1WKBA

Crystal structure of leucyl-trna synthetase from the archaeon pyrococcus horikoshii reveals a novel editing domain orientation
Total Genus 282
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
282
sequence length
807
structure length
791
Chain Sequence
LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Leucyl-tRNA synthetase
publication title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 282
structure length 791
sequence length 807
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 1wkbA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1wkbA01
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wkbA02
2VTBA 1GPMA 3LOQA 1U7XA 4ZT2A 2CUZA 1EFVB 5KHAA 2QJTA 1WXGA 3TQOA 3M5WA 1GN8A 3FDXA 2JA2A 4AS1A 2OQ2A 4Q16A 3CVVA 3N05A 1OWOA 4X0EA 1K92A 3ZXIA 5DK4A 4I6EA 2CV1A 4WNYA 2WFEA 3MLBA 3FHJA 1UFVA 1F4LA 4MUNA 1OD6A 5TS2A 3ZJTA 5AGJA 1N3LA 1PFVA 3DPIA 3H97A 1MC1A 2YXNA 4MLPA 1M1ZA 3E27A 3AL0C 4KKVA 3IH5A 1IQ0A 1GAXA 2PZAA 4MW2A 3CLSC 1TFUA 3PNYA 3S3TA 5FO0A 1O0BA 2QUIA 4MWBA 4NAHA 4U63A 2YWCA 1MRZA 3NBAA 3UY4A 3HL4A 1R6UA 2QUHA 3ND5A 4R2LA 5AGRA 1M83A 1KQNA 1J1ZA 4EG3A 1N2HA 2X3FA 3PZ6A 2V0CA 3KFLA 5J5AA 2QJOA 4GU5A 2AJHA 2DXIA 3IOBA 1M8FA 1NSYA 2ZUEA 1VBNA 3O0AA 1D2RA 2IELA 1K4KA 3RK0A 3IDFA 3SDBA 3VRHA 4PY2A 4E1AA 1WK8A 4EG5A 3DLAA 1JILA 1I6KA 1OBHA 2AJGA 1O97C 1QNFA 3KT6A 1H3FA 3Q10A 4G5YA 4J75A 1J1UA 1MJHA 3QTBA 4GRIA 1O96A 4RUKA 1VBKA 2XRZA 4U8HA 3AIIA 3U1VA 3K32A 1NUUA 2AKEA 3D6UA 4U7JA 4ZT3A 1JHDA 1IQUA 5TEWA 5KCMA 4MWDA 1PG2A 4J76A 4MW1A 4YP6A 3RBAA 1N1DA 2GOYA 4HJXA 2PZBA 3A4IA 5LM3A 1H3EA 1MAUA 1TQ8A 3INNA 4G6ZA 1KQPA 2C5SA 4ARCA 1JIKA 3COYA 3IMCA 1IRXA 1KR2A 4L2IA 1WQ4A 5IJXA 1KQOA 3X1JA 1G8HA 2TS1A 3MLAA 1EE1A 2A1TR 3PXUA 1T9GR 1PG0A 1GLNA 4MUEA 1TEZA 1NURA 2CYCA 2H2AA 4EG1A 1ZH6A 2J09A 3GLVA 2HMAA 3IVGA 4ND6A 1F9AA 1U3CA 4ND7A 3ISJA 1TYCA 1X8XA 1T6YA 2PG3A 4MW4A 4K47A 1JMVA 2YWBA 3RK1A 1O6BA 5HUJA 1VLHA 3IVXA 3KT8A 4YBRA 3ZIUA 3LE8A 4NDAA 1F7UA 2OV4A 3FY4A 1JEDA 4ZCPA 3NBKA 1KAMA 5EKDA 2NZ2A 2DEUA 4MVYA 1EFVA 3CVWA 2J07A 1WXEA 3A04A 1IQRA 2B7LA 2AJIA 2R5WA 2O8VA 3P0HA 4EG6A 3IOEA 3X1MA 2DR2A 1N2JA 3H05A 1HYBA 4I6GA 1X6VA 3JXEA 4P2BA 4MWCA 1VL2A 1O0CA 4EGAA 4MUHA 4RPIA 2A1TS 3CVUA 1T9GS 4NX2A 4KR9A 4XFJA 4PBRA 2A1UB 1OBCA 4I6JA 4DJAA 1WXIA 3P0JA 1FYDA 2CSXA 3VU8A 3KT0A 2D5BA 2QUKA 1N2IA 2CYBA 2CV2A 1N78A 3UOWA 5KWVA 1RQGA 1O94D 1OWPA 1WKAA 2BTEA 3ZGZA 5J58A 1YIAA 1MOPA 2VTBB 3IOCA 1WY5A 1H3NA 1QRSA 4DE5A 2AG6A 2PFSA 4EG4A 2A86A 3SZGA 1Y42X 3SEQA 1QJCA 5K0SA 1U7DA 1LI5A 2IJGX 1EJ2A 1GZUA 1IHOA 3CLUD 3MMXA 3H9CA 3HMQA 1TYBE 1WJGA 3CA8A 3ELBA 4XSVA 3AG6A 4CDMA 3QTTA 1MBZA 3SP1A 1YI8A 1J20A 2WSIA 4MUFA 1O5TA 2O5RA 3FG9A 4MULA 3SZ3A 1Q15A 3G6KA 2WQ7A 1XNHA 1PFWA 4MW6A 1H1TA 2EJCA 4OJMX 2WFDA 1CT9A 1XNGA 1M8JA 4MAFA 1FFYA 5H16A 3CLRD 3N8HA 4EG8A 3ZJVA 4ZT5A 3H99A 1KH2A 3COZA 2E18A 3ND7A 3G5AA 1XJQA 4MW9A 1IVSA 1KORA 1EFPB 1G8FA 4K48A 1I6LA 4JZYA 4NATA 4MW0A 3SEZA 1R6XA 2CV0A 4MW7A 1QU3A 3OTWA 1J21A 3Q4GA 4G5FA 3NV7A 4HJRA 4MUKA 3IMGA 5H7XA 1MAWA 4S1OA 4KPUA 4KR6A 1OWMA 3MUEA 3CVYA 1WXFA 3BL5A 5DEOA 3TQIA 5JBNA 1V8FA 5F23A 1O94C 2ZUFA 2PZ8A 3UC5A 3FH0A 3AG5A 2VXOA 4NAUA 2A7XA 4DDKA 2DETA 2QTRA 1WQ3A 2IP1A 5FNZA 1QU2A 2WFGA 5HUHA 2HGZA 1I6MA 1Q19A 2E89A 1KP2A 2PIDA 1GTRA 2J08A 3PRHA 3CLUC 2HZ7A 1UE0A 3DO8A 3DV2A 1M8KA 4JYZA 4EFKA 1N2OA 3G59A 4DDHA 2GKSA 1K97A 1MB9A 1IFXA 1YULA 4R2MA 4EF6A 4L2IB 1QRTA 1JEEA 3KT3A 1GTSA 3GMIA 4ZT7A 1F7VA 1XNJA 1ILEA 3P0IA 1EUYA 2X1LA 3ZJUA 1YIDA 2A1UA 1R6TA 4OUDB 1UDZA 2PXHA 2Z08A 1KP3A 1KAQA 1NYLA 4QBTA 3HFJA 3ND6A 4F4HA 4ZCRA 4F3RA 1YUNA 1QQTA 1U3DA 1Q77A 3CLTD 2I1LA 3IVCA 3K9WA 1QTQA 1G8GA 2X1MA 2V0GA 5IHXA 2E0IA 4XFDA 3TNJA 1NUPA 1T6XA 3X1KA 5FO1A 4JXZA 4WSOA 3IUEA 1WNZA 2CFOA 2J5BA 4UZFA 1WKBA 3LCJA 2JAXA 1NUSA 4MVXA 1M8PA 4YP7A 2G36A 4ZCSA 3PNBA 4R0NA 3GUZA 2A84A 2DUMA 3CVXA 