YA 1EFPA 1TYBE 1R6UA 3ELBA 1FYDA 1I6KA 3ND6A 1GTRA 4MLPA 3HL4A 2BTEA 4ZT6A 2PXHA 3VRHA 4MUJA 4ZT2A 1WY5A 1J09A 1G8GA 4L2IA 1NI5A 4ZT7A 1K4MA 4MW5A 4AS1A 2PG3A 4XFDA 2QUKA 3CLSD 4MUNA 1YIDA 1UFVA 3IDFA 3HZRA 1MAUA 2TS1A 3QE4A 3DO8A 3F3MA 3IVGA 3G6KA 4ZT5A 1PFVA 2JAXA 3ZXSA 1M8FA 2GOYA 1RQGA 3ILVA 1IQRA 4L2IB 5AGTA 4MW9A 1O95C 2XRZA 2D5BA 3IMEA 1UE0A 3CLTD 1QRTA 3SEZA 4TS1A 1ZJWA 2NZ2A 4EFKA 1X6VA 2A86A 1J20A 4E1AA 3O0AA 4WSOA 3FDXA 3AL0C 4WNYA 1WNZA 3MMXA 1O96A 1N77A 4EG4A 1JIKA 2B7LA 3CLUC 4JXZA 5KCMA 1NP7A 3ZJUA 1LI5A 3GLVA 3AG5A 2ZUFA 1GAXA 4I6GA 4K48A 3FIUA 1TFUA 1ULHA 4JFAA 1O97D 4ARIA 1O96B 2WFDA 1CT9A 1KQPA 1GZUA 3P0JA 1T9GR 1F7UA 4NAHA 2GKSA 3P0IA 1GN8A 1WK9A 4GU5A 1K4KA 3H99A 1O94D 4ZCTA 4K47A 4RPIA 2EL7A 1JMVA 2A7XA 2PZBA 3FHJA 3FNRA 3COVA 1KP2A 1A8HA 1WKBA 3KT6A 5KHAA 4DDKA 4MUGA 4U63A 4OUDA 3RHSA 2J4DA 4K03A 1ZH6A 3ZJVA 3CLRC 4ZT3A 3VU8A 3AKZA 1U0BB 3QTBA 4RUKA 2CV0A 1ZUNA 4DDMA 1JILA 3RK1A 2X1MA 2QUIA 3KT3A 3D6UA 1T9GS 4NX2A 1EUYA 2R5WA 4OUDB 3I05A 4YMIA 4DLPA 3ZUGA 1QU3A 3CVWA 3TS1A 3FWKA 4DJAA 4PY2A 1N2OA 3M5WA 1HYBA 3IMGA 4KR9A 2H29A 2X1LA 1JEDA 2NSYA 3COZA 2IELA 4MWBA 1KH1A 3FI0A 1M8PA 4MW1A 4MWDA 3N05A 1TYAE 1O0CA 1N2HA 1IQUA 1IFXA 3MXTA 3E27A 3TQIA 4MW0A 5HUHA 1KKUA 1Q11A 2Z09A 2V0GA 4EG6A 3Q4GA 3CVVA 4S1OA 1F9AA 3INNA 2HGZA 1SURA 1ILEA 2E89A 3NBKA 1R6XA 1GPMA 1N2IA 5H7XA 3HMQA 2WFGA 1H3EA 3X1JA 1U3CA 3FH0A 5J59A 3PNBA 4EG8A 1H3NA 2CUZA 1VBNA 2JA2A 4MVWA 2X0KA 1IHOA 3GUZA 1OBCA 3VGJA 4PBRA 1V8FA 1EJ2A 2OQ2A 1WK8A 2A4MA 1MC1A 1JHDA 3LCJA 1M1ZA 5JBNA 2DXIA 4R2LA 5DK4A 1PFWA 1MAWA 2AG6A 5FO0A 2PZ8A 2H2AA 1BS2A 1PFYA 1MRZA 3OP1A 4I6JA 1JEEA 4G5FA 1N3LA 2I1LA 3A4IA 1KQNA 1IVSA 4PBSA 4JZYA 3Q12A 4J76A 2G36A 4ZCSA 2AKEA 1G8HA 1EFVA 1TYDE 1YIAA 1K97A 1N2EA 1N2BA 1N78A 4U8HA 3MUEA 3N9IA 1D2RA 3PRHA 1NUSA 1N1DA 1KORA 3AG6A 5HUJA 4MW2A 4R2MA 1VLHA 1MB9A 3LOQA 5IJXA 4HJRA 5AGJA 5FO1A 1QJCA 1EFVB 1JECA 1EXDA 1G8FA 5EKDA 4ZCQA 5FNZA 3IVCA 1I2DA 2CFOA 3CLSC 3SZ3A 2EJCA 3CVXA 4ZCPA 1M8JA 2A88A 2YWCA 3L93A 4MWCA 2WB2A 4EG3A 4EG7A 2X3FA 4X0EA 3L92A 4XSVA 1H1TA 2A1UA 2E21A 2QJTA 1J1UA 2IP1A 2CYAA 4UZFA 3Q10A 3IOBA 4EF6A 3A2KA 5F23A 1J21A 2VTBA 3CLTC 3PZ6A 1WQ4A 1I6MA 1OD6A 2YY5A 3QTTA 4MUKA 1IRXA 3G59A 3TZEA 5AGHA 1KP3A 3H9BA 4ARCA 2QTNA 4DNXA 3MLBA 4KR7A 2DPLA 2A1UB 3FETA 1J1ZA 3DV2A 1KAMA 4DE5A 1NUTA 1N75A 2GM3A 1O0BA 3NV7A 1OWNA 1Y42X 1JIIA 1YULA 4MW6A 4YP7A 3SP1A 1PG2A 3UMVA 3IH5A 2VTBB 1IH8A 1EUQA 1R6TA 5TS2A 5H16A 1GTSA 2ZUEA 2CYCA 3PNYA 1M8KA 4HK4A 2AJGA 3COWA 1P7PA 1VBMA 5AGIA 1O97C 2O8VA 3C8ZA 1H3FA 3S3TA 2CV2A 3N8HA 3IMCA 1U7DA 2Z08A 1F4LA 2CT8A 1MOPA 3BL5A 2CV1A 2J07A 4F4HA 2V0CA 1V47A 4U7JA 4GRIA 3CVUA 1UDZA 1WNYA 3H97A 1MB2A 1O94C 1U7XA 1N2JA 3IODA 4Q16A 2QTRA 3DLAA 2RE8A 2AJHA 2DETA 3IVXA 1WZ2A 3U1VA 1NUQA 1Q19A 3GMIA 5J5AA 2CSXA 4QREA 2E0IA 1MBZA 3SDBA 3NBAA 2HZ7A 1OWMA 4R0NA 1YI8A 3HFJA 4PBTA 3HV0A 3D6VA 1KAQA 5KWVA 1YUMA 1JIJA 5DB4A 1EE1A 3TNJA 3UY4A 1T6XA 3LE8A 3UK2A 3PZ0A 2QUJA 4MVCA 4UZEA 3ND5A 4NAUA 3ZXIA 4J75A 2IJGX 3KT0A 4F3RA 3PNVA 2WFEA 3JXEA 2A84A 1O95D
chains in the Genus database with same CATH superfamily
1BW9A 1V1JA 3LW7A 4FGWA 1U1IA 2W83A 5BT9A 3GUHA 3PJGA 1RJ9A 1ZONA 2C2XA 3IUBA 4RY9A 1IBCA 4BMCA 1EM8B 4A7PA 1QTQA 3KXLA 3PUKA 3OJLA 2A14A 2QLJA 3UG6A 3MSCA 2IZ0A 2OC4A 2AA3A 2OUKA 2PLRA 1IATA 5HDBB 3HACA 2OFWA 2CZCA 1KI7A 3TDKA 3SZLA 4JOSA 3A06A 3JR7A 3UOWA 1QV9A 2ZJAA 3K5PA 4YALA 4AJIA 1CE8B 2YVKA 4FCTA 1T2NA 2QRMA 3HCAA 3CF4A 4L4ZA 5IS2A 4GR9A 1O95A 5LYYA 5B7PA 2B8NA 4GI5A 4GECA 3UATA 4EX6A 5J47A 2PA0A 5EINA 1KZ7B 3UWKA 3BIXA 3FHOA 5GZ6A 4BMSA 4YGYA 3ST7A 5EIWA 5AVZA 3OETA 3LPNA 2ZIAA 1EGQA 3FLEA 5BUZA 2WTUA 4B3JA 2HHCA 3ZY5A 1RADA 3MEQA 4IGAA 1N6KA 3N1UA 4FILA 3T5CA 2AJIA 4L78A 3THWB 1GJRA 1NRIA 1VL2A 4YMWA 3GRCA 5BSGA 5LA6F 3T5TA 2ZYGA 1V4NA 5LZ5A 1C3XA 1V48A 2FUG6 4BQIA 1EWVA 4ESHA 1Z18A 4LWQA 1MB3A 1N2ZA 4JA0A 1XYYA 4XH9B 3M3DA 2UUAB 3TTYA 3LBAA 3WP1B 1SFRA 5CX1B 1TTTA 2OVFA 3EIFA 3K9BA 4FD2A 1BMQA 5ECDA 3NWPA 5J9FA 2JRCA 2B9EA 1SN7A 3WQQA 2A0FA 1F2VA 5KTKA 1BN7A 3V4RA 1EK2A 3FLBA 1SVLA 2PCLA 5FWNA 3LC0A 2PGDA 2QHXA 2H48A 3GFTA 1K7FB 5HGXA 1VI5A 1R4ZA 3FE2A 3K5HA 3UWDA 2D1RA 4M87A 4D98A 4WBNB 1CFZA 2PYZA 1U3UA 1ZG3A 3QVVA 4WFJA 3ZG6A 1A8QA 2CNNA 1AA6A 3ZS8A 1N4DA 1NRJB 2WB4A 4BUJA 1A88A 3P2MA 4CMBA 1P2FA 1ZK1A 4GGPA 2I7DA 1WP4A 3TW6A 3U4MA 3C3MA 5AM2A 3V4LA 4BXOA 3K0FA 1A69A 3L0OA 2Z8YM 4OQFA 5DRYA 4L4YA 3L6DA 1L4HA 2B8EA 2OLEA 3B9RA 1UZAA 1X1TA 3PGXA 1WXIA 1Z74A 1PSWA 4K9LA 4Y2XA 1V8ZA 2QL9A 3RFVA 3ZX5A 5A4AA 1NIPA 2KWIA 1QR2A 3BHNA 3D8UA 4FLMA 5D87A 5EP4A 3IHLA 1UBSB 3IV7A 3NX4A 3DMTC 2PRSA 5IZCC 1OZ0A 3UUFA 5C32A 1ZNZA 3WB0A 3ZW8A 2FH5B 1NLMA 1TT5A 3EH1A 3Q2KA 3RUHA 1IHYA 3DL7A 4JJ6A 3PQCA 3PPYA 1OREA 1JPJA 2L17A 3MMNA 4PC1A 4UNRA 2EJWA 3N2IA 4Q1FA 4BNDA 