1NZJA 4AQ7A 5J59A 3Q12A 3A2KA 1TYAE 1OWLA 5DB4A 3AKZA 2RD2A 1EUQA 3FETA 2X0KA 2A88A 1M8GA 2A4MA 1N2EA 1N2BA 3L93A 4ZT4A 2RE8A 4FZJA 4A91A 1NUTA 4CT0A 2AZXA 3HZRA 2JANA 3ILVA 1N77A 1G59A 1JIJA 1JZSA 2BYTA 5DASA 4CQNA 3QE4A 4UZEA 4MUGA 3TZEA 3FOCA 1B6TA 2GM3A 1SURA 1EFPA 1O95D 3RHSA 1JGTA 5TGTA 3HV0A 4K03A 3FIUA 4QREA 1NUQA 2EL7A 1OWNA 1K4MA 1ZH0A 1Q11A 1YUMA 4ZCQA 1KKUA 4MUJA 2QUJA 4MWEA 3D6VA 1NP7A 1V47A 3COVA 1COZA 3F3MA 1WXHA 2D54A 3ZXSA 4DNXA 2WB2A 2DPLA 4KR7A 3CLTC 3PNVA 4TS1A 4JXXA 1LW7A 2CYAA 2E21A 3RJZA 3HGMA 4JFAA 1WOYA 1DNPA 3PZ5A 4ARIA 3N9IA 1P7PA 2QJFA 1WNYA 4DLPA 1JZQA 1KH1A 3FI0A 3I05A 4HPWA 4BWVA 1WZ2A 2YY5A 4MVWA 1BS2A 1T6ZA 2D13A 1VBMA 2QTNA 4CDNA 1EXDA 1PFYA 5LFAA 1O96B 3FWKA 3AFHA 3UMVA 5AGSA 1IH8A 3H9BA 3CR8A 1ZUNA 4Q93A 1ZJWA 5AGHA 4DDMA 3N2YA 4MW5A 4K0RA 5AHWA 4QRDA 3FNRA 3SYTA 1JIIA 3OP1A 3TZLA 1A8HA 5BNZA 3CLSD 3MXTA 3ZUGA 1JECA 5HG0A 2NSYA 1ULHA 3IODA 2CT8A 2DERA 1LI7A 1J70A 4PBTA 2WQ6A 1S4MA 1TYDE 1NI5A 3C8ZA 2Z3VA 3COWA 3IMEA 4MVCA 3PZ0A 4ZCTA 4HK4A 2H29A 4KPUB 4OUDA 1N2GA 4MQ6A 3VGJA 2J4DA 4PBSA 3IUBA 2QTMA 1KH3A 3L92A 1U0BB 1J09A 5AGTA 4NZPA 1QRUA 2DLCX 1MB2A 4MUIA 4YMIA 1O95C 1N75A 4ZT6A 5K0TA 3UK2A 3CLRC 2ZP1A 2XRYA 1I2DA 1PFUA 5LLTA 5AGIA 3RFFA 3A05A 4H3SA 1O97D 1WK9A 3TS1A 5TEVA 4YP5A 2Z09A 4EG7A 3P52A
chains in the Genus database with same CATH superfamily
4IY1A 4I9UA 1YI1A 3WA6A 5BV7A 4K88A 5IJ0A 2WVHA 3F5MA 2KBFA 3DOEA 1TF7A 3LUDA 4JJ4A 3F78A 3RODA 1UT8A 2QRLA 2JA2A 2PUJA 4L7QA 1WM1A 1QDEA 1XUOA 2ZJ3A 3ABIA 4ZEOA 3ZOZA 4Q1BA 1B3RA 2V7TA 1LA2A 4FDTA 4OP3A 4Y2UA 2EBHX 3ZXIA 4I6EA 2XODA 4JT9A 1X15A 1O9GA 1ZD8A 2JLYA 2XUFA 3MLBA 2ZXFA 2I03A 2O0LA 2YRXA 3P26A 4PCLA 4YB8A 1JNYA 1XDZA 1Y4UA 4YC7A 2WM8A 3CUUA 3GT7A 4HXEB 4JWTA 4QGSA 3K8OE 3FWNA 1AXEA 1GUDA 3KM0A 4MLPA 4UATA 2C78A 5DGHA 1BQ4A 2XUJA 2YL2A 3TUIC 2OCPA 1AUQA 1GTJ1 2F9MA 3WGJA 1DRKA 1SVLA 2L19A 3IH5A 4Q9DA 1XCPA 4J0JA 4U2BA 4UXJA 4Y2GA 5FO0A 2IYVA 3PUKA 3QE0A 3T4XA 3TZHA 2D0OB 1MRNA 2J7PD 3Q0IA 4EMBA 1R0LA 1JQEA 1F4VA 5C5CA 5THXA 4ZI5A 2HHCA 4ER3A 1QQ5A 2HRZA 3INTA 1SVOA 2BAGA 5JI2E 3TE7A 5EIXA 3ENVA 2GBGA 3RU3A 1ISHA 1PHPA 1T24A 1Z7EA 2Q1TA 3GWGA 4ACBA 3CKKA 5LD2B 4ZU3A 1ZIYA 4O4LB 4DA4A 1WXDA 1YB7A 3AJ8A 4JT8A 1WB5A 2G17A 4QU0A 2CJFA 2H2IA 4LYJA 1NSYA 2BE7A 3QMWA 4A0RA 2P4QA 1W93A 4QWMA 1CY0A 4LKRA 3LBAA 5JH7A 1QV9A 3BGOS 4JP5A 5JAIA 3SXUA 3D6TB 4QHYA 5FFFA 1G2QA 3BRWA 3E23A 5IK2A 3R3JA 1M2EA 3PF8A 1NNEA 4U6QA 5FUYA 2H6EA 1RXSA 2ZI5A 1OX4B 3DLAA 1IIBA 4TMYA 3UATA 2YFKA 2ZSUA 4ZV9A 4EHLA 4LC0A 1WS6A 3DGEC 4G4IA 2MSWA 5J2TA 3TBHA 3LYAA 1CWUA 1GA6A 3ET4A 4INOA 5MGBA 4GRIA 3BEOA 5FUQA 2XDYA 4OM8A 3C3DA 2WG0A 1SVNA 1B8NA 4CYMA 4Z7JA 3D31A 1IYZA 1N4AA 4PG8A 1XJWA 1UMCA 4KHZA 4UAJA 4YRTA 2QGFA 3MOSA 4G8BA 4ZWNA 1W8IA 4O4LF 1PL8A 3OWHA 2R6JA 3EC7A 3EXFB 4HXFB 5A4JA 1ZQ1A 1ID8A 2JIZD 1AUVA 3VZDA 5DI3B 1YOVA 1WULS 3CRVA 1IUPA 1F0YA 4PO8A 2I8CA 2Q1SA 2Q3DA 3D4PA 3EGEA 3KQSA 4OM7A 1P0IA 4R1NA 3E7PA 3EVNA 1BJKA 1IUKA 1MGPA 1ORIA 1F12A 1PQYA 2P6MA 3TNYA 3SSOA 3VZRA 1AHNA 3SNHA 3U19A 3EZNA 3CIFA 2KJQA 1RC8A 3UJ6A 4E5KA 4KZPA 2VUHB 2FFQA 3OU7A 1NT2A 2VWGA 5AOCA 3BRQA 4O33A 3F0TA 1VHJA 4LRQA 4CHTA 5BV8A 4AT1A 5C5DA 3KQLA 5A0FA 1NIPA 3PXUA 3HYLA 3C48A 4MRSA 1I1OA 3WQSB 1KS2A 3DFFA 4WZAA 1ZH6A 5EHQA 4WECA 1M1NA 4PN3A 2KSQA 4TRNA 5DGIA 1ZNZA 4L4ZA 2PD4A 2GWRA 4RF5A 1YDHA 4RZHA 2VHVA 2BHRA 2C03A 3V2IA 1HDIA 2XQKA 5B57C 4HC4A 3EGWA 4QZVA 1AKEA 3AKYA 3I2YX 3Q3VA 3V8EA 1JYFA 4WQMA 4ETMA 5LQKA 1W30A 1LPNA 3N39C 4MRPA 4RNDB 2ETVA 1XWIA 1N5JA 1GDDA 2BFEB 4HEA6 1BEUB 1VQ1A 5BXQC 4Z6KA 2DKFA 3K2EA 3IPLA 4R7GA 5GOZA 3GJ6A 2TMDA 3T06B 5AK5A 3CMCO 3CNOA 5LWQA 2RI6A 1K88A 1KTIA 4RIEA 1QC5B 1Z74A 2XTNA 2VJAA 3L2OB 3QFHA 1LJUA 2H3EA 2W0MA 4KQJA 3SHWA 4BJ3A 1QX3A 1KDOA 3EIHA 1JWLA 1B42A 1EP3B 3GAZA 4MS3A 3PHLA 4RY0A 1OX6A 3IUYA 4I6GA 4O25A 1SUCA 5DNAA 4P2BA 5LIRA 2ODWA 2BD0A 1IXZA 