1TZCA 4JI6B 2V1XA 3HDQA 4YJFB 1ID1A 1JQLB 1A1SA 3LT0A 4C9BA 4D57A 2P2CA 3I04A 3TLJA 1IZ0A 1N92A 4CLRB 3U4QB 4DB2A 4IHKA 3LHIA 1GG8A 4OGGA 5JS7A 6Q21A 4Y8VA 4NATA 5LA6A 4L0DA 1RP1A 2JJ2D 3FPJA 2DFTA 4LV5B 4BNHA 1VB3A 2CXPA 2Z3VA 3DHEA 4NJEA 4XCVA 4M8KA 4Q02A 2OBFA 2AN5A 1Q92A 3GRZA 5L7TA 1EJBA 1OCEA 3N8IA 1CY1A 4XLZA 2O57A 3QY9A 4ZARA 3WKCA 3MQ4A 4TT3D 4JUIA 4OBEA 5I9SA 1H0RA 3DKIA 4LHZA 2DHDA 2AFRA 2QX6A 3WIOA 1PSDA 3EGDA 5CEFA 3O26A 5DP2A 1FJHA 3BK1A 3FMOB 3ORSA 2W2KB 1BROA 3WYNA 1PZMA 2ZDGA 5UKDA 4YCMA 4CQNA 2C4WA 3BA6A 3WGYA 3P9XA 4R54A 3TVTA 3ZU4A 3GDFA 1WXFA 3AR9A 4BVFA 5CXUA 5CDGA 4KXMA 3OQMA 1D4FA 2ISSD 1RWBA 3PKIA 3DDOA 1RFLA 3HB0A 1Z36A 1J24A 3EVAA 4LRXA 5BVHA 1GG2A 2XT9A 5C37A 1SZDA 3B6EA 3B3QA 2AOUA 1EWRA 1R4NB 2AKYA 4HC4A 3D7NA 4CN9A 2YJ3A 2QXTA 4AZWA 2JLYA 4NABA 2W71A 2ZSIA 3T5PA 3ZDBA 1RJGA 2Z43A 3O90A 1VDMA 3G0DA 1NX9A 3CUVA 5GZ1A 4Q3CA 3UA3A 4FWTA 4DHWA 4BTLA 1E6MA 3DCYA 2PZAA 3BWDD 3BMQA 2E3JA 3I72A 3NWJA 3C5CA 1ZGGA 4Y2HA 5EZQA 4DLXA 1QIEA 2X76A 2X3UA 3QGMA 4ZAVA 2W4QA 1CJTC 4HTFB 3EXEA 2GFIA 3W78A 5IX8A 2HF8A 3I34X 2YVAA 3SBDA 1QP0A 4LTMA 3PXEA 4PCAA 4QU0A 4RD0A 1GTRA 4ND3A 3TIVA 4DTIA 4WNAB 2JDIA 3PNKA 5DYIA 4E2FA 4Z7OB 1GQOA 4KLCA 3ZWDA 2R47A 3HJGA 3K9HA 4HFMA 1SOMA 4WASA 4ZT2A 1TGVA 1M1NA 1I9GA 1AC5A 3TTTA 3TMKA 3AVTA 3EGXA 1VIAA 4GOKA 1HE8B 4IDAA 5ILQA 2PG3A 4UTZA 4BMOB 1NPDA 1UFVA 1AQ6A 1AKVA 4G0QA 2CB9A 2YW9A 1GILA 3N58A 3ZOKA 2AF3C 2WD9A 1HPLA 5AXDA 2ZZNA 5GMOA 1SULA 3N6VA 2D2EA 5M04A 1IBRA 1JQKA 1RZUA 1Z8DA 1PVOA 1JE0A 1C8VB 2G8LA 3ZXSA 2GJ4A 5CYFA 5EXPA 4O5AA 1RQGA 3VR0A 2WZCA 1IQRA 3IUPA 4GHWA 3N07A 2REBA 3C1TA 4ND4A 3FTPA 4WL0A 5CFLA 3K2BA 1VYHA 3ZVNA 4LQDA 3FGPA 1H8EA 2DECA 3QVWA 5KAMA 2ZCVA 2W2LD 5HIJA 4OREX 4JI4B 4ENUA 4TL7A 1XA3A 3RRFA 2V6IA 3KTDA 1HTTA 4XDZA 2YW2A 3D64A 3HDGA 3WNCA 3DL4A 4JHLA 1N77A 1T1EA 2P91A 4RD4A 3DMYA 1W96A 4F5YA 3OF5A 4AP9A 5D3MA 4MVJI 1EFRA 1RWMA 1SB8A 4JT2A 3U56A 5KO2A 1JYFA 4CM8B 1GYRA 5LMNB 1A96A 2PSFA 2QPAA 3GPBA 3MW8A 4LJ7A 2CDNA 1KIFA 3TSWA 4EJ6A 2GPAA 3CRRA 2ZIZA 4MHTA 2QRLA 2VHUA 2ZUFA 1D0SA 3C6BA 4DJDC 2C9DA 1XAJA 2H5IA 1YQXA 1II0A 3NIFB 3QM1A 4NMHA 4XUEA 2BGUA 1A9ZA 1T5TA 2O5CA 5EKXA 3M34A 4RJLA 4B6QA 4JQYA 5COAA 4H6VA 4ZHSA 3EX7C 4IY1A 3KZOA 1I6WA 1NP3A 4RKYA 1XTPA 3CPEA 4M1WA 4BCBA 2GAIA 4UUAA 1QS0B 1ZMTA 1W4AA 4XAQA 3CR7A 3NTVA 4M1SA 3PHGA 1OBFO 2QRVB 3TLZA 1NFQA 2X9LA 1ACMA 2BKVA 2BR5A 3WK9A 1QDEA 1ST3A 3UICA 3A1VA 1EA7A 2H9YA 3A9VA 2VSXA 3ZY2A 2FZ4A 5EE3A 1YASA 3VR6D 4G0VA 1ADCA 1UFQA 3OPQA 2GA8A 1MA3A 3EEBA 3C39A 4PRLA 3A4TA 2CLIB 1S1CA 4MH0R 3QG5A 4K03A 1WVIA 1E3MA 1DUVG 3ECSA 3IQZA 3ISVA 3WRWA 1II9A 2H65A 2VP2A 2IDZA 3UZUA 2O8CB 3ZJVA 1VLMA 3DTVD 3Q15C 2ZUVA 3WL5A 1CS0B 1E7SA 1GGHA 3FGNA 1SIWA 2YMMA 4YR7A 1USUA 1ZOPA 2SBTA 2XGMA 4JC8A 2DTEA 4EI8A 5A2GA 1LBEA 3R3JA 5GM1A 2EBWA 1RU3A 3ZIAD 1TCUA 2HSZA 1HDOA 3B38A 4F4UA 3FJ1A 3KD2A 3H4TA 2J3MA 5AJWA 1WX1A 4J16A 2ATEA 5BORA 1R7RA 3BXHA 5FNVF 2V1UA 3IQIX 3KHKA 1TEVA 1JG4A 1QV6A 4CV3A 1KWGA 5GAJA 3LNTA 3UQZA 3TIFA 1L4MA 2C3PA 2C2HA 2OO7A 3QX7A 1TO2E 3BZWA 4Q4DA 4MWBA 1QYCA 1U0FA 3O1LA 3TI9A 3FI0A 5BYBA 4MW1A 2VF4X 3L8HA 3DZDA 1E6LA 5CEEA 2W00A 4C6RA 1UH5A 3WLFA 1QE0A 3GLGE 1DCMA 1XFAA 3BJMA 3Q87B 4FW8A 4ZANA 4RVOA 3RKSA 3S27A 1A9TA 4DC9A 5IN5A 3FOFC 3GFBA 4GBGA 1RZVA 4MV6A 5BW6B 2ECKA 2HF2A 1E5LA 2VCYA 2GEVA 2EGGA 4J16C 4I2NA 3NG1A 5KYYB 3TTXA 4TSKA 2KHZA 2XGSA 1U31A 2JJMA 2SKEA 3TRDA 4MUYA 2CBZA 3CHYA 3FH0A 4HXFB 1T4CB 3LLSA 4HXGA 1HH4A 1KRHA 1RYNA 1ACLA 3FVQA 4Q3OA 4RV5A 2VDNB 5CFRA 5FWYA 4FOOA 4LEIA 3WRYC 1J99A 4YY3B 4HRAA 2P2LA 5EHNA 5CK5A 2XMZA 4HSGA 4O8ZA 1KTVA 4M0DA 3VPBA 4OYYA 2P65A 4ZK6A 2RBEA 1Z0FA 3B3FA 2A4MA 2W2TA 2R11A 1Z0IA 3PS9A 2RGBA 1AX9A 1EGVB 1RHRA 2VT3A 3KOUA 4K5QA 4AMVA 4ARVA 4DQVA 4HDRA 1O8CA 2FZKA 5BO5A 3DONA 4DV6B 2FFHA 2IZZA 2A33A 2W2NA 1PFYA 3M6MD 3P4XA 1N5IA 2O3JA 4ZJZA 4DILA 1CSEE 2I1LA 2V7WA 3NUGA 1UWLA 4F8EA 3Q12A 2XY4A 1JBQA 2PQ0A 4UD2A 4YRJA 2OMEA 3ADKA 4KHPB 1SKAA 5FNVA 2I2BA 1KGSA 2X19A 4GM0A 4GPTA 1QHHB 2NZYA 3FKSA 3FWHA 2VAWA 5IJ0B 5TF0A 4JX9A 2R3SA 3V1UA 3ZWOA 4PPFA 1HEUA 1NOJA 3NYRA 4CKWA 2QTGA 4WLFA 4I14A 4TWJA 5HK9A 1M5RA 4H17A 1QHXA 3PDJA 3V2HA 4NJMA 5B3AA 4L51A 1Q1NA 5EMKA 5BSUA 3H5OA 5HZMA 3H5WA 3GRAA 1RQRA 1HORA 1F8YA 2HSJA 1I2DA 4CMEC 1JHVA 1G21A 3OSUA 4PZ0A 4PYRA 3SZ3A 1M1UA 1GNTA 3FSJX 4HEA1 3K9LA 4XVUA 5EXEA 2J3KA 2GRUA 2KBFA 3CISA 3GNTA 1WOMA 2HMWA 3L18A 4G65A 4HN9A 4X0EA 4X84A 3ZV6A 3HL0A 2A1UA 2YZKA 4L75A 1SKYB 3MOGA 1FU7A 4C4PA 1ZWLA 1SK9A 2BSXA 4DEYA 1BA2A 5JTTA 3WK5A 4ZMRA 4QPNA 4RK4A 5K99A 3AOEC 2X0DA 1I2ZA 2FU5C 1M34B 3PQ6A 3S1SA 3S2ZA 4TZ0A 3UIEA 1BWSA 2FUCA 3BEOA 3EF0A 3I1FA 3PQ7A 4MUKA 2QN9A 4AUMA 4C2TA 3QF4B 4YO7A 1WWKA 1YACA 3AC0A 4N65A 3D81A 3UJDA 4KR7A 1ABEA 1TLLA 1Y4AE 1Z8FA 3G7UA 4P1ZA 1J1ZA 3VJKA 1FDOA 4B2LA 2IX9A 5JH7B 1U80A 2ZJFA 5JQWA 2PSSA 2QLFA 3UTCA 2WWGA 4EB6A 2IIPA 1NQUA 2Y9MB 4DG8A 3GR6A 2ZJOA 1PG2A 1Q95A 5DCLA 4JJGA 1MEOA 1E1RA 2IOHA 2P4SA 4X6XA 3THRA 3UYKA 3MJCA 4A6EA 5K01A 3U4GA 1OVGA 4HV4A 1GTSA 5ITWA 1R64A 2CZGA 3ZQJA 3AT1A 5A3QA 5AW8A 3FBWA 3UUGA 3BRSA 1HK7A 3I23A 4DNFA 4YAUA 2IPAB 3OBIA 2FEKA 3WV5A 4BGDA 1BEZA 1SOWA 1VSQA 4FMBB 1U2GA 1NMXA 4DR1B 1GCUA 3CZMA 3I76A 4TYNA 4DM4A 3RR2A 3WMEA 2H7YA 3B48A 5BUSA 4MKFA 5BSVA 1JPUA 4FDMA 2R66A 2W8BB 1JYSA 2NUAA 1KQ3A 2X4IA 3ZNQA 2UXCB 1Z8NA 4TTIA 5BVGA 4GLLA 3D2LA 1TC1A 4J8PA 3FSGD 2ZTUA 2O8FB 1E0DA 4IUDS 4TSRA 1EVYA 1V7QA 4E22A 1GRCA 2QAGA 1V1MA 4R8MA 1K6MA 4QELA 4HL6A 3RT7A 4I1IA 4GVLA 4RZ2A 3X3HA 1KSJA 4WNCA 4DY4A 3QQPA 4LJ5A 1DFGA 5E3HA 5A9RA 4RKQA 3G8AA 3OO1A 5K0CA 3TW0A 4WT7A 5DX1A 1PLLA 4IS2A 3V1YA 1DEOA 1K4YA 4R9VA 1EM8A 3F3KA 4O2RA 2DFDA 4XTCS 1W19A 1CUDA 1VZ3A 4N54A 5NULA 1N8SA 5AQ1A 4KLNA 4HWGA 4JUDX 1T6XA 3LE8A 2Q3LA 1PTKA 2Z2XA 4YUWA 4LWZA 1C9NA 1RJWA 4C29A 3ICQB 2QRQA 1E0AA 4G1UC 3H0EA 4BNWA 4HAZA 1CE8A 2FR8A 4R9NA 4BFVA 5K0FA 1UDWA 1XA0A 5J1TB 1RWWA 2AH5A 1E1NA 3HVUA 2P8JA 1E3WB 5CM8B 1KYZA 2P0EA 3WB1A 4Z7NB 2FE1A 1AF4A 2NO1A 4R7TA 1G42A 4U9HS 3VC3A 4BV3A 4OHWA 2JHAA 3IV9A 1FY2A 1RM5A 1A4XA 5DCUA 1XT6A 1XVAA 2R7AA 4RM2A 5ISMA 1BQEA 2IC5A 1NLUA 5EHXA 4N3CA 2R00A 4F04A 3CUSA 4Q1BA 2JANA 5JE8A 4B34A 3W4JA 4EVSA 3THWA 2CXXA 1Z0UA 1JLKA 1OOEA 3H9QA 2H1LA 3RV3A 3KOZA 4MWEA 2H17A 2G40A 3QXXA 2C77A 1CR4A 2ZSJA 3KVVA 5IAGA 1F8XA 1T6NA 4WXRA 1FMFA 1Y8QB 2PH7A 2Y9PB 3HO8A 4YR9A 4R2XA 1XTTA 4FQ5A 5TQ2B 3VR4A 5JVDB 5CX1A 3PDCA 1K06A 5JS6A 4X7BA 4ZCRA 2JEOA 2P3QA 3JALB 1Q0SA 4PS0A 1F20A 2AG5A 2OB2A 4DL9A 2EFEB 2FPLA 4JJKA 1L2TA 4F2PA 1U3FA 1IM2A 2DUUA 4X1YB 2Q7XA 4MUFA 2FVXA 4F2WA 1DJOA 1FFBA 2ZQ5A 3BXFA 1F7VA 4WXMA 4WBNA 1ZITA 1XRJA 2EJVA 2FR0A 4R5HA 5LLTA 2XJ4A 3NTOA 1DCFA 1JHPA 1Z17A 3H9UA 1WOYA 4GP6A 2Z5VA 5AGSA 5DLEA 5FPQA 4L0MA 1CPYA 5EJ7A 1E2HA 2JFGA 2VRCA 1TD1A 4DLTA 1SBIA 1GUAA 3EJWA 3AB7A 4E94A 1USKA 3JCZA 4Q48A 5F7JA 1QVRA 4IV5A 3EBPA 2F55A 3FTQA 1GUDA 1ZYUA 2YMPA 4BVBA 4NENB 3OCWA 2W37A 2EW1A 2BZSA 4F38A 3COSA 3T5BA 4RTPA 2I03A 2WJ3A 1Z28A 3PDHA 1IDOA 3GMDA 1SK8A 5AJHA 3CWQA 1T0JB 3AF1A 3F3YA 2N46A 1L5KA 2QTTA 2PM8A 2Z5FA 4D4MA 4YJFA 3FSEA 2SCUB 4HH1A 4FGSA 4MQBA 1VPEA 3PNLA 1N25A 2NVUB 2F00A 3B53X 4ZRMA 3PF8A 3E4DA 4G5OA 4OHUA 3RVKA 2XWJI 1MR3F 3EG9B 3JS5A 4CLRA 3UT5B 5JCOC 2VZ0A 3U4QA 4DUPA 1NJ1A 1N0VC 3DMGA 4UJ5A 1Z37A 1VGVA 1XRPA 4AJ9A 1I33A 4J0QA 5BPFA 2ZM6B 2SKCA 3EOBI 4IIJB 5ICFA 4AKHA 5ALOA 1NATA 4EX7A 4ML3A 4H7IA 4LDZA 2Q4BA 4UEJA 1D6SA 2ZE6A 3OOHA 3LYUA 1WLSA 3WK6A 1NXQA 1XNHA 1PTJA 4OB8A 3L77A 2O20A 2QPOA 2E5WA 1PWZA 5D00A 3UMGA 3H1FA 2X77A 3RB8A 2E37A 3ROPA 3A6KA 3IAUA 4KFRA 2IF0A 2W2KA 4L57A 3ZLUA 1OXSC 4E6PA 3AUYA 4S1PA 4C20A 3ZDXB 3L6BA 2WG2A 4JC5A 3O38A 1V3UA 4BP8A 4EG0A 1K3TA 3AM4A 3OPYI 3A1FA 1APBA 2XUHA 5J2UF 3NHLA 2PX3A 4FZJA 1ND6A 1YDFA 2CNWA 4HEQA 1SD2A 1Q2XA 2JAUA 3C1AA 4BGEA 2PUJA 1NYQA 2HWKA 2P2NA 4A0QA 2C5AA 4HJXA 3DXZA 4CF7A 1R4NA 1TLFA 1PTJC 2QN8A 1CVLA 2CFSA 1J0XO 3P52A 2EBFX 1TYEB 1O57A 1UJ4A 3W79A 3LL4A 1DV2A 2QUBA 2WYUA 3CRQA 4W9NC 4TMVA 4RH3A 4H1TA 2PNJA 4CR6A 4HGZA 4HVAA 3F0TA 3IDAA 3ND8A 1BGWA 4V3BA 2JHPA 1XN4A 5C4GB 4KX3A 3AIKA 4GO1A 4AMBA 1E7QA 3HCWA 1VP3A 3EDCA 2QSUA 3JR3A 4JVMA 3ZDFA 4AB1A 1KH2A 4BB0A 5LZ2A 3C7KA 1EK1A 3IRUA 2FSGA 2NSJA 5DF1A 1P3DA 1LPPA 1X7DA 1MAHA 2A58A 2HLDA 4HTFA 3KP1A 2M6LA 2ZB3A 4XCXA 3W8EA 2Y4OA 2Z6VA 4ZT4A 3GMSA 4IDHA 5L3SB 2AFVA 1GLVA 2JJQA 2XQJA 2DUNA 3OE4A 3RTCA 1PHPA 4NZPA 5JARA 2EC5A 1E9FA 2I2WA 2AE2A 3CB2A 4WNAA 5DTIA 4B47A 4BFTA 5SZKB 4NBLA 4ZYTA 2ZI7A 4XX0B 4MITA 4P82A 3S44A 1HDZA 1A4IA 1WXWA 4YRNA 2RH9B 5C8DA 4RVFA 5DHQA 4WVLA 5BQOA 1MABB 3HNPA 5K4GA 1J8MF 3KAQA 1G0NA 3H9JA 2ZI6A 3L7AA 3ND6A 4DZZA 4Z7QB 1RM4A 3T1OA 4Q82A 1D3AA 4MLPA 3ZV4A 1DPFA 2JLQA 4Q66C 4TTTS 4KOEC 4MRVA 1L5FA 1V8DA 1S7CA 4OIMA 3SFTA 1JWAB 3CZCA 5J2UA 1P5JA 3O1HB 3S2IA 3TR0A 1DVRA 4CT5A 1ODFA 3I01A 2LW7A 4TKVB 5HZGA 1YS6A 1HNZB 5CIWA 1OYVA 2DWUA 1NBOA 5FLXA 5C1BA 1R12A 1EZ1A 2WU8A 5JJ5A 2R8YA 4X45A 3NTLA 1FRVA 2DY0A 2YJ5A 2IBMA 5INTA 2WAYA 4XLTA 1P77A 5AHOA 3DAHA 5HKLA 3FUXA 1T25A 4JEIA 4TXHA 1D6NA 1UDCA 1Z5VA 2XDQB 3NYWA 3C43A 4P2GA 4GPEA 4AZVA 2GARA 1ANKA 1E9CA 3AZQA 3KKZA 3TNFA 4CM8A 4GLFA 4E88A 4UTPA 5I4CA 3FUTA 4MINA 3N0WA 3PF9A 3DLPX 1X6VA 2RGWA 1J20A 3FPKA 3EVZA 3V1LA 3UGKA 3E58A 3G2HA 4AX4A 2ZJ8A 1O0SA 1NOIA 1TEXA 3INGA 1JIKA 3JYPA 2YMLA 4FFOA 4QC2A 3W3ZB 4TVSA 4Z51A 4B7CA 3OOJA 4KDFA 2XAAA 4R4JA 4V1CI 3VGPA 4ZAFA 3DLHA 1NY5A 1L7EA 2ZUCA 5BW4A 1KZYC 3GLHB 4RK5A 2MR5A 3DL2A 4JI2B 4WADA 2QRVA 2I8LA 4Q9JA 5U1PA 5LQMA 1QOQB 4WNIA 2C0QA 2VEDA 2W6NA 2B1QA 3ASUA 3F5SA 1OFUX 4FYPA 4L6IA 4OK6A 3SSNA 3TOSA 2ZREA 1TU3A 2XDAA 3L6EA 2ZROA 4I81A 3FFWA 3UT0A 4AX8A 1JMYA 1XPRA 2PUAA 2Q99A 4LVUA 3EULA 