2RONA 3HWRA 1D4FA 3DR5A 2C4UA 4WZBB 1I2ZA 1KAEA 5CLQA 1T2AA 4YT4A 1M66A 3CVUA 1MX1A 2Q99A 3A9SA 4YI5A 1JRLA 1U8ZA 2IY8A 2VXYA 3ND9A 4NWIA 4MO9A 1F4PA 3EJ6A 1S1MA 1IWPB 2C8JA 2GUGA 2UKDA 2ZBPA 3QY9A 3WRVA 2IWHA 1YQTA 4DJAA 1CUZA 2MSEB 3U4AA 3GRPA 2P2LA 3CSSA 1KPIA 4KO1S 1GKIA 1UBGA 3WGVA 3CM0A 3B3JA 3E6AA 2WNIA 3BMNA 1PBNA 1W46A 5ESWA 1JSCA 1UAYA 3A9UA 3D6JA 1WF6A 3CVJA 3IDOA 3EMVA 2HQRA 5EE5B 4E5NA 4BNTA 5FOQA 3N59A 1X42A 4FHDA 2NZWA 1BA2A 4AZ3B 2ORED 4RFSA 3V1MA 2VCYA 1PAUA 5IAJA 5JEEA 5K8LA 3GLFA 1XD8A 2YYZA 2FG5A 4BMPB 4JLNA 5IT4A 1A5TA 4JNKA 4XUEA 1HDOA 2PMKA 1X3SA 3GN2A 1YD7A 3KPWA 2AQIA 3SQWA 1K3UB 1JXMA 3AETA 2ZSDA 3B3FA 1XCJA 3FW1A 4AUNA 1X1QA 2BFAA 3IULA 2GRJA 2QAGB 1RLTA 1GG2A 3JYQA 4NBSA 2IJGX 2ZI9A 4WOPA 4XIIA 1Q20A 1UDAA 2AR0A 5D6OA 1UC9A 1NBIA 1TM5E 3HMQA 3W79A 1LFDB 3FR7A 4OHPA 1G8SA 1RRKA 4AX8A 4G0VA 2XJ4A 2X4LA 2ZYTX 1E6MA 3ICVA 2WTXA 5FWAA 1DBVO 4LK2A 4Z1OA 3MWKA 1EPUA 3M2TA 2ZJ5A 5K0ZA 3D8RA 3QTTA 4BLRA 1S2GA 1M2VA 2Y1LA 3NYWA 5CVEA 4GLBA 1L7PA 1F60A 1XF1A 2P9QA 3N2ZB 4FKMA 3FNFA 1FNNA 3SZ3A 1Q15A 3H19A 1UDBA 4M0MA 3WP0A 5L4NA 2R8EA 4XYBA 5FTWA 1P7WA 4MJLA 4OQYA 2OVFA 4IOLA 4X65B 1SWWA 1GD1O 4A8PA 4GOXA 1DDOA 2W6JA 4CM4B 2ODQA 1ULUA 2I3ZA 3FTEA 1ULSA 3S55A 2PU5A 3IDQA 4OY3A 2VYVD 3BHMA 1D9ZA 2DFVA 3WGIA 5B7NA 2CXPA 3R0QA 2XUAA 3COZA 1OROA 1BXGA 3UICA 2YBEA 1Y5NA 3VC1A 3VVBA 2JI9A 4BRZA 1DWUA 5LZ4A 2WPDD 4NG5A 1XJQA 3ASVA 5EIAA 2JBHA 4URVR 5JWRA 5CGQB 4MTLA 4D4JA 2A0UA 1CZUA 4JYCA 1DE0A 2C84A 4JVSB 4NZMA 3FWHA 3G17A 2ZJ0A 2X2FA 3UUEA 4AYXA 4CN8A 3FYHA 1DAKA 2ZRDA 5LNK6 4I50A 1FRZA 1OMOA 1QU3A 1DIGA 2X7JA 1BE6A 4AKIA 4K46A 3T1YB 4CTMA 3IMGA 5H7XA 4GR4A 3EZ9A 1XTVA 1O5IA 2B5VA 3I28A 3ZHXA 4FTWA 2VYNA 2OHOA 3PBKA 1M72A 1M2GA 1I3KA 1ORDA 1P4HA 3PC6A 4QBFA 4AJIA 3ONVA 1L5NA 1AKTA 3DCYA 3PPIA 1FNSA 3ZU5A 4HH1A 3F90A 1O94C 3IQGX 5EQFA 3WKDA 1RYEA 5L95A 3ZHBA 2QVZX 1WMEA 5SV2A 2ZBUA 2Q8PA 3A26A 3DKPA 3AUXA 1ZIDA 1XRPA 4D99A 5KMGA 5F33A 5IEJA 1U0NA 3CH5A 1XQWA 3GGSA 4CR6A 3DMPA 3E8SA 4I9FA 2JAHA 3PUXA 1Q0UA 2JZNA 3QELB 4PN7A 2QD1A 2E4AA 1C3LA 5G4LA 1H8ED 4J0QA 2FW1A 2ASEA 1Z5NA 3DFUA 3I09A 3H42B 2P6RA 2G8NA 2PBFA 2XYRA 3NHZA 3R3YA 4R3WA 4HAZA 3FPAA 1K97A 1GYRA 1PSWA 2NSLA 3CUKA 2Y1EA 4Q3EA 5B58T 5HUQA 3O2NA 4K6MA 1JKMA 1YQDA 1OGJA 4RGBA 4GX1A 1GTSA 4ZT7A 2FB9A 1E1YA 5IJ9A 1ILEA 3P97A 2PKQP 2XGMA 3P0IA 2Q5EA 1GG9A 4RXUA 1TNDA 1OXMA 3QSGA 2JL1A 2BCJQ 1EUYA 5HYVA 1FQJA 1U0LA 4E09A 1YDFA 3AUAA 3IMFA 2PLRA 2R8YA 3L41A 3LHFA 4F71A 4V0NA 4IOJA 4XGRA 1QH8B 3H3JA 3IO5A 3SFTA 1TK9A 3H65A 3ZZNA 2G3YA 3ZN2A 1E20A 3G7SA 4G5GA 6ABPA 1F2DA 5ALYA 1YZGA 2V5VA 4RD0A 2OV2A 4QT0A 3TNLA 4CVNA 1BCSA 1R0SA 2WR8A 5FOUA 5A4DA 2F4VB 1THGA 3MGAA 3ZGXA 2EQ5A 3IVCA 5U9CA 1PT5A 1W36D 4UXHA 1XC7A 1H2EA 1QTQA 3DKRA 2SKEA 3HY4A 2ZBFA 2X7XA 2CXXA 1E2PA 2R6ZA 3MB5A 4X84A 2AI2A 4ALNA 2BL4A 4L9SA 4FCVA 1G55A 1WKVA 1XZNA 3CRNA 4R7TA 3AEKB 3EYAA 4QYIB 1NM5A 2ID9A 2X41A 3E53A 3AR6A 2YW2A 3ILYA 1MOQA 1SOWA 4HAIA 3UT5A 1MO6A 3OU6A 5G02A 2C3OA 3HSKA 5CHEA 3I83A 1D04A 3I6ZA 1QAOA 1S0UA 1S3FA 1QO9A 2HJ9A 3LF2A 4MCHA 4ETIA 5FR2A 4MQ5A 4KV7A 2Q4DA 4PZPA 1GWNA 1D1SA 1RRMA 2G36A 4NFSA 3PNBA 5AIAA 5IJ0B 4CR8A 3IESA 4FKZA 3UMFA 1OXXK 4YT5A 4K6KA 1KY2A 1NA5A 2O2XA 2BE9A 3KLOA 5BWCA 2LKDA 3ZVNA 2UYQA 3ZWWA 5DB4A 3Q7IA 3R6LA 3NHKA 4CRWB 1XNRB 3GH3A 1IU9A 2RFLA 1LDEA 4NZ9A 4DGSA 3DVSX 1ZMRA 5TJHA 1M8GA 1LDYA 3TVDA 3VXKA 4RTOA 2OA0A 2XOXA 2PVPA 5EJ6A 2HCJB 1N9GA 4Y6LA 3QBJA 1I7QB 2J0UA 5H83A 4MWOA 1GU7A 1U6JA 1M2FA 2NUPA 4GICA 3AJDA 2ID7A 2ZRIA 1LV8A 2ISSD 3AZQA 3QE4A 1EXWA 1O6ZA 1VL0A 1PNTA 1WDLA 4XDHA 3T7AA 4BAZA 3AI3A 4L8WB 1QYRA 5DX0A 3PWTA 2AG0A 4Y2PA 2VOJA 1T0UA 1LBIA 1U0FA 2ISCA 3N2KB 4FE7A 4AXBA 1DKRA 3DE1X 2HPHA 2P41A 3NRBA 3E7DA 2JEOA 4YQYA 4MQFB 1ZJ5A 2NADA 1ZH8A 4B76A 3MT7A 4A36A 1VE9A 3Q11A 1Q0SA 2QN1A 1XA3A 2BEUA 1B16A 3NT4A 3QNUA 5LBUA 3P9QA 3AOEC 2YMQA 3U40A 1HY3A 