1O97D 4YRPA 4EABA 4DGSA 2FXVA 4M0MA 2PN1A 2V55B 1HM5A 2VSOA 1FVFA 4FYJA 4RZSA 2XTAA 3L1IA 3KLBA 2WFLB 2XUQA 1E20A 4B71A 2WF7A 3ZGVA 1IMOA 2QIPA 3PEVA 1DIOB 1HR0B 3H99A 3KR9A 4EW6A 3E8XA 1KY3A 5DT9A 2O8CA 4C1BA 2W98A 3D6TB 2J5RA 1CS0A 3I04M 4QSHA 2XD9A 3V7NA 2PZBA 3O8NA 2RHWA 1KZHA 3H2IA 1QH8B 4DA0A 4E0BA 1RXIA 2PX5A 2JLWA 3AR4A 3NORA 2A9RA 3PPVA 1F6BA 1W1WA 1FXSA 3P32A 5M3BA 1J2JA 2CE2X 4DDKA 1I0LA 3B3JA 3I64A 1F1BA 3JW8A 4ZVOA 2YXLA 5B1YA 1ORDA 3R3SA 1H93A 2J4DA 1YVPA 1CR1A 3RYCB 2JS7A 3VAYA 3KETA 2A9OA 5I7WA 1AH2A 5J2TF 4M7OA 5EN4A 3HYTA 4YMGA 4PHGA 2DWCA 3BD8A 4HDNB 3WHKA 2VZEA 3D4BA 3TAUA 5BMVB 2ZIUB 2RMKA 2HSEA 2WUDA 5HFNA 2FPRA 1TZMA 3CJRA 2O2XA 4IHJB 2UUOA 4FGLA 2R4UA 1SRQA 1L8OA 2VP5A 1Z4LA 3W34A 4YRZA 4AQYB 3O4GA 4QU9A 4QUHA 4ZVTA 5K8TA 3T1TA 5EUMA 5KZMB 4LTNA 1J9EA 4B4KA 1T3TA 2P2GA 2V7TA 2ZYWX 1GZ3A 4D5GA 2X1LA 1OA1A 3ICPA 1X2EA 4C4XA 2VFAA 3OQPA 1FE8A 4HGOA 2P3SA 4OP3A 4L0QA 2HA7A 5FI3A 5AUNB 3ZE0B 1T4CA 1N2HA 1SBNE 1YCDA 2BRUA 4P9NA 4X41A 2RGDA 4DNOA 4IR7A 1IFXA 4IL5A 3MXTA 2PRKA 3SM9A 3G2IA 2EKBA 5DYWA 3UBMA 4GKAA 4YRKA 5ALQA 1GG9A 3FROA 3KQKA 1UBHS 1T4GA 2WWRA 3NXKA 4HUQB 4IQ0A 2ZZKA 1E5TA 1NVEA 1L7PA 3MTAA 4GX5A 2ZBVA 4PO9A 1THTA 3MELA 4Q39A 2FB9A 2LVBA 1E2LA 3I73A 3U3RA 4GRDA 1LPAB 1JALA 4EY5A 2GZ1A 3D6JA 4XB2A 1MU0A 2XZTA 1D2NA 1X38A 3BXGA 3MUOA 3DLCA 5BR4A 3NAQA 1FJXA 4M1EA 2NX2A 5AYVA 2EF1A 4LQ4A 4DMHA 4ESOA 1BRTA 1Q0LA 2PX4A 3KLNA 3IR7A 4CPDA 2BRUC 3V8EA 3X44A 3ZE8A 1QYXA 2HSWA 1JKIA 1R0RE 1OBCA 3E05A 4RL4A 5FV4A 1VG9B 2XUZA 2E4ZA 2XUKA 3MT7A 1UQUA 1YFLA 1BMTA 5JAIA 1U0SY 1HFWA 3QYFA 4O3FA 4RVGA 2JCXA 5ER9A 1SVOA 1JHDA 5GZ3A 2VNJA 4IGIA 4ONEA 1QHHA 4R41A 5IJ0A 1YNOA 2H00A 4MPDA 2XF8A 3UYLA 1YBMA 4OFBA 2W6CX 5FO0A 2AQHA 1H2BA 1T5HX 4GI7A 4E1BA 3P45A 1O4VA 3D1LA 4XWGA 3PFIA 4TMXA 4W4TA 4Q3KA 5C34B 1LKZA 3WS7A 1U28A 1Y4ZA 2JGFA 4NEQA 1NQOA 4JYCA 4Y18A 1DXYA 2ACEA 3U0BA 1K6IA 3RC7A 2FSUA 2KQUA 1C9DB 3HMKA 5DNUA 2BDUA 3NDRA 4JC4A 5T6MA 3FMIA 3M6VA 3PNMA 1EWQA 4QGAA 2B35A 1C29B 4FMCF 3WG9A 4DF3A 3BQMB 2HGSA 1YTLA 4DDTA 1Y3DE 4HRVA 1SXJB 2QZ9A 2NACA 5K3DA 3BWBA 4QU8A 4UE3S 1Q21A 2KYRA 3A70A 2ZJ4A 5HZKA 4Q7MB 1KK2A 2ISQA 1J7JA 2V9ZA 5LU9A 2Y93A 1Y9JA 5D6NA 4BJ1A 1U28C 3DZ8A 1RMYA 3I2YX 1ECPA 2YRWA 3IERA 1Z26A 3MTDA 1YA6A 2BMDA 3E9MA 4DV4B 5J3JA 1Z06A 3L4BA 2C4TA 2C7GA 4CDGA 5FNZA 9MHTA 4RGBA 3WB2A 1M34A 2DPHA 3BGDA 3DWGA 2ZEJA 1OBOA 3LUKA 1CS4C 3FD8A 5BV1A 5ITZB 5LWHA 1ODTC 5ELMA 5D7BA 3JZDA 4CE6A 1V37A 4X90A 2WB2A 1ZH2A 1SC3A 4I8XA 4RSRA 2R7NA 3QF4A 1Y3BE 3MUNA 1NMYA 1JLLB 4YAFA 3ABQB 4JMPA 2XH8A 3KQUA 1C30B 3OMXA 2IBTA 2A57A 2WP0A 3L7KA 2WDPA 2E4XA 5JH7A 3B5JA 3EYAA 4DBLC 2IH4A 1L9KA 4YNBA 3ZE6A 4YUYA 2H4XA 3MJEA 4ZQGA 1C7JA 4YPOA 3HN2A 4UJ3A 3OCUA 5BV7A 4N3BA 3FYTA 1GZ7A 2HA4A 2IODA 3OIWA 4RHXA 5JJBA 4YRCA 2ZYUX 5A7FA 1XJCA 4EFDA 2BM1A 1KEWA 2CCKA 1IN4A 3W06A 2QX4A 5PGMA 5KYTA 3R24A 2GPYA 1QQBA 2W6ID 3CJQA 4KYTA 3T3MB 1BQ3A 1G2IA 4IVRA 2YFKA 3IP7A 3NV7A 1K63A 4JQSA 3OTHA 2W8BA 4XRRA 2X4LA 1GGMA 2WAOA 5JVDF 4R1PA 1KI1A 1YL7A 2JIPA 3CIOA 3L7MA 3E4CA 4KQCA 3UOGA 2O8FA 2VVTA 1THZA 2F2TA 1DAIA 2ROQA 4KIUA 5ALMA 1P8JA 5BRNA 1Q3KA 4QDXA 4RD6A 4ZVNA 1CUFA 2FA9A 2HLHA 1H3FA 1SG0A 1TIPA 2H1SA 3D1VA 3Q3CA 2E87A 3QFCA 1VKNA 3LWNA 3P96A 4DEXA 3FN4A 1QO7A 1F0YA 2OCAA 2FUEA 3N53A 4TYMA 5DK6A 3RNOA 4C0HA 3FFAA 1SC6A 1ZD2P 2VBCA 2WR8A 5BV0A 2C7QA 2J07A 4I8IA 2BT4A 5EYPA 3GRUA 3USES 3ED1A 1QNLA 3P19A 5E1OA 5E2BA 3SZOA 1VJGA 3IODA 3RYIB 4XUDA 4URHA 4IIYA 4URZR 1U99A 3B7GA 4HB0A 4HOYA 2RE8A 3HM2A 2WJZB 2JJ1D 3A6JA 3EXG1 5BQPA 5CDFE 4OHFA 2Z6AA 2NWQA 3U1VA 1GSAA 4BVJA 1OJLA 2PS1A 2QN1A 4W8HA 3ZGOA 3D6FA 1E3WA 4A2WA 4BQQA 4ZPXA 4G09A 3AKDA 4JD5A 1USWA 2VCHA 4BLRA 1E32A 3HFJA 3WKEA 3VUEA 3FNFA 2D8AA 4NFHA 1PR0A 3UY4A 5KUTA 3PZ0A 5BV8A 3UMFA 3AEZA 2AZTA 3OWXA 1C3JA 3V3TA 1WY7A 1J5PA 3EXAA 5HEKA 2IPOA 2Y05A 4JOQA 2IJGX 2XCLA 4NEGA 1QH1B 2PT9A 3H2HA 3QK7A 1A04A 2MHCA 4RLSA 3JXEA 5JECA 1SUCA 3RG2A 5FPTA 4G0XA 4CHTA 3W1WA 1DUSA 1Y8QA 1JJBA 1SA0B 4J7CA 5ECYA 4K6FA 3AR6A 5GV7A 3N86A 4IBOA 3CCCA 5TQ2A 5AHWA 4K46A 5JMOA 4TWRA 4JX8A 1ZO8A 5JVDA 4F4IA 1FJGB 1JBKA 3I8SA 4FMDB 1A5SB 1KK1A 1YCHA 3NCTA 3T3NA 4PAQA 2EG5A 3JALA 2QJFA 5HKKA 4RS3A 1VC2A 5DWDA 4DAOA 5ITSA 1YFKA 2GZMA 1FLVA 2VKQA 1HBJA 2FN7A 1FS5A 4X1YA 5JDIC 4G0UA 5K0LA 1RYMA 4OOEA 1KERA 1HY3A 2RGXA 2JD2A 4Z86A 2HUPA 5FF9A 1E2UA 2UYOA 5I9NA 2VOEA 4WINA 1MAVA 4I9HA 2NV6A 3V4ZA 4JP3A 2CY0A 3IJ5A 4BO4A 4WN9B 5ABPA 3F5DA 3QMVA 4B9EA 1EA5A 2GEDA 2WLSA 7GPBA 2MSWA 4PZ9A 1JG1A 4C6HA 4MVJP 1XDBA 5B2EA 4FEYA 3V1TC 4KZKA 1HSZA 2O2JA 4EJSA 2O0HA 1DAKA 1DCKA 3DMRA 3JZAA 2XLCA 3PQEA 4NENA 1GGNA 4I5IA 1KA9H 3DKPA 3O8OB 2PS0A 2I6UA 1B6GA 4GS5A 4ND5A 2QTCA 2H59A 2PAFA 3F8SA 1CFJA 2SCUA 4QO8A 2GF2A 1XTRA 2NVUA 1KDRA 5CH5A 2ZUUA 3KTAB 4HS4A 3RAJA 3EG9A 4KGZA 3N75A 1OXBB 