2FR0A 4IWYA 3PZBA 4QWWA 5FUWA 1D1TA 2HWYA 3GA0A 3D02A 4B34A 5P8WA 2E2WA 1MHPA 1UBSB 1JSZA 1OZGA 1PL6A 3PHCA 1PR0A 3OHSX 4Z4GA 1FNDA 4WH0A 1LLCA 1O94A 3TBKA 4D9GA 1XV5A 3KV3O 2JEZA 5JH7B 3L5KA 1C8VB 2YTZA 4RZUA 2ZKIA 4C89A 3SXUB 3QBDA 2ZWIA 2WP8J 4LZWA 3SDSA 2C61A 1FXSA 3BMOB 4MCIA 2WY2D 3SJCA 3TQTA 4B9EA 1RBYA 1CEQA 5FTLA 3TLGB 4KQFA 4G0XA 3AZOA 5JJIA 3E84A 5CXQA 3MJRA 4ERXA 4CDNA 1OFHA 5J2TB 1UBMS 2RGNA 2J3EA 3WP1B 4MDFA 2A0XA 3OZEA 4YMSA 3HRKA 2OD7A 3QF4A 4LV6A 3D3WB 2AUTA 3L02A 2MSNA 2XH8A 4TLDA 2E49A 5IZ4A 2RHGB 4P92A 1XOIA 4XJVA 1MAVA 4JA0A 1UMCB 4D7AA 5EI5A 4QRDA 2ERCA 1V43A 2GASA 2YQ4A 3H3XA 4NCIA 3WL4A 3VZSA 1Z4JA 1LBQA 4JBXA 4BMCA 1XT6A 3AR4A 4DNPA 3WRYA 1Z35A 1L4GA 4RLFA 1KPGA 2XDQB 2W5UA 5LA6A 2HADA 3ADDA 1XJCA 2X0IA 3DOFA 4RSRA 1P91A 5KQMA 1EFCA 4HAOA 1SY7A 4BVGA 3QSYA 1QDLB 1ECFA 4EA7A 5KDOA 3SHOA 1J90A 3JQ9C 4F97A 1DEAA 1I7PA 1WUJS 1NP3A 2WKPA 4BFTA 2G71A 5JNVA 2ZYHA 3U7QA 3ZUPA 5CFOA 1JJVA 1Q7GA 3GNQA 5JPDA 1S4QA 1Z5GA 1BKSB 1TIBA 4RELA 2WFMA 2FSSA 1C4WA 1GR0A 3I0NA 2XWQA 4WZAB 4AICA 4RTMA 1RZRD 4DREA 3GT4A 3UXHA 4DQVA 2C97A 2FN8A 2WLSA 1WTAA 4JA2A 4UVHA 4ZYTA 4FZ5A 2W8BA 1HPLA 3IKMB 1SHTX 1ZWKA 3I3OA 1C4XA 4X3PA 3V1NA 1PFUA 1XU7A 1XN4A 2AJCA 1C0IA 2B34A 3C1UA 1O8BA 3DBHA 3K15A 1OI7A 3M49A 1HLDA 1GPDG 3P9ZA 4LOLA 2R7KA 5FWXB 3AVWA 2OORC 3BXEA 1EVZA 3C6ZA 1UT6A 3HCNA 4GLFA 4HGRA 4KK3A 4HI0E 4NABA 3T61A 3O8LA 3T7EA 3NRJA 3RU9A 1KEWA 3BVPA 3BHIA 3WWDA 4ZOLA 4NQRA 4E6EA 1E7MA 4FR5A 3MF4A 4B47A 1RIIA 1JHQA 1P6XA 2OHXA 2QUAA 3AEUB 8AT1A 4V0MA 2B78A 4QXPA 4RKEA 3IQXA 5EP2A 3ZVKA 1GEEA 1R64A 2Y93A 3NTUA 4J16C 4KN8A 2FCAA 3CU5A 2G7ZA 1RXWA 1YS6A 2JJ1D 2H92A 3CH4B 3JTMA 4RVHA 3QFTA 1VECA 4Q7LA 3DD5A 5CFNA 1ZAYA 1I32A 2IYFA 1KNXA 1G9SA 2QENA 2CV1A 4GYWA 1BJTA 1ZI6A 2VJQA 2G8LA 3FVTA 4FYHA 2FW0A 4HZUA 4JDPA 4EHIA 1Z0KA 1Y8QA 2OHHA 4TMVA 3FCCA 3RC2A 2BSXA 4UBLA 2DFDA 1LXCA 1LSSA 2FEPA 4LI0A 5A3JA 3OQ1A 5JSQA 1M1ZA 2Y1DA 5I9TA 5AW4A 2FRXA 1ZCAA 3O82A 2IZOA 2GCPA 2G72A 2PT6A 1YIOA 1CUFA 3PNYA 1JEAA 2GPWA 3C6MA 3ROKA 3M1LA 3OUTA 2H1HA 1E0JA 2H1LA 2JA1A 1E77A 3NC1C 1Y7TA 2BKVA 1DMRA 1KEEA 3BMNB 2PE5A 1E79D 4WOBA 3U3MA 3OWOA 3A37A 3AOEA 3SYNA 1M9NA 5TJ9A 4F6LA 1INLA 3CX8A 3F97A 3PVSA 3QENA 4CCAA 4R2WA 5U4QA 4HEHA 1J06A 4V2UA 4OFXA 5LP6C 5GINE 3UGTA 3UH0A 1CY2A 4UHHA 5J5AA 2DM6A 3NTXA 1JVBA 4IKOA 3HVJA 4R1SA 5DTQA 4YLYA 1P7CA 4MRNA 3U60B 1JJFA 3AETB 3IOBA 3LC1O 4AKSA 3OO0A 2Z0MA 3SE7A 4EH1A 4UNSA 3WQQA 1QCZA 1QTIA 2JKVA 3KE8A 4KXYA 3T5PA 3OLVA 1NV9A 1P2TA 1D2RA 1KJQA 2IYUA 2WJPA 3D1VA 1E5LA 3NR2A 3O8DA 4K05A 1K66A 4B17A 1HL3A 3K9LA 3RK0A 4ZVUA 5LB4A 4B6JA 1JLHA 3DMHA 2J32A 2GZAA 4AUEA 1OA0A 2Y1WA 1ZS9A 4JLJA 2WICA 5FA8A 1QP7A 1KY5A 2OV8A 1CIVA 3PYLA 4TYQA 2Y1XA 3OH8A 3V4VB 1O97C 3KDAA 3BIJA 1GKYA 1R0BA 3I58A 4LGCA 4CJXA 3TZBA 4B2YA 2OO5C 1Y7IA 3R8FA 3DAGA 2OENG 4R9RA 4KDEA 3OQOA 1DX4A 4FQ7A 5BPFA 2RBKA 4CLHA 1SG6A 3LY7A 5ISMA 3LLUA 1G4UR 4ALIA 1T3SA 1YB4A 2I6QA 3HCPA 2MSDB 1Z7WA 2Z8ZA 3F9IA 3RBAA 2O48X 1DS6A 4CETA 5JISA 1VE7A 3WQRA 4KVAA 1IHXA 3DUWA 1LTKA 1ZNYA 3ZX4A 1A0OA 4F3TA 1J5XA 2OG2A 5IJZA 4H9GA 4PHGA 4ARCA 1JIKA 2RK4A 3ODGA 4Q1CA 5DNVA 5EMKA 3JR3A 3CISA 3LVFO 1XCBA 1ISJA 4JI6B 5BWBA 4R3UC 4AJ2A 3V8BA 5AVWA 1A8UA 1RXVA 1T5LA 4FMBB 4UBKA 1PTKA 1MLDA 2O8BB 2OGZA 1ENPA 5EIWA 4H0NA 1EE9A 3WB0A 4CM7A 1WLYA 3CR7A 2O07A 4M0FA 2CL7X 4KR2A 4LTNA 1SG9A 3SK0A 4BLOA 3D4NA 3BA6A 3ETJA 5EKUA 3DL7A 3CUSA 3QLVA 3TFOA 3EWIA 2OORA 1TYCA 2K7ZA 1QTRA 2FZKA 3I45A 1SZCA 1X38A 5AJZA 5DHSA 1P80A 2MWMA 3PGLA 1D5WA 4HXYA 5D3QA 1O6BA 4OATA 3RIXA 3JYNA 4ZMSA 1VHQA 1L5SA 2EWVA 4GEKA 2BRUC 3HKCA 5KMGB 2BT4A 1JG7A 1GU0A 1PR1A 3IP5A 5D3MA 4R8SA 3AVVA 1PW5A 5EKDA 3L18A 2HLDA 4G1CA 5GIPE 3HP7A 4LY6A 3LUAA 1T5DX 3NHBA 3VPAA 5UKDA 1PZEA 3EMBA 3QH4A 3EOBI 2GGSA 4I50F 4JJGA 4BJ6A 4E2WA 4YCCA 1W5BA 5HMMA 5JNSA 3PGJA 3OAAA 4NLLA 3AVXA 1YVRA 4ENTA 3T9AA 5EWLB 1CVRA 2JI7A 