3RUAA 1ZK3A 3UT5A 1YTUA 1RWXA 3L01A 5A1JA 4EATA 1H1DA 1FSPA 1VG0B 5KPJA 3NHSA 4YVFA 5BQ5A 5LB2A 1UXJA 4Q7KA 4IIJA 3VNAA 4MDEA 3IEVA 1S2LA 1PJZA 2E6UX 4LZLA 2FX3A 3UKOA 5JR3A 1FMLA 2NOAA 1PBTA 5T6BA 5E4YA 4LXUA 1HYQA 2J5BA 1K88A 3IP8A 4DLNA 1NMQA 5EESA 3V3KA 1SBCA 2V7UA 2QG9A 3H9EO 4J2OA 2BGKA 3BD6A 4WXPA 2OCIA 5DBOA 4AD8A 4I1YA 3FZEA 4N6NA 4PFSA 3HCPA 4LBYA 3FTEA 1IXRC 5EWMB 1X7HA 3BE4A 3IAM1 1XU4A 1J2UA 1GTVA 2NTNA 2ZIEA 2I6QA 4WY8A 2FK7A 2P9BA 3WAJA 4F11A 2EU8A 3FZNA 3LRTA 1ZI8A 3OFKA 1NURA 2D3WA 5I9TA 2FX2A 4LX8A 1RXWA 4IOKA 4J0HA 3SNKA 3UKDA 3UVEA 3T9DA 3L8ZA 4D56A 1IZZA 4BAUA 3GEEA 4YQEA 4OG2A 2CHEA 1Q50A 3CXUA 3OJ0A 1JXAA 2JZOA 3WDSA 4AG3A 3GFFA 3LMKA 1U3TA 1DKMA 1WG8A 1Y34E 5AKKA 4DGQA 1ZJ4A 2UZ1B 5DGDA 1CULC 4YMUA 5TGTA 4Z3OA 4XM0A 1DC7A 3KL2A 2GRAA 2IXDA 3FOZA 2R6GA 2XRFA 1CUCA 3LCUA 3E7WA 1EK6A 3X2SA 5ALGA 5CFNA 3A11A 4NV3A 1QLHA 1YQUA 2ZAOA 2ZR7A 5L3SA 1S1MA 1R8JA 3NGMA 2YZ2A 1Z5UA 3IP5A 5FPSA 5HW0A 1H4QA 1PG0A 4G4SP 2WT8A 3OU7A 1SUPA 3D4OA 3MERA 4XX0A 5CD9A 5AW6A 3G0BA 2G0TA 2P4UA 5JXGA 2ENUA 4PSCA 3PKZA 2CDBA 1CQZA 2VBGA 1AQIA 5FTWA 2BFCB 3O3NB 3E9NA 1P0CA 3UAVA 5LR6A 1JPNA 3HRHA 3E0QA 4A1OA 2WA1A 4JLSA 1C14A 4HLUA 1MABA 3FOCA 4PLPA 2VSYA 1U1CA 4BEWA 2RKOA 3M6AA 2IH5A 3L46A 4CW7A 2N75A 3EC2A 2J6HA 4N82A 4BNYA 1GU0A 2C7BA 1ODCA 3EDOA 2EIXA 3M9LA 5JASA 5JRDS 1GKIA 4PSKA 2Z5GA 1RP7A 1RYFA 4W5QA 2C2GA 4NBSA 1WTCA 4BGVA 5EKTA 2O9JA 3UPDA 1SMKA 3HC7A 3T9BA 4ZIRB 5EQDA 1NONA 3UEOA 1CQWA 2HOQA 1K08A 3SYNA 2VDOB 2XB6A 2OK8A 1PD0A 3P4YA 2D0OB 4INPA 4R8RA 4WK2B 2RGCA 4HBGA 5CTJA 3SS9X 3IFSA 3QFHA 1XLVA 2F3RA 1FDRA 1JBEA 3O9VA 4CQMD 5CVUA 2FEWB 5TE9A 1W73A 4Y2SA 3OEHD 2B0CA 2H06A 4J0GA 2J87A 3DM9B 3P9YA 4MKXA 3RDPA 4EHIA 4Z0HO 1JQBA 2RHRA 3LJKA 5E9WA 4C0LA 2BTEA 4K9PA 5TPZA 4U0JA 3U09A 5DIZA 1WY5A 2XDQA 3DE2X 3IIIA 5IULC 5LKRA 1KRWA 1EP1B 4DZRA 1GNVA 4MW5A 3HBMA 1U98A 3K53A 1F51E 1C1DB 3OUUA 4WKCA 3TVDA 4QU5A 4BKRA 4BP9A 5B6IA 2MSDB 2ZRKA 2VRWA 3I0ZA 4KXYA 3IX7A 2JFVA 1U2EA 3E1GA 3AJRA 5KI6A 3F7OA 2JLUA 1MAUA 4F3YA 2G0NA 4N47A 1PCXA 2YOFA 2Y92A 4IHJF 6LDHA 3O8RA 2XMDA 4Q1AA 1YJQA 2P69A 1LRKA 2JAXA 4PWZA 5IUNC 3ILXA 4OJNA 1DBPA 4MNTA 4WK0B 5AGTA 3JY6A 4LY9A 3GLHA 4C1NA 1GPNA 1QXSA 1UE0A 2GBPA 3CLTD 1WDWB 2YHBA 4YRAA 5C8ZA 1DMSA 3GJRA 1XN1A 2HO5A 2RGNC 1U9YA 4DRXB 1ISPA 3D2AA 2DE0X 3PVCA 4LJKA 4MZXA 1ZEMA 2YV5A 4EA9A 4PHHA 5D7NA 5CVEA 2DCUA 2PBLA 4FFNA 2YNMA 3RVBA 1EEXB 4B8ZA 2P9HA 4MXDA 1V5WA 4YH1A 1TVKB 3GGSA 5DE3A 1YFJA 2WFLA 3AINA 3ZJ4A 2DFPA 4UAJA 5SY4A 4LJ6A 1R6BX 1RJFA 4WEOA 1EVKA 1JAHA 2JAOA 4YMSA 1CY2A 5DBIA 3RSOA 4C43A 3F2IA 3ONFA 5HZHA 4RKFA 2W58A 1WM1A 3CKYA 2LDBA 4I0WB 4OJTA 4OQDA 5CVCA 3ZU3A 1W2GA 1QH8A 2HYDA 4JBIA 1A7JA 5K20A 4LC9A 3OH8A 4ENSA 1DHTA 2J67A 3EZ6A 4J94A 1G5FA 5LIRA 1KTIA 3HG7A 4NG4A 5I5EA 4PV7A 1IULA 3VVBA 4JWKA 2N42A 1ARZA 1IHUA 4X24A 3RYCA 2JLZA 3LQQA 3QFFA 4FYMA 5DLQC 1BWQA 5P21A 2E4VA 5HJEA 2IYTA 1LSUA 4AZSA 4B8WA 4KH0A 2ZQYA 2XWBF 3DNPA 3V55A 4HDNA 5THKA 1HQKA 2XA9A 4UBKA 1SKUA 2W6JA 2JHGA 5IC5A 5BMVA 2DSNA 2I7XA 3C7CB 3ER6A 3OESA 4IHJA 2VPPA 2YWFA 1DWOA 4IUBS 4PFJA 4ZO7A 1QGOA 3T8YA 1VKOA 2F3QA 2XBMA 2Q6IA 1XZAA 1OKKA 4PTLA 4F1KA 2UUCB 2XTNA 4OA5A 1QZUA 1N0HA 4CODB 3KD3A 1W30A 4GMKA 1IEWA 2HIHA 2BONA 1W44A 2KLHA 3UAYA 4J29A 3R6DA 1Y1QA 2GN0A 3BHMA 1L4EA 3NHBA 1S0UA 2NN3C 2QSYA 4M8NE 3ZZTA 1MZVA 3VDRA 1Z07A 4W5WA 4I3HA 4FYXA 2BIFA 3UFBA 1A3CA 4WDQA 4D9HA 4GX1A 3D6UA 4PSAA 4V0MA 2ZJBA 1ESZA 4OFWA 1EUYA 2YMQA 3BE5A 2ORYA 3M8KA 1I01A 5J1SB 1S5PA 4AN4A 4AW9A 1U8TA 1ZKMA 3AV0B 5IZ4A 1STOA 4JBWA 2PNFA 2WJIA 4HUQA 1CRWG 2QX8A 5EKSA 2ZB2A 2AG0A 1JRLA 1DKPA 1E98A 1TIKA 3IMGA 2GPSA 2FWBA 4L4XA 3RO7A 4KMSA 1G2PA 4QXRA 4NQZA 1KH1A 2GBCA 3F8TA 3ZHOA 4WOKA 1RACA 4D1YA 1TYAE 3EVNA 4WQMA 1FBNA 5B55A 4MS4B 2I7TA 2CXTA 3M6WA 3MTQA 2E9SA 4N12A 1QGZA 5JWHA 3BIWA 5T8KA 2FFQA 3A10A 4V3CA 5BW5A 1Y6QA 1V8OA 3A25A 3K3PA 3CH4B 3KKLA 4J0FA 3MQFA 4MYDA 4MARA 3SMVA 3C6QA 5EJFA 3L7YA 5FBLB 4AXXA 1TF2A 1QO0A 2IVZA 3MWYW 1JDBB 1PQWA 4MGYR 1V16B 1XNQB 1X19A 2P6NA 1JX6A 2Z2KA 1R5NA 3BS4A 5T64A 4FZVA 1VKZA 1M2FA 1KO4A 5H81A 3GPCA 4PYMA 2MMGA 2UVPB 4IXTA 1G8JA 5JLJA 3MUFA 1BHSA 3H2ZA 5I9MA 2VJKA 3IULA 1GPJA 4GXQA 3RAGA 5HVNA 3A26A 1EX9A 4TLBA 1QYVA 2C78A 1QM5A 1H6AA 1E3SA 2HMYB 3LCJA 5SYAA 4MVJD 4GKJB 5A5DA 4O2LA 3H2KA 1A82A 5B37A 5B4VA 1KO7A 4BDTA 5HQTA 3ETGA 4IXNA 1CC1S 4TKVA 1MO3A 2BW0A 3GIWA 2H2AA 1SXJA 4C89A 3E7XA 2GDJA 1MVNA 4PYNA 1UMKA 1N3LA 3NBUA 5KYXB 1YC2A 3AI2A 4PBSA 5AOBA 1S2GA 3WSVA 1GWNA 2G36A 3B13B 1G2QA 3ZI4A 4UNNA 4JDPA 5E8JA 1KI3A 1Z4NA 4Y30A 1N78A 4U8HA 2GPWA 5DN9A 4M0UA 2QJRA 1T8RA 1SD5A 4TQUS 5ITZA 2R6FA 3QI7A 3C0KA 4JLPA 1CJCA 2WPDD 4IHQA 2O0LA 1YRQA 4MVJE 4URXR 5JNLA 3PSHA 1JLLA 4UC0A 5F5LA 2QLTA 5FOUA 1C30A 4BQPA 4YT8A 3CSUA 3KV3O 2WILA 3WXBA 4UNQA 2HT1A 5FO1A 1NXPA 3L6UA 