1SG0A 3L7AA 4YFVA 2NUTA 1R27A 3CNBA 4BPBA 3Q40A 2FGKA 3PSHA 4AW9A 4MUHA 1EFDN 4N8DA 5BYKA 3GJRA 5A05A 3I04M 2AMJA 3WBJA 1P9NA 4NV3A 5H80A 1HEUA 2LGJA 2ZBDA 4TTSA 5BWNA 1E94E 4B3MB 2V65A 3JPYA 3WDSA 3CKYA 3CF4A 1WXIA 3PUIA 2O54A 1G64A 1PJ3A 3LCUA 2XTAA 4C01A 1EDEA 1BCSB 5LP6A 3T5GA 1T6BY 3FLBA 2WYHA 2I67A 3OSUA 4TQAA 1Z2NX 4J29A 2QI9C 2TMGA 1CD5A 1YR2A 6ADHA 1K5PA 3BT7A 4A8JC 4X95A 3DYVA 2CUTA 3NI2A 1EK6A 5JAQA 3SZGA 2WA1A 4RY8A 1ZHOA 4ZALA 4BY9E 2O8FA 1Q0TA 2ZVQX 5HDBB 1UOEA 1BA3A 1ISRA 4JOCA 3N07A 2XTMA 4Q4DA 1Z2OX 1K7CA 1KI6A 1AY0A 1V2GA 3L4BC 2IC5A 2P9BA 3FKSD 1T2FA 2X5XA 5IASA 1JR6A 5HJEA 1GFWA 2BMWA 3GFBA 4QYSA 1JFFA 4INPA 1RBQA 2R87A 4ITUA 3KR2A 2OO5A 1KU6A 1T35A 4E51A 4HNHA 3U6BA 4RGQA 1E18A 2WF9A 3KPUA 3P9NA 3U81A 1Y4DE 2PWYA 4MUFA 1O5TA 4WAUA 5ALKA 1UIRA 3BHJA 3PFGA 3WYEA 2W6OA 3A3OA 4G85A 1KJWA 4PYJA 2VCHA 1JPNA 2G40A 4D98A 4WCFB 3RT7A 2W6QA 3ZHOA 1FDRA 2GUWA 1DC6A 3WSVA 2HMWA 2OYRA 2VLIA 4QPDA 4QKQA 1F3OA 1MO3A 1WB4A 3N0VA 1OXKB 3D2CA 1C1XA 5IC5A 3LYLA 3W8NA 1DO0A 5I7EA 3KAPA 5JZVA 2IOQA 2FWMX 4MB2A 1VKNA 3GLHA 3ND7A 4YONB 5JC8A 1X0VA 3L8ZA 4D8XA 3EIQA 4YGYA 5KPJA 2IUSA 4EJSA 4BKUA 4QEZA 2C3MA 2FZGA 4JZYA 3PJDA 4DR6B 2WAAA 4YJHA 4CM6A 2CV0A 2BEUB 1XAIA 1VLQA 3C1TA 3EIUA 2VHXA 2RB5A 1RWVA 2KI5A 1L4YA 1Y1LA 4LPKA 4PO1A 2I5PO 4S24A 3VPGA 5A3QA 3H2YA 1PP4A 3D7SA 4PTLA 2A5GA 4S1OA 4Z9FA 5F21A 5I48A 1TT5A 3NAZA 1NXQA 2Y67A 1P2DA 3QEOA 1OFVA 4G26A 4GMXA 4L07A 3O2QB 4PZLA 1T1GA 3UJ9A 2DF8A 4BBZA 5F5NA 4DMMA 2J6IA 2Y9MB 5T4HA 1J8FA 2QVXX 2ZR8A 4YXFA 1BJRE 3DA8A 3P9SA 1FW8A 2BCGY 1JT2A 1S5PA 1U3UA 2EBWA 1WDMA 3CUVA 1ZUHA 1YDGA 4PC7A 3OJOA 4K6CA 5FEUA 3KKMA 4IP0A 5EAIA 4O6VA 1WQ3A 4V0KA 4YHBA 2QD3A 4MVJM 5FNZA 5FYDA 1NR7A 1S89A 1ZJJA 3IKVA 1U5AA 4XEUA 4H15A 4HNAA 4NNJA 3RSLA 3WLNA 1OV4A 2ZBVA 3QF4B 3EEQA 4ZMBA 5CK5A 1NXWA 3RSQA 1WSAA 1OC2A 4QUHA 1Q2XA 5ER9A 2XB4A 1R8XA 1X1RA 4ZA2A 2JHAA 2X9VA 1Y82A 3DO8A 5KDDA 4R0VA 2PJZA 4Z9BA 3WK7A 4CE6A 1QWOA 1C3VA 1SQSA 4MV3A 4ALLA 1A72A 3G89A 4R8KA 2E4YA 5G41A 4YGXB 1SHKA 1R6DA 4EFNA 3C1AA 4OYHA 5AVRA 2IUFA 5LA6B 4OQLA 3VO9A 4BUZA 2GN8A 2OZKA 3C70A 1BAPA 2ZBQA 3CX7A 1ZN7A 1JZTA 1T8UA 4OIMA 3UJNA 1AOXA 1R6TA 3U4GA 5F78A 2JHCA 1L7AA 2RB4A 3A14A 2A9FA 2A5LA 4OQ4A 1I3MA 4DANA 4DR5B 1EWRA 2VAWA 1I3CA 3U7QB 4F4HA 3PA6A 4YECA 4V02A 4IKPA 4PSUA 2R44A 5HZHA 1D6SA 2OO3A 1PX0A 2WIBA 2WNHA 3A3KA 5IXSA 4DR1B 1QQTA 1Y3IA 3AR8A 3ETNA 2V7XA 2W2QA 1KDYA 1XDUA 3UT0A 2I1LA 3FUTA 3O8OA 3Q3IA 4OX9B 3VC3A 3EULA 1W44A 1P73A 4HB4A 1SWVA 3PQEA 3FZGA 5B7QA 2W8BB 3GXBA 5DIFA 1KBZA 1UM9A 1YNOA 2OVBA 1N2CA 4ZOEA 3TNJA 1BOFA 3DBHB 4RVGA 1AO0A 1NQAO 3GV0A 2F1JA 1TU4A 1V26A 2JIDA 1OZHA 2ZIWB 1UZLA 1V6CA 5K9ZA 4IFTA 1S8FA 2J7KA 5LA6F 3RAGA 2ODBA 3OQMA 1LVGA 4BKMA 1GSAA 3GAAA 3PEUA 4IZ6A 3WBBA 1K6XA 3BFXA 1DIRA 4M9SA 4XIGS 4Z4CA 2HBRA 3HO6A 3NALA 3EQZA 4MVXA 3OJXA 2AXNA 4YYZA 2EZ8A 4WK6A 1FJGB 1W2GA 4CTOA 5J5VA 2O2CA 2GAFA 2VG8A 3CWQA 4G5QA 4KE7A 1E9VA 4NE2A 2XCTB 2PSDA 3FROA 3NEJA 4OMFG 4AB1A 4F7DA 4YT8A 5C1DA 3VNVA 2ODEA 4O8CA 521PA 4D6PA 5C7YA 4TSRA 5DM60 2A58A 4RK7A 1TUGA 1X7YB 2Q1YA 2OKCA 4MQLA 4H16A 4Q4CA 5AK6A 4HB2A 1ABFA 1NYTA 1HI9A 4QJ3A 3KVVA 2V8OA 3VPBA 3EK2A 5LJIA 4BEWA 4N1AA 2QORA 1V71A 1P6UA 4PLPA 1TT7A 3ROTA 3TVYA 4YASA 4A91A 4HZUB 1KZ9A 3KEFA 1T2VA 4GPIB 2CL5A 4LCEA 1HQDA 1Y8QB 1QHXA 2OCGA 3ILVA 4AJKA 2RHHA 1UWLA 4D5EA 1N77A 4RK4A 2PRKA 4A15A 3IT0A 3SC6A 3LW7A 1CUYA 2ZWMA 3OLYA 5CH3A 3NJRA 5CYPA 4RKFA 4HVAA 1E3DA 2GF2A 2GO1A 4I5EA 1QQBA 2HNAA 1PQUA 3R0IA 4H08A 4ZOLF 4L78A 3QVLA 2QLLA 3RVOA 1WUYA 2BKEA 2OD9A 3GLSA 4C78A 1U94A 4O0LA 1KNQA 4NE7A 1WD5A 3L1JA 4IDBA 4OQDA 4LJ8A 2PZKA 3AONB 3Q9UA 4L75A 3QU5A 2C2YA 4N6GA 2ZCVA 3OPVA 1KJZA 1YA8A 3BCHA 2DR3A 4ZYXA 5GAJA 3QXSA 4N3GA 1X1DA 4ZCQA 1IBLB 1OI3A 4IHKA 4M8SA 2C2ZA 3PUZA 3F4LA 3OFNA 2Y4NA 5LKRA 3D5TA 2WUWE 5FOTA 2V7EA 4Z4FA 1FL9A 1YS4A 2WHYA 3I76A 5HKBA 3W6PA 4P3KA 4AS2A 1WAMA 4MVJA 2EZ9A 4UD6A 4ARIA 2H9YA 3G5LA 5H70A 2QJFA 3ITNA 2FUNB 3VTAA 5A5FA 4NCNA 5KQPA 2XOKA 4MVWA 1PZXA 3OZDA 5IYZF 4JBWA 2OHIA 1XZQA 2PT7A 1GLGA 1PQ4A 3JSXA 3KR1A 4H4CA 3VOAA 1ENZA 5GM2A 3U7RA 4F21A 3FWPA 4LJRA 3HUFA 4UHCA 4Q93A 4B1FA 4CMEA 1RQ7A 1B6RA 3DC2A 1B41A 1LUAA 1Y5IA 2P35A 2XWPA 4JWKA 4OXXA 3BGIA 1LEHA 3L0OA 3OP1A 3DZIA 4Y1EA 2XXAA 4Q3LA 2Q1XA 4E94A 5ITSA 3LDFA 2UVQA 1BX1A 1CR6A 2VRBA 2QTVA 1BROA 5KYKA 1OJLA 4KZKA 5EWJA 1QORA 1JBQA 1V37A 4F9TA 1RCUA 2P9ZA 5IM5A 1POXA 3VV2A 4ILKA 1IOLA 3ZHCA 2H4HA 3BUSA 2FPSA 3R09A 2VOEA 2IYTA 2ZEJA 3WB2A 2D4AA 2NTEA 3WK8A 3HBFA 2ZITA 2IF0A 3K8ZA 3DLPX 3NHMA 2O2IA 1EA7A 3P45A 5DGCA 1KDRA 4YMTA 4M1SA 4YIKA 4UARA 4M6WA 5F9HA 2OBYA 4RIGA 4MVJG 1EB9A 3PVCA 1OAOC 5A5GA 3SVLA 2EQBA 1KOGA 4A6EA 3C6XA 5EJGA 2NO4A 1Z0DA 3L7KA 3MAJA 4DCJA 1SOMA 3F1LA 3HR8A 2VP3A 4GI2A 3D0KA 4I8DA 1MIOA 4MR9A 5T57A 4AN4A 1ODLA 4EGFA 1GKUB 5L3QB 2FEAA 2FPRA 2WTMA 3ZZ1A 1LNZA 3ZBPA 5AK4A 3BSFA 1NJSA 3KAJA 1SD1A 1AE1A 4KUEA 1YB5A 1F1BA 4EG7A 1JHMA 3HKCB 1P2SA 3DF7A 4Y9RA 5FRDA 4CEHA 1EWTA 2V9CA 3GD7A 4G1UC 5BMOA 1OH7A 4AD8A 2Z2KA 3F6SA 3A3NA 1TCVA 4JBGA 4BC0A 5BQFA 3GMDA 2GYUA 2ZBEA 3TPFA 5C8ZA 3OA0A 4MYCA 3E7XA 3W7AA 1V9CA 2XE4A 4DEXA 2UUAB 1GN8A 3B1XA 4CFSA 1P8JA 4G97A 2BKUA 2VF7A 4TWRA 2AFHE 2B4YA 3WLHA 3ZWKA 4BATA 1UDXA 2QX9A 1HZJA 2EWWA 2ZAYA 2PPVA 3MINB 4X0EA 2NUTB 5JRDS 2P91A 3QUTA 4YY3B 4XWYA 1ZD2P 4KQIA 5D5PA 4JK3A 4KUGA 4KXWA 5ALQA 1GGJA 4HN4B 1FDTA 3DMTC 3R5XA 4X20A 4EZBA 3SQXA 1Z22A 1M33A 5ALIA 5ECYA 3T9CA 5F7XA 3N0WA 5BYJA 4UHDA 1B23P 3AL0C 1L4LA 4FFLA 5E7QA 4I1SA 4EEKA 1CP2A 1XDGA 3WC4A 2L2QA 1JEYA 1G2PA 4N49A 4POOA 4XTCS 4CG2A 5ALSA 5IH7A 4NAHA 2HWXA 3RRXA 1DT5A 3HA2A 4LMAA 2ZS7A 1L1RA 4ARBA 3I1FA 1VE3A 4I5FA 3RG8A 3BB4A 4Y6OA 1CJVC 1U04A 1YUBA 2RH4A 2VJKA 2X3UA 4LXQA 5AJVB 4XQCA 3GMTA 3QWBA 3TTWA 3RB8A 1VHDA 3OQNA 3V8MA 4KWTA 1N2HA 1YL7A 3MHPA 1WSWA 3ZTTA 3ORYA 2AJHA 1RYHA 1X8KA 2P1RA 3O6VA 5B4TA 1CDZA 2Y2UA 1AS3A 3T5AA 3T1VA 1QVAA 4PM4A 4GOMD 2YVLA 2HLNA 4AX4A 2DBQA 1CFJA 2XDWA 2PWBA 3BD9A 4OL9A 4FE4A 5JASA 1YVEI 5E1MA 1JLMA 1G1AA 3OF5A 1DIOB 3JYPA 2WAOA 2UUCB 4C2UA 1QYDA 4ES6A 1OBHA 2A35A 5TVGA 1JFFB 4GUDA 2ATVA 2H65A 2VZ0A 4IINA 4CWAA 5EEGA 4OFZA 2QUZA 3LT2A 3WZMA 2IH5A 2ANBA 1VSBA 2RDMA 1V11A 4RVUA 4YI3A 2I4LA 3FB1A 2J3QA 4U8HA 5K1ZA 2P65A 2ZTLA 2ZULA 3RBVA 3ZY6A 4I36A 5LP6F 1ZINA 4ROSA 4ZI7A 4AWBA 2DQZA 2UZ4A 4ZAFA 1CJUC 3C87A 2IHUA 3KFXA 4YRMA 4TXNA 3I4CA 1S1CA 1GQQA 3BTVA 3OZWA 3ZKAA 2FWPA 4D4HA 3MCTA 1IQUA 3TFWA 2W2KA 5DKFA 1AHHA 3H4VA 3NKVA 3ZLBA 4G5XA 1WCV1 3Q1KA 1ZXXA 2V4UA 3MS2A 5KYWA 4PWYA 4BTEA 5CCXA 1Y8ZA 2ZUTA 1BDBA 1RZUA 4R3NA 3GOQA 3AXTA 3PQ3A 2BFBA 4QOSA 2XBLA 1E58A 4P3XA 5C8YB 1AKWA 3U0VA 1LK5A 5L53A 2A5JA 4EJSB 3Q6IA 1E1NA 1MG5A 3HXTA 4GGOA 4IUDS 5K01A 3FPKA 1LPBB 4FWTA 3MTEA 2C5FA 3H2ZA 3ROPA 3UFBA 4YJHB 8ABPA 1NVMB 1ZD5A 1NJGA 5IS2A 3V7WA 2UXCB 2HJGA 3NPMA 2CY0A 2HHAA 1FVXA 1XZHA 1ZJ4A 4HFJA 1TT5B 3VOSA 4OHZA 1FMFA 4OGWA 4JJEA 4C0BA 2OAEA 4J0KA 3ASZA 4UDOA 2OMKA 1YGPA 3GJ0A 3NWBA 4LOJA 3LXXA 3SNKA 2DQKA 1YDEA 1CFZA 3TJRA 1Z73A 1NL3A 1OTXA 1U0JA 5KSWB 2CCJA 5JSHA 2CLOB 4KG7A 2DE0X 1WMAA 1VMKA 1XHEA 2Q4EA 3B6JA 1Z68A 3LE8A 1EHIA 3WHKA 5CJPA 1XYYA 4UTOA 2VUIB 2C7GA 4TS3A 3PC7A 4HNAB 4MP3A 4DLZA 4FU0A 4W1RA 3CN9A 4ZXPA 5D87A 1MV8A 4WIAA 1JWBB 5C35A 3CVWA 4JODA 4OH1A 5HS6A 2J07A 3KD3A 4WEOA 3LLCA 1X9GA 1Y9DA 2VS1A 4KLRA 1RLOA 1P81A 4BCBA 4PGMA 4NBNA 5TQ2A 2JIZA 3L8HA 2QL6A 2WG2A 1Y6ZA 1VLLA 2O8VA 3P0HA 4HWTA 4RESA 5EP4A 3LFUA 3HDQA 4F9GA 1A5ZA 5BSTA 1X6VA 2IWRA 3IUNA 3ICEA 4M22A 1PSZA 1XI2A 2DCMA 3L1UA 3QE2A 3VA7A 1Y7PA 5DTEA 1TYEB 4LV5B 2IUTA 4D9NA 4DQLA 1B14A 2AD5A 2RGEA 2XGGA 1P5HA 2WU1A 3OE5A 2QAIA 2NUAB 4E2ZA 3V6MA 4C04A 5AW3A 2WTEA 1JA9A 1ACMA 3C3WA 1EGQA 4JL6A 4JI0B 1SCUA 2E85A 3RYTC 2D2XA 4E31A 1V4BA 4YUZA 4I9NA 4RSGA 3NONA 3ZHZA 4WNIA 5H4GA 4L9WA 1Z5UA 4E70A 4EY6A 1G4HA 3VU8A 