2HZBA 4MI9A 1MXFA 4ZCQA 1XMJA 1VXRA 4WY2A 5I3ZA 4PM4A 1CG6A 4OQMA 6ADHA 3IUQA 1YZYA 3SX0A 3T3DA 1MFZA 2NUBA 3RTEA 5DX0A 4PICA 2EJCA 2A88A 2XZOA 1P3Y1 1YCFA 2R68A 2P4QA 2VDLB 1W2HA 1T5SA 2V74B 1T3LA 2WHPB 3VU9B 1FSFA 1EGAA 1G9SA 3GELA 4M8SA 2PS9A 4B3RB 3N74A 1YMUA 4DAEA 1KOFA 3EMDA 2MU1A 4GL4A 3ABSB 1DJLA 4MR8B 3GJ8A 5KJ6A 3A2KA 1MV8A 1ELOA 1GEEA 4KC0A 2PJZA 3M1IA 2VWQA 3QPVA 4BFZA 4FMDF 3KTFA 1LB1B 3UV6A 3MK31 1FS6A 4P7GA 4XW2A 1RMQA 4P3YA 2G4LA 4Y2VA 2ZETA 4D3YA 5IFLA 1K6EA 1GPDG 4QVKA 2DP4E 3LPAA 4WH0A 5CDHA 3VYUB 2E4UA 3EZXA 3MB8A 1XZIA 3KV1A 4I1SA 4CUKA 2J30A 3OU2A 3EA5A 4HATA 5CNIA 4XQ0A 4C7OB 2Y0DA 3TGWA 4UCQA 5JNSA 1QP4A 4PU0A 1X13A 3GZJA 4YQZA 2HU7A 3HR7A 2XV1A 1ULAA 4KX5A 3IE1A 4MW6A 2KM1A 5BN3B 4EK9A 4D9FA 1CUYA 5LQNA 1IH8A 1X7GA 4Y0AA 4DV0B 1Y5RA 3QMWA 5MHTA 1RHJA 1VPVA 4WA7A 3RC3A 1KYYA 3RYIA 3VU0A 4QIHA 4TLMB 5BYKA 1BDBA 1JLRA 2Y6VA 1Q7BA 4GPZA 1W49A 1HE4A 2HMUA 3NWOA 4AAYA 3FBGA 4EIWA 3PEWA 4I5EA 2PMFA 3WXMA 1T24A 3KKNA 4J1NA 4BATA 1S7GA 4AWAA 2A5FA 1S6YA 5CD1A 4XJXA 2W2XA 5CDTA 2X22A 2VDJA 3P0EA 5B1IA 4BZXA 3IL2A 3V8PA 2A9FA 5J40A 4B4VA 4C7XA 1ZMRA 3ZOZA 3AQIA 1MJGA 4BQFA 2IK8A 3CX7A 4Z7JA 1TW2A 2Y76A 4EPRA 5JAOA 2DETA 2J7KA 2GR9A 1RBYA 5DEIA 4BV2A 3ANSA 1D04A 2FUG1 2YZGA 2WIGA 5BWBA 1TE2A 1EVIA 1QH1A 3ND9A 2B3DA 4ZCMA 1U9JA 3P2IA 1E5VA 1UP6A 3N0RA 2GHIA 4AJEA 1NTRA 1CDEA 5KTOA 1ZR4A 5F7OA 5HCIA 4RF5A 4REQB 4X97A 4LHVA 1IUNA 3UNXA 5CCDA 3C41J 3RYFB 1DKNA 1AMNA 1SQ0A 3MWJA 7ABPA 2WM3A 2QUJA 4G8DA 1W5SA 4YRSA 1FYXA 3SCZA 4NAUA 3GBVA 5C7IO 1YA4A 2CD7A 4QULA 5H02A 3UAXA 4F3RA 3K0SA 2DVMA 4JOBA 4P08A 4TWIA 4GKBA 5KMGB 2CHVA 4CM3A 1QP7A 2GCGA 1F6DA 2W0MA 2AHOA 4WN9A 5KOHB 1J2YA 2QL7A 4IMPA 3S70A 3FTNA 4XRGA 4HNQA 1U1FA 2IF2A 4QLOA 1BXKA 1ULZA 1P1BA 2ZPAA 3DCJA 3PJDA 4ILEA 4KYUA 4PLYA 4OB6A 5T3YA 3T99A 1WBDA 1F0NA 2VH2A 3UN1A 1BEEA 1F9EA 1II8B 4XJTA 2Q0HA 1CZHA 5CH3A 3KXIA 5JPCA 4HRXA 1I0ZA 4MUBA 1SBHA 3I32A 3O8OA 3EPHA 2D54A 1Z6ZA 5CVDA 3SLKA 4PF1A 4OI1A 1YJAA 4EY8A 1E1YA 2CMKA 1R6DA 3BFJA 3E8SA 5EZ6B 1A8SA 4O1MA 4CVNA 5BMOA 1W4CA 3EPRA 4DANA 3OP4A 3QPAA 3W05A 2DLCX 1C0IA 13PKA 3KTAA 1QG0A 5GJCA 3PUHA 3G1UA 4RH0A 2M2IA 4D97A 3VZSA 3L4JA 5FB3A 2JLXA 4KREA 4LOIA 4M9QA 5HRAA 3O2JA 3L8YA 2QQEA 4TZKA 2P5UA 4RACA 2GBLC 1HEYA 3FDZB 4MHOA 4CIBA 1KYWA 4QNNA 3HCOA 1KY4A 1V6AA 4BX9A 3BDIA 4L76A 4PGMA 1BDMA 5EIBD 3CG0A 3U7RA 4B4WA 4QHYA 2Q5FA 4D80A 4ETMA 2C2MA 1EM6A 1UAGA 1C5KA 4URWR 3AVPA 2VXYA 2QUHA 4B44A 2QTMA 1JSLA 2X7HA 3H1TA 3RFTA 3KE8A 3LY7A 3II6X 2YJGA 3SYTA 3FCOA 1JG2A 4NYJR 5EWMA 2GN1A 4IW3B 3B2NA 3GT7A 3PXBA 4GZLA 2ODBA 1OGYA 5DNDA 1IK6A 1U3GA 4QBHA 3VPSA 1R9MA 5L8VA 3OM1A 4NFLA 4D9JA 2I3GA 3ET4A 4ND2A 5FLEX 3F6EX 3E18A 4NE2A 1M1YB 3GI1A 3KVOA 2EQAA 4GXRA 1GP2A 4PYLA 1CZKA 4QG7A 3F97A 3SR0A 3I2JA 3TX2A 1DTEA 2WLTA 5I7HA 4H1VA 1AK1A 2J7PD 4RE6A 2PZKA 3H83A 4U3JB 4M88A 1J8FA 4H4CA 3EUWA 1MF7A 2BFDB 4HN2A 3ZWPA 1YJXA 1VIMA 3O8BA 4DIKA 2VHCA 4QT4A 2R48A 3CRZA 3IJEB 4E5YA 2CK3A 5KSYA 1A8PA 2AQIA 3R0IA 2UZ1A 1JB9A 2BZ1A 2MWMA 3WNBA 5C7LO 3RIXA 3LZDA 5TF4A 1PJLA 2AZXA 2QK4A 2BJHA 5E0OA 1ULBA 3Q8XB 5HWSA 3M89A 4QYTA 1MT0A 1FPMA 2WW8A 1P75A 4QGGA 5IW8A 4R9UC 5A5VA 3FG9A 2A0XA 3GPLA 1PJBA 4GG1A 4RPLA 5KQMA 2SHKA 4YACA 2GS9A 2EEZA 5BSFA 4LPSA 3CF6R 2QGZA 1G19A 1Z7EA 1WCV1 1XJQA 1YBHA 3D8NA 2IHUA 3H18A 3ETEA 3LDAA 5ERXA 3S8MA 2QP4A 1T6ZA 2J6IA 2PO5A 4ZYXA 4S1TA 1NRXA 1E3JA 2BFCA 3DCIA 3MG9A 1E63A 1J23A 4QUEA 2XAUA 1KFJB 4UPVA 4X44A 2C97A 4C01A 3DULA 2I4RA 3F4LA 2ODEA 1N3IA 3ITEA 1FSZA 4C03A 4WOBA 2OK7A 1D8AA 1BXGB 1E3QA 4G0YA 4A0HA 4FBLA 5AVKA 1CUZA 3G2JA 5AK5A 3QXSA 3FVVA 5KVQA 3ZDDA 4JR0A 4KFTA 1FRFS 2BMWA 2QTHA 3GJSA 1IL0A 2ANCA 4YAOA 2J9XB 4ZIRA 5KBYA 3PXGA 5A0TA 4XM1A 3JAKB 4L8YA 2VQ6A 1CZOA 3MJSA 4HCJA 2EX1A 3ZUPA 4BFXA 1V35A 5JSZB 1ATIA 2C5BA 1LI7A 3TQOA 2QB5A 1ZSVA 5AKEA 1LFDB 4ZI3A 1IOLA 2FWNA 3PKJA 3L7LA 3DDWA 3G89A 4ZV7A 1P31A 1OAKA 1F8UA 3NT2A 2DTXA 4YJ2F 3AETB 1H0SA 5AT1A 3WRXA 2OQVA 4DLAA 1TU0A 1OQAA 3I9V6 4BPRA 5HTOA 1Z73A 3ELUA 3UH0A 4BVLA 5AVWA 3CIFA 4AYTA 3VNUA 1JB1A 1KYTA 2ZAIA 5K8CA 2JIQA 5L4NA 3MRVA 2Q5JA 4V24A 5AUOB 3I12A 1I7QB 1TYCA 4A5SA 1C1DA 1X8JA 1SIUA 4KUGA 1XDDA 2BP7B 4FS8A 3VM6A 1T6YA 3WGLA 4IICA 3EDQA 4A2CA 2VBFA 1DDOA 2C2KA 2HLNA 4X91A 4AT1A 4BKUA 1I6KA 1H2XA 2B69A 3FCEA 1VLZA 4YDHB 1GU7A 5IAKA 3SHVA 1GQSA 3TL2A 4IQFA 5DTJA 3VPAA 2Q27A 2B36A 1HNXB 1OLOA 4QPPA 1X77A 4F2HA 5C3UA 1LZKA 1RTKA 4CL0A 4O4IF 1RLTA 3C7DB 3IT2A 3TINA 3U26A 4F5ZA 3UCEA 3KLOA 3NOOA 5HKAA 2WT4A 3E3NA 1HKUA 2CGEA 4DRXA 2GUWA 3PQ3A 2VJCA 4JSRA 1DMRA 4OMUA 3DO8A 4DW8A 3F3MA 1XP5A 3AVUA 2O7NA 2FK8A 3LQKA 4M36A 5C1OA 1P5FA 2GPTA 1TVKA 3HJUA 4XR9A 1J8DA 2QR3A 4F3NA 2HK9A 2P78A 3FUCA 2Z30A 2CNLA 1SELA 1GL6A 1NNSA 3IMEA 4OVKA 1FP7A 4H6WA 4RCVA 3EEOA 2QMHA 3MPUA 3OT4A 5DHSA 5K0GA 3QU7A 1VA4A 1T35A 5KNDH 