3MWJA 2EP5A 1U99A 4JB0A 2D5BA 1PDVA 4Z0TA 4KQ9A 2QUKA 4QFCA 5JAMA 4JC4A 3ONDA 2EIXA 5BSEA 4CKWA 2RHMA 3D6AA 1JYEA 4NQZA 3G9QA 1T4CA 5EUCA 5J43A 4BB6A 1UM9B 3CH6A 4OQNA 1G5RA 2WJAA 5CFPA 5JNUA 3DZJA 2YN4A 4NXNB 3ZE1B 7REQA 4G1EB 4BX3A 1QRSA 2EKDA 4Y1RA 4UFOA 4DQDA 4AM8A 3R6WA 3K3PA 5H1YA 1TAQA 1A9ZA 4PYNA 4LJ9A 4CF6A 5IF9A 2YQ5A 4MI9A 1PJAA 1GZUA 1TECE 1H05A 3OFVA 3Q7RA 5TMEA 3RYIA 4G2NA 2AG8A 3H1BA 1PYDA 3GP5A 2R65A 1T8PA 5DYWA 1NGSA 1E63A 1H8HA 1XEWY 2ZUUA 1QHGA 2GMWA 3SSAA 2ATCA 3AQIA 1UL1X 2L69A 1C0LA 5ARBA 5J5CA 1PYOA 3CRRA 1E4VA 2G80A 5L8VA 4P22A 5I51A 4G4JA 4OU5A 1DLIA 1IOZA 3G6KA 2C82A 1ADJA 2QI9F 3RU2A 4CKXA 4S0XA 1EG7A 1SULA 2OGWA 3IDSA 4QUAA 4OV6B 4IRUB 1HTWA 3KZCA 3GDWA 1KL7A 2IHJA 5JS8A 2FSGA 3CSUA 5FBVB 2VZ8A 2EFJA 2CD9A 4DIBA 4I1PA 1ZGCA 3DCNA 1YBVA 1CUXA 4REMA 1C8KA 4Q12A 3ZV4A 2GPJA 3OZFA 5FB3A 1ULBA 2CW5A 3UAVA 4ZT5A 2B1IA 1PWHA 3CWCA 1NVVQ 5BT9A 4A5OA 1Y3BE 3SEAA 1FFGA 2H07A 1Z4NA 3PYMA 4KYIB 5J9FA 3TQRA 3VOTA 1J23A 3SEZA 4U1RA 2QRKA 2F00A 2HKIA 3RS8A 1DQYA 4C29A 5FTKA 2VR1A 1A2OA 1J21A 1MZVA 1QF9A 2PRYA 4N5IX 1JWAB 3K72B 4G5FA 4MI1A 3RYHB 5CLHA 3UMCA 5CFZA 2OL4A 5HPYB 2ZYWX 1I2AA 3QBVA 1ZH4A 2M2IA 2YIMA 3CZCA 5CIQA 2Z58A 3G0HA 1DRJA 1FMJA 3DOOA 2QN7A 3TIVA 3IIMA 5CVJA 3BL5A 1S2NA 3K09C 3TCXB 1UT5A 4I3FA 2YASA 4S1PA 4LXGA 1WPXA 1BS9A 2ZUSA 3FAKA 3RWMB 4B81A 1CS0B 1DZIA 3SQOA 3NBFA 4E33A 1GAQA 3I5YA 3BZUA 2ZROA 4MQEA 4ZFNA 1PS0A 1TM4E 4YJGB 5EIHA 1LZKA 2IP1A 4ER6A 1EFLA 2AC2A 2ZRGA 3GRYA 1YFKA 1FX1A 1LBEA 3MTJA 5BYAA 2HEIA 1RYMA 2HZ7A 2G77B 2VF5X 3F1KA 5B3JC 3TL3A 5COQA 3OQJA 5I6DA 5AKKA 3WMWA 4CM9D 3ZI0A 3SU8A 4YR7A 2XXAB 3JVEA 1IZZA 4D92A 5JDCC 4PQGA 1AA6A 2QYSA 3EG5A 3EJWA 3L7BA 3FSRA 4F8JA 3MQFA 5HXAA 2QV0A 4EF6A 3GK3A 1QRTA 5FT9A 3KT3A 4UEOA 5EWJB 2WPDA 4NYIQ 2GX6A 1F7VA 2B6HA 1O6CA 2WYWA 3DWGA 2ODPA 4FYXA 3S2SA 3COPA 1XJ5A 3OZUA 3QLEA 3ZLUA 4C7OA 4MVJF 3BZWA 1RP7A 4RK1A 3R6TA 3OZCA 3IAEA 1BNCA 1I3LA 2CD7A 3TZQA 3GRKA 2WMOB 3B9QA 1R9JA 1LDBA 3SYLA 3Q7EA 4EHKA 1R8YA 3CB4A 1E1CA 4M8IA 3I2IA 3OSZA 1SQGA 2X0EA 3RHFA 1DELA 5L6LB 1J5PA 1GPKA 1TVCA 3KR9A 4IM7A 2VTDA 2HRQA 4M6WB 4RKRA 2WSMA 1Q16A 4P81A 4LDPA 2QT0A 5JZMA 2HH9A 1GZ7A 1HBJA 2LXNA 2F43B 2V9ZA 3LO5A 4GS5A 4G5OA 5JSZA 2OECA 3GEPA 4G67A 4LVUA 1JKFA 1XRNA 2E0IA 3D8NA 4L27A 1E2LA 1QLJA 4MS4B 4CIVA 1MIOB 1ZK0A 2B2CA 4MR9B 4DRYA 2QB5A 1DBRA 2HF7A 3QLUA 1XQXA 3PNPA 4RD1A 4NZOA 2B21A 1J2JA 4UTVA 2I3AA 4J1QA 3STHA 1OV6A 4JXZA 1KK2A 2NT3A 3IUEA 2NTNA 3TINA 1Z6QA 4MR8A 4UZFA 1Q0ZA 5REQA 1CZLA 1BYUA 2PQ6A 4IIEA 5GM1A 5TQVA 1KGSA 2H2GA 3RPEA 3B5JA 1HSOA 2QW0X 3HR4A 2IV2X 4HWGA 1H8EA 2HQOA 2VDRB 3CVXA 2NYVA 3CKMA 2LNDA 2C1ZA 4DLYA 4RCVA 3LDHA 1KY3A 4TL7A 2GJAA 3I4FA 4IH1A 1LFAA 3O4GA 4LBYA 1CBUA 1ZMXA 1IJBA 3U4CA 5M2QA 1WP9A 1KI3A 4BNWA 3B82A 2X3YA 5KOHA 2W7TA 3CQ9A 4TUYA 1QCYA 2BZSA 2DPHA 2Q2WA 3OURA 4QOIA 5MN5A 5TF4A 2QXYA 2R00C 3HZRA 3ZVMA 3U5ZB 4MRMA 3HJBA 4X20B 1G59A 2XE7A 3GA5A 3VQTA 2A67A 3TF5A 1T5BA 1XP8A 2WUGA 4L73A 4DIMA 1FNCA 1M6VA 2FWJA 3PXXA 4UE3S 5DASA 2BDUA 5HJ2A 1CY6A 4EVIA 5JCJD 1LVUA 4ZICA 3DYIA 4DLKA 5AKYA 3PI7A 3HPQA 3AY3A 4H2DA 4JI2B 3S27A 1WVGA 1FBTA 1IBSA 1R4NA 3DT8A 4MGYR 1AM4D 4K03A 3TTUA 3OPNA 1N2XA 3OOJA 4BKQA 3E3MA 4AY5A 4ZKDA 1YZHA 3NASA 5KTMA 4E22A 3GGJA 2JAOA 4JHXA 3TQQA 1K2WA 3U4MA 1IZ9A 5EZYA 1RI5A 4FOSA 3MLEA 1CUIA 1ESZA 3HZOA 4AP6A 5K45A 2QRVA 5EE9A 3JD4A 2H51A 1NKTA 4OF4A 3K09A 1U8FO 2O2EA 3C4QA 2R6DA 1W4ZA 3C3BA 3O5AA 2J0VA 3TJZA 3KSZO 4CGYA 1NLFA 1J99A 5IWAB 1TZJA 2WB2A 2RHCA 1Y3CE 2GA8A 1LW7A 3K0KA 4MMYB 1FZTA 3H4MA 1VPEA 5CLJA 2XW6A 5FUMA 2OQRA 2CJPA 5HIMA 1ZGGA 3AQ4A 4RXMA 4EL0A 1GLVA 1TL7C 1MJFA 3EN0A 4LJKA 1VTKA 1G41A 3QXHA 3ESCA 1XRQA 2BMAA 3I53A 1U9IC 1V11B 1BYIA 1ZUNA 2ERXA 4OBXA 3JVDA 4R5MA 3ZJYA 4ZI7B 2ID4A 3E03A 2CEAA 2JLRA 5FAXA 3WIOA 2GCEA 2IX9A 1QFMA 2W2TA 3OZ7A 3ABSB 3I1IA 2JARA 3P5BA 4EVRA 5DM4A 5BN4A 3DT6A 4D6YA 4YV1A 