2D6FA 2F8SA 1RXUA 3TLCA 4D0RA 1IHXA 3KHSA 4B4UA 5JQGA 2V58A 3WDMA 1AB5A 3EVCA 2VRNA 3TSYA 2PUFA 1PR3A 2XZPA 1CJBA 2QWXA 4ZTUB 3ZNPA 1IOVA 2JHCA 2GEBA 3OM9A 2WG1A 4P7KA 1MRSA 3ZLVA 3I3OA 2CNKA 1IB6A 1MX5A 1RXEA 3TJZA 1ZM9A 4ZEMA 1G7SA 2IFTA 4QOHA 4XSGA 1KPIA 1NW7A 1JT9A 3OEED 5TC4A 1YS9A 3U37A 1ZA1A 4A15A 1OXMA 1N5KA 1Q0QA 2HK7A 1TRHA 3S8EA 2GSDA 4DLUA 1RRPA 1RKXA 2NZXA 2XWQA 1TFUA 1ULHA 1U90A 2PBFA 4QWMA 3AIMA 4LDJA 4YC7A 5FI5A 3RSSA 3K9NA 5L3RA 3E03A 2CFIA 3WTCA 3KRTA 1IB0A 1NR5A 2VA8A 1RBZA 1B7GO 2XBLA 1FUEA 1HQYE 2HQ1A 4OMCA 1J0EA 5C1DA 3NJ4A 4QM6A 1WQ1R 2I2XB 1FC0A 4L5IA 2FZEA 4FZ3A 4JQCA 4ZXFA 4TS4A 4RPIA 4RQUA 1H42A 3PJEA 4U6SA 2A7XA 4RTSA 1R74A 3FYSA 4BU1A 2R79A 4GC5A 1N8TA 3KVYA 1SQFA 1XELA 5I47A 3ANMA 4BE4A 1HXHA 1M9NA 1VYUA 5THQA 4RHYA 4RJJA 3F9IA 5EUBA 4FWBA 3EQZA 4LGMA 1QTIA 2W4IA 4P58A 4BLQA 3NC4A 1YI1A 3ZD8A 3DH0A 2WFAA 4MS3B 2SECE 4AJ1A 1YB2A 1NZDA 1IRIA 1L6IA 1ONBA 3OBBA 4F8JA 3N2GB 3KXDA 5JAMA 1U0BB 4MX8A 4JGBA 3HK2A 1PE0A 2ZWIA 1ZIXA 3I5AA 4D9KA 3X1WA 2KX7A 1XRQA 4MS4A 1XJ0A 3KJGA 3BRCA 4AUEA 3HJBA 3MGCA 4LC0A 3I2HA 1ML3A 4NX2A 1U2DC 5AOCA 1NNUA 2PE5A 3M4JA 4DCMA 3S2YA 2GCOB 5K3OA 2VK2A 5DTEA 1DGQA 3U4IA 4HGYA 4R0MA 1TUBB 3CSDA 3QTLA 4XCQA 3TS1A 2ZM5A 4AKGA 2O6HA 4DV2B 4WW0A 3IPLA 2XTJA 1P6UA 3CCBA 3F8WA 2A35A 3V7YA 4ARBA 4EYGA 3MS7A 4ENTA 1V16A 1RR6A 2Z2YA 5IT4A 1LRJA 1J0DA 1E61A 3NJRA 3ROFA 4PPYA 2EJUA 4LBWA 4OXYA 1HWYA 2D1QA 2PX2A 4GL2A 3FM9A 1AKEA 3PR3A 4EKYA 2R86A 1DRJA 4S1OA 1W0KD 1Y6GA 3RVLA 2WF8A 3DO5A 3W0LB 4J6EA 1V95A 3RASA 1SURA 2DQZA 2XDYA 4MYRA 3VKGA 1T34A 4FT2A 2IYYA 1NN0A 1ZMXA 1B15A 2AQKA 4LE2A 1FX1A 5A6SB 5K1ZA 1JLHA 4RTRA 5ENDA 3RAFC 1UC9A 4Z1MD 3N2KB 4RPGA 4CI9A 1V9CA 3GCZA 4XEHA 3K6RA 4K8OA 3QLVC 2TECE 3W3AD 5HUQA 3U7HB 4KVZA 4MKHA 4PX5A 3OQNA 2O3QA 4G4JA 4KAAA 4U2FA 1ZD1A 2D3TA 1N36B 3PCTA 4B40A 4J1QA 3GP8A 4XVHA 5KYXA 4FD3A 3GT0A 5L3VA 1XLWA 4L85A 1TO6A 5ALPA 1NMEA 1FVHA 4H3KB 3OX2A 4LHSA 4ALMA 2YZ7A 3ESXA 3T34A 1W29A 4KDEA 2PKQO 4K9RA 4HVTA 4AICA 1WK8A 1VM6A 4JGGA 1PDWA 1QIJA 1UEJA 4BKPA 1Q3TA 1C9JA 2W22A 1HZJA 2HJHA 2JIMA 2Z56A 1KVRA 2HCBA 3DVAB 4RD3A 5C8YB 4IEIA 2VXCA 3WJ2A 2F59A 2I4NA 3T3PB 3A4IA 2WTBA 4JLMA 1VL8A 3Q40A 1TI7A 3IHKA 4JZYA 3L7JA 5ADHA 1XMPA 4HWTA 2RH4A 1FLNA 3T7SA 3QU2A 4QXAA 4Y98A 4UNPA 4RGVA 4A8PA 5BWNA 4E70A 3AEYA 1YIAA 3FWZA 3UT6A 3WLQA 4PR0A 1IJKA 2E85A 3PX2A 3RVMA 1NUSA 5LIPA 1P2VA 4DUGD 3JQGB 1CF4A 3N6XA 4MW2A 4M0FA 2BWJA 4Q21A 4ATNA 3AH8A 3HPRA 3VU9A 2WHPA 3DAFA 3VHXB 1A7UA 4PLZA 5DWQA 3D0QA 1MB9A 1HL3A 2NZUG 3VYSB 1K7XB 5IM5A 4ZMSA 2QX9A 5DNAA 1BO6A 4ISBA 4Y9UA 2XB4A 2DQ4A 1U8CB 5KTMA 5CXSA 4LECA 4MR8A 2X8JB 3U48A 4BNFA 5K8VA 2CHGA 4IOJA 3OLVA 1WLYA 4KWCA 3RS9A 3A8TA 5JZSA 3BCHA 4BNNA 1KE1A 1XO1A 2YY7A 2FN3A 4ODIA 2F1HA 2A3RA 2ZE5A 4NV0A 3L0CA 3IAAA 5EJIA 1Y3CE 3K70C 2QNRA 1DOZA 1JH8A 4TVOA 1EYZA 1T15A 1KZ4A 2QLLA 2CC2A 4YDRA 2PBRA 3KU1A 3LWZA 3Q2OA 1KYVA 4PNZA 4C7OA 1OR8A 5CT5A 2IUEA 3SKYA 1Y8ZA 5KOJA 1FTQA 5BN3A 3FWNA 3RIEA 2PR2A 1NQAO 3LBYA 4QDOA 1JHOA 4GZ6A 3BWMA 4KE6A 1VDZA 3L04A 3ONDA 4UUQA 1DAPA 1L5SA 1IRXA 5FR2A 4EVQA 3TZEA 1DJNA 1OIVA 1WB4A 3OZCA 5JO9A 3U81A 2PUEA 2RCYA 3G2PA 1UC4B 4F1JA 1F2TB 3KM0A 2RH5A 4UFNA 3NR2A 4ALJA 4XGNA 1TCVA 3K05A 3SE7A 5JI3E 5FFNA 1UJ5A 1OWNA 2Z2ZA 2XB2A 3LGAA 3DV0B 2DCMA 2ZXUA 2P9YA 2DPGA 2ZJZA 1NVVR 3ABIA 3STYA 3WIEA 2IQIA 5EZYB 2XT6A 4TWAA 4AIIA 1BVHA 2AQ8A 1KRXA 1NVMB 1U02A 4Q03A 2JFBA 4TVKA 4CL2A 1AJEA 3M3PA 2Q3JA 1Q44A 1P7PA 4O4LF 4FLFA 7MDHA 1LS6A 1P0QA 2ZKLA 3UJPA 3ZZUA 1OTYA 3VVMA 1TMKA 3BEDA 4HNTA 2VJAA 8LDHA 1E9RA 1QGUB 4ZKDA 2P6RA 2XECA 3JVVA 4H16A 2EKQA 1I80A 3KLPX 6GPBA 3O03A 2JAWA 2BL4A 1ZGZA 2JJYA 3IC5A 3IQWA 4FLEA 4REQA 1WNYA 4A8JC 3WI7A 4K40A 1MB2A 3K1AB 5EA2A 5FR1A 5I7FA 4X6UA 5L51A 3RYFA 5JAHA 3HLYA 1UF9A 3M4NA 4RDHA 3KQVA 2BSAA 1TT7A 3AONB 4E2WA 2ZWPA 3HWWA 1B16A 1D7AA 2NYAA 4YFVA 4NR0A 3C4QA 3FB4A 2WV9A 1C0LA 1Y3AA 4QXQA 4W82A 5KMGA 2XBUA 4B45A 4CQJA 1EHCA 1KJQA 2FWRA 3CW8X 5KOHA 2H4WA 3GVCA 3QWFA 3PI6A 4KXNA 3LUBA 4LJAA 3D6VA 4C07A 4DJFC 2ZRGA 4OX9B 1PX0A 2Q2OA 4R98A 1R5BA 2EWMA 4WX2B 2I4LA 1KJZA 2C0PA 2R6AA 5L3ZA 3UK2A 3UOAB 2GVZC 1HQDA 1CNFA 4CTNA 4A6XA 2WOJA 5EP2A 1RNLA 4UZEA 1NZFA 3U2QA 4CM9D 1II8A 1M66A 1R0ZA 1Z5NA 1XCLA 5FL7A 1IAQA 2VP3A 2XXBA 3LHKA 4L16A 4LF9B 4YP6A 2JD1A 1DEHA 1NBAA 2REQB 2GBFA 3Q6IA 1HFKA 2VBIA 2VQEB 3BD9A 3C2QA 1M33A 1VL6A 1A2BA 4K2AA 1LUAA 1T8PA 1I7NA 2IHZA 3UXHA 3V4FA 2VSFA 1KDOA 4FUTA 1N2GA 4L7QA 1JFTA 3SQXA 2P90A 1NI4B 3IOEA 4QQNA 3P5BA 4UBIA 4R5MA 2A9PA 3A36A 3PT5A 2ODTX 3K7EA 5MGBA 3DMPA 4OV6B 1VOTA 2M1ZA 3H9CA 3AWDA 3FDZA 2MMCA 2TMKA 2G8NA 3DWFA 3OE7A 3MZ0A 3O3OB 3T06B 2CLDX 4C4TA 3M6FA 3KFLA 1H1LB 5C7OO 1VYVA 2PIDA 3Q8KA 1GUBA 1CZLA 1A8UA 1JR4A 1UL1X 2FKAA 3IHTA 4KAJA 1TCAA 4KMMA 5D5HA 2Q4RA 1KYIA 2I1QA 2ZBQA 1Y5LA 1E2BA 1Q0ZA 4R2HA 1KU0A 1K8QA 2J09A 3N2YA 3EZYA 3ETLA 421PA 1NOKA 3E1KA 4KN8A 2K87A 1XDSA 5MGNA 1CZNA 1MQSA 2EWWA 2YUTA 4PHTA 3K9QO 4FE4A 1NW5A 3BTOA 3LM8A 1ENPA 1NSTA 1OX5A 1TAGA 2FPOA 4PYJA 2EYUA 1MQ8B 1ZW1A 1FB5A 1XVIA 3C3XA 3RJZA 4R01A 1JTVA 4OHXA 4DG9A 4ZI7B 3LLCA 4QDZA 2DYKA 3AIOA 1JA9A 1M1YA 2H2HA 3QLEA 4TRNA 3LF1A 3QIAA 4XASA 1JVNA 4UXJA 1SU7A 1GLNA 1X39A 3NWEA 1LTHR 1H6CA 3PYLA 4BNTA 5KQRA 3NTXA 2HCRA 3PYMA 1HT3A 4YP1A 2XYQA 4U3JA 1L7RA 2BFDA 1QB7A 1WNFA 1NKSA 3K09C 2WZBA 1EUZA 3AHHA 4GPBA 3L4KA 4TRRA 5JBIA 1H5NA 1MXHA 5DFAA 2ZJ0A 5DHUA 3OIGA 4KN9S 4JI1B 5I8WA 1BOOA 2J41A 4BVGA 1I3OA 3JZFA 3KFVA 3W90A 2A1TR 2Q3DA 3L6CA 3NHJA 3VR5H 5SY6A 3IKJA 1KSHA 2CLKB 1G291 3MT0A 3N7TA 4M9CA 4NDAA 3TNYA 4ZV9A 3UUEA 1E3LA 4IEFB 4WBSA 3IAEA 3VO2A 1JUDA 1RDFA 4PQRA 3VUFA 1JDUA 4C04A 4S12A 1Q1EA 3C6XA 3G23A 4IFIA 3H5AA 4LTDA 4CT0A 1OF1A 4GEGA 1FTSA 4E3ZA 4B6FA 4JROA 5FIUA 2E4YA 4N0MA 1IZ8A 3DQZA 4RHEA 1SBTA 3F5QA 3OICA 3K4QA 3LVFO 1OZFA 5B57C 5GPBA 2AC7A 2R7KA 2ZBDA 3FJOA 2DTDA 2ZIWB 3HBJA 2RSLA 4AJ2A 1CVIA 1LGYA 1N7JA 5F2KA 1XL1A 3IUJA 1BXGA 2D62A 1ZN8A 1QGDA 2BCGY 4BWVA 1NC1A 1ZVJA 1P60A 1XF9A 2EQBA 4EG5A 2WFMA 1DBIA 3PGJA 2YXPX 5LFAA 4GDFA 3R75A 2JFNA 1NQTA 1YD7A 2A1TS 2HMTA 3JAKA 3D9QX 2KB0A 3MFYA 1JF8A 2VDUE 2OE2A 3PENA 4TXMA 5TRTA 3AJ8A 3G0GA 1YUNA 4LXTA 4F1WA 2AYXA 1I5EA 1U0HC 1UOPA 4M98A 5JSZA 1QKKA 1MJGM 1OYOA 3G1TA 2YC2C 3W04A 4XLLA 5CYOA 3OY2A 2O2ZA 4J7UA 1AS3A 4S04A 3AETA 3SJBA 1AVTA 3OEYA 4BMXA 3JQFA 1Q6ZA 3OX1A 3FVWA 3TMAA 4N41A 3S2SA 1L5GB 1GGVA 3BFVA 2RHDA 2XA2A 3IKLA 2IHBA 1BDIA 1DQZA 3NBZC 1URPA 3WGGA 3ERCA 1WB5A 3BE8A 1RAEA 1O6BA 4R2JA 1IOZA 1RZRA 1EP9A 2IIVA 2PVSA 2P2SA 1XZFA 4LC1A 1DQSA 1OUMA 1WSBA 2GERA 2BP7A 3AQ4A 3EWIA 4G4SO 3U3OA 1J9GA 2GQ0A 1ZOOA 3IBTA 2BFAA 1W6UA 2Q5CA 1EK5A 4O0LA 3ZY3A 4UVIA 4HLQB 5HNKA 2YWGA 3P0HA 1SC1A 1AM4D 1KS9A 5TEWA 3CY6A 4JGIA 1SEPA 5L6MB 1YB5A 3QUBA 3H8SA 1M0EA 1GAQA 1RFGE 4KKVA 4WV3A 2HFJA 4OU4A 1VZ2A 2C54A 2OM6A 4N3GA 3H7AA 2Y1XA 5REQB 4NF2A 3ZHYA 2Q49A 2O52A 5AGRA 2ZWOA 4ZN6A 2Q0SA 4WZBE 1PK9A 1KDPA 4JC0A 4V0RA 5LVAA 4JI0B 1E89A 3TLKA 3H17A 1PUXA 3M6XA 4MDFA 3DMFA 2ONCA 5G40A 1AGXA 5EHGA 3L8GA 1EXVA 1PGNA 5I7OA 1Z0DA 1YOBA 5HS4A 2IHVA 1P8AA 1NI5A 1LQUA 3HVHA 4ENPA 5JNWA 4Y7CA 3BDVA 4ZP1A 3C85A 3N3BC 1SVWA 4OTZA 4DIBA 3IDFA 4Q19A 1NX6A 1IN1A 4QDUA 3RARA 2AYZA 1QF9A 1XYGA 1ZVKA 4IIFA 3TRHA 5E6SB 4MKZA 1W85A 3IVGA 3ED5A 4UOQA 1HV8A 1Z5PA 2LDXA 4TLCA 3S0JA 2WWWA 4WJLA 3KB6A 3TGPA 3GEMA 4IFTA 2IZ5A 1I7DA 1Z8HA 2IY8A 1NFFA 2HWWA 2PT5A 2Z0MA 3U1TA 3CG4A 3GEGA 2F4VB 4I4TF 2ZJ7A 2F1OA 3VMMA 2PRZA 4C5CA 4LZJA 3SEZA 3S29A 2GWHA 3TAHA 1PFGA 1ONPA 5LJIA 4YIHA 4ZC1A 3OLYA 3GNQA 1X1SA 3CMCO 3MOIA 2PFKA 3NU1A 3RYTC 2PKXA 2PAAA 1QVZA 3CZ5A 4LZNA 2VHQA 1YVRA 3H87A 4RMJA 4C0SA 4YRBA 4YV0A 2X0JA 2OBMA 2ZTMA 1WB6A 3BPSA 4A36A 3WA6A 2WV7A 2XHZA 3NHYA 3PWZA 2JAQA 2GM5A 5IAAA 3EY4A 2VQFB 1LLQA 4JT8A 4FFWA 5SZIA 1BNCA 1C2TA 2VP6A 4Z8YA 1C2YA 1C8BA 1G5HA 3HEBA 5KKAA 2FEMA 3KQTA 2OO3A 1KKMA 3WWYA 3PHLA 2QV0A 5SYMA 4AG6A 3IXMA 2CL6X 3IHWA 1R2QA 1WPGA 3HZHA 1NWHA 4LY3A 5AVXA 4K48A 3WADA 4X7PA 2AV6A 2VPTA 5KINB 2DLNA 2R7LA 1CJKC 4QOIA 2P9JA 4P4UA 5H83A 2IYQA 1NLZA 1U7WA 3WMXA 1F60A 4OA8A 4I66A 5IRCD 4ZZ2A 2H4FA 2GKSA 3DE0X 2VHZA 1BE6A 1XF1A 4JH0A 3KJQA 1Z2OX 1X0XA 1O94D 4MS3A 5KOYA 2RGUA 3AHEA 4DV1B 4GOLD 1YU6A 3EIWA 3NKLA 1Y4UA 4D8VA 4RF4A 3N2GA 3NBYC 3FCYA 5M5BA 3PQDA 4P54A 1J8YF 1GL3A 1WW2A 4QDKA 2ZK7A 5C8YF 4F4JA 1ORTA 1KP9A 5BSMA 3F74A 1CUXA 5H9VA 4JUBA 1S9DA 3QWBA 5F33A 3KCQA 2IYWA 4H2DA 3RHSA 2FWAA 2UYHA 2CXSA 2GCOA 2ZSKA 1SUFA 4X1KB 5IK2D 3SHOA 1TUBA 2RG7A 3A27A 5AJUA 1M74A 4Q3DA 1WXXA 4A8HA 3FCUB 5CB8A 2GN4A 4GGMX 3C7AA 1REQB 3GHHA 1Z4QA 4U7GA 3RVPA 4RUKA 1L4KA 1WKVA 1T9AA 3B1XA 4W1SA 3VR5D 3VSEA 2J3EA 4EELA 3JPYA 4EGQA 3RK1A 1JLSA 3B1ZA 4XVCA 1N1GA 2Y1CA 4Z2AA 5A62A 3HXOA 3P8ZA 3BN3A 1WPXA 3IALA 3QU4A 1Z4IA 3KS9A 1ZPDA 2UXBB 4NS1A 4JCOA 2B25A 4TTQA 1W0CA 1X14A 3K0CA 4QQ8A 3V8BA 1WMBA 2X58A 3O1IC 4XGKA 1GCGA 1NVKA 4OAOA 1E2PA 2NO0A 5A6SA 2BH9A 1UBFA 1Z2EA 2IYEA 3FJYA 3N2KA 5CDSA 1SIOA 4RSMA 3BGSA 4TKLA 3P71T 5F7XA 1IE3A 1P2TA 4LV8B 2WY2D 2WABA 2OLKA 3E27A 5FUQA 4ESEA 1Q2UA 4V0LA 1TF7A 3MNFA 3R6LA 4XWAA 1B8VA 4HEHA 5IMBA 5MFZA 3OZVA 4TMFA 2E89A 2ZYTX 4Z4GA 3O3MB 4B3DA 1N2IA 3MAJA 4KVAA 3ZHSA 2IZ6A 3AKYA 4GP9A 2DBZA 4N39A 4FNMA 5JXJA 3WQBA 1O6ZA 2NUPB 4N03A 4BLSA 2JKVA 4DSOA 1XSEA 3NAZA 4GE3A 1FQOA 3HZOA 3AVQA 1UBLS 3CGGA 3DVAA 1MD9A 4RVCA 5EE9A 1YU9A 5C8YA 1OXTA 3RS4A 5IDXA 1D6MA 2EP8A 3A1WA 2WWTA 3EC1A 4YCJA 5D3ZA 5K3CA 1H9AA 3ZIDA 1QGED 1OW3B 5F78A 1JR3E 1J1IA 3INTA 1IWPB 1F8GA 1P9NA 1U5CA 2GH1A 2J32A 4L5JA 4W99A 5IJ9B 3A4VA 5D3QA 1UBMS 2VYCA 5AIAA 5BWCA 5B3LA 1WZIA 2GZDA 4GZ5A 2E5LB 2FW6A 1ODLA 3E5HA 4X66B 2DXIA 3E61A 4FYWA 2G63A 4JJEA 2HJVA 1YB6A 1AKQA 3QVGB 3JQAB 4M7RA 2XEXA 3ZW7A 3JQGA