2W2KB 1W49A 3DL0A 3QKWA 4XPZA 2WHPA 4PANA 3EIWA 3IQWA 4KACA 3UMYA 2HW8A 3UWDA 1ZIPA 1J7JA 3H9QA 3KZVA 4FHEA 3TECE 3V8QA 4EGQA 1PJTA 1OT3A 2BFBB 3OJWA 2ORYA 1VJ0A 3L0PA 3QVKA 5ITVA 1IB6A 1JXQA 3EXAA 4GWLA 4MGZR 2WQ6A 2ST1A 1G4AE 1QKIA 2DC1A 2IOHA 2RH9B 3EBOA 4HAUA 4NTZA 4AROA 4IDCA 2ACVA 3TPZA 5HWSA 2GFQA 3HJHA 2FHSA 4K6FA 2QXUA 1B93A 2C7PA 3ORRA 1ZMOA 2H1IA 3EGIA 3ENZA 5A3SA 1E2FA 1TA0A 2R60A 4PYQA 1NMZA 5DWQA 2X22A 1FDIA 1TM2A 5ALDA 3GQBA 1EDOA 1Y3AA 3QWAA 3M4ZA 4ZI7F 1B2RA 2XHZA 4ZT6A 4S1WA 4EP1A 3GCZA 4CU5A 3HG7A 1Y6JA 4X63A 3G2MA 4JBHA 4EMUA 5AGIA 5KTOA 4JX8A 3A05A 1R5NA 4QODA 4Q15A 4J49A 4H3SA 1HDRA 1JHUA 1TCUA 2ZR7A 1JUDA 3ANTA 1NE7A 3SQDA 3ZWPA 5EJ8A 1QHHA 4AMGA 3DTVD 1YMQA 2HLHA 2E4WA 1Q1BA 2FF5A 2Z1NA 4I3GA 4U0KA 4CTNA 5B6IA 2J3IA 2J6BA 3R6DA 3FFBA 8ATCA 1GPMA 1TM1E 4K3UA 1ZZEA 4EW2A 5CDFE 4WBXC 4X8HA 1UK7A 2PGAA 1YJXA 1ZOSA 1HV8A 2FUG1 5ECDA 4JUIA 3UMRA 4UTNA 5FPQA 2D0DA 2R4TA 2FZVA 5TQ2B 4WWHA 1T9AA 3QV1A 2CLHB 2LPMA 1V1RA 3VU0A 4J1NA 2R00A 5AHRA 1G8PA 3UXYA 2EAUA 2HA4A 2D6FA 1F5NA 1GUFA 1I4TD 2YOHA 2YUTA 4RK5A 5LUAA 2CNBA 2W98A 4OX9Y 4KIJA 2CFCA 4BO7A 3O03A 3Q88A 1MENA 1URPA 5ICGA 4PF1A 5EJ2A 1N6LA 3IIEA 2XF2A 2YV2A 3U3OA 1F6DA 2GKOA 2B5OA 2GLUA 2PZAA 1SCUB 3DEYX 3KJZA 3EXEA 4KBGA 4PFSA 1LPOA 2NQ8A 4MA4A 4UBNA 3PA8A 5CM9C 4D26A 1XROA 1YQGA 3IP6A 3MRTA 2PSJA 4GXNA 4BEBA 1ID1A 1D6JA 1X7XA 5DJ5A 3ZWOA 3GP8A 3FPBA 2W0SA 2G06A 1RU3A 2FFHA 1FP1D 2HNBA 1CB7A 3VDRA 1EFUA 3TAXA 1M6EX 1UJ6A 1T4CB 1ZRSA 3RRYA 3UM9A 1RRVA 3ABOB 3F74A 4U6NA 1P4GA 2A3RA 2P2GA 2V0CA 2QGNA 4JEUA 1J0CA 1PU2A 3HHEA 1A9TA 3IBTA 1UJMA 2Q5JA 1DADA 2I1VB 3OETA 3KB1A 3LVBA 3R4CA 5KX5A 1NQ5A 4Y1RB 1GZ5A 4G24A 4ACAA 3BE8A 4K86A 1VBNA 5CHYA 3BGWA 3JX9A 1D2NA 1YZKA 2IXFA 4OPMA 5BVGA 3PU6A 2P0AA 3CNQS 2XRMA 3JAKA 2H17A 4W5HA 3SDBA 3VRHA 1I9GA 3OF2A 1SPBS 4Z2AA 3D7LA 3RVLA 4AMYA 4OI2A 1M1YE 1V41E 1WPQA 3OPXA 1AQIA 5CXSA 3SJ7A 3ACCA 3K4HA 3MILA 4MV7A 4YJ3A 1E2KA 2FF7A 2JJ1A 4IHJA 3EODA 3QU7A 3IP9A 2Y77A 5A9SB 3IBFA 3AIIA 4NBVA 4WNCA 2PRIA 2QPAA 1A4XA 4O4HA 1ZHFA 3IOYA 3ZDAA 3B2EA 2FI1A 1WMFA 3KAQA 1G6OA 1EVYA 2N46A 1N5LA 1AQJA 4UNRA 1PL0A 4M0KA 1NLMA 3S1AB 5KNCA 4RMJA 1ZD4A 4TZKA 1WB6A 1ZU4A 1NQOA 1T9BA 1HDZA 2EZUA 3B8EA 3EUAA 1W5EA 5KI6A 1PJ2A 3EXHA 1UFOA 2VYFA 4YQZA 3I9NA 4IUCS 2LZ0A 5F64A 2BP7A 2MYUA 3TVTA 5FLXA 3UV3A 1TW2A 4BE7B 4DLUA 4CEJA 1QVWA 2CHEA 4L9AA 1F3LA 1CJSA 2W6MA 4W8GA 3O8NA 3NIDB 2WWYA 4JXKA 3WTCA 3LQ4A 2NM0A 1TJPB 4PZEA 2W58A 3W3AA 3I9MA 1IN8A 3ESZA 3HL0A 3FGNA 3GNLA 3IQIX 3SHFA 1J24A 3I52A 1AKNA 2J3DA 2P9EA 2A33A 3IBGA 5A5VA 1GSOA 2ZJBA 5ADWA 2W2NA 3BXOA 4EG1A 2C3YA 2X9GA 1AZSC 3ANSA 4GQAA 4J91A 5K3AA 1NN5A 4ND6A 1PV1A 4IR7A 4NRDA 3ZGLA 5FYQA 1A77A 5IJWA 1MW9X 2P5UA 3VM6A 2YFYA 4FNGA 4PXAA 3C8MA 4NE9A 3QQPA 3WI7A 3R76A 1FP4B 2WAXA 3TYXA 2OWEA 1KWGA 2VL7A 3IVXA 1DTSA 4BDTA 4UC0A 2QN2A 3BWBA 1I2BA 3ZCTA 4INAA 1GL9B 2C5HA 1RAHA 4G9BA 4MQEB 3CONA 3V4SA 2B69A 3FZEA 3I2JA 1VJTA 4A27A 2FPWA 1A1VA 4I3HA 1RDFA 1QH0A 1F2VA 3KQQA 5IANA 3PPVA 1PIWA 4JJKA 1V5FA 3NHUA 2FXVA 3K70D 5E1OA 3KWJA 9LDTA 3NO4A 3TCNA 4B3JA 1IQRA 4YCAA 1V95A 2Q6KA 2YBDA 2ZJFA 2IV3A 4EFDA 2GPBA 1VPWA 2MCFA 1VIAA 1Z0JA 4JI4B 1ILWA 3MS4A 2FE1A 2V97A 1R6AA 5D6NA 3Q87B 1A76A 1SHLA 3TLBA 4D80A 2ZREA 1BFKA 4RK0A 3WNVA 2I6TA 4LPSA 4MYSA 1ISSA 4JS0A 2AXPA 2ZRKA 4NZZA 4PSVA 4LRYA 4YHHB 4C7OB 1QP0A 2XT9A 3KBOA 1YBAA 2XVMA 5TT0A 3OTGA 3WDMA 1YTLA 1HEIA 8ADHA 1FNMA 2GNOA 5HRCA 5BR7A 5K3FB 1RHQA 3RAPR 1T0HB 2YJ5A 2GR9A 4UM8B 5IKEA 4DIUA 1E1CB 3PKZA 3IQFA 5HA5A 2VATA 3AR2A 3FNHA 1XQVA 1YCFA 3OIFA 4ANFA 2C2BA 4EA6A 2CV2A 1U7UA 4G8JA 2V6BA 1RPJA 5JSZB 4HXGA 1CJBA 2F3RA 2HI0A 1KVSA 2IXGA 2JFYA 1QTNA 2ACKA 3HXMA 1MOPA 1FDVA 4Q05A 1O0SA 2DH5A 4OGGA 4IO0A 5H0IA 2OCDA 4HCJA 1G60A 1FOEB 5A6SB 3R7BA 1CUAA 3IJ5A 3THRA 2C4NA 3RADC 1SKYB 1AA9A 1RBMA 3Q7TA 4MR8B 3HYTA 4NK5A 1XQ6A 2FVXA 1NR5A 3ONNA 4TLMB 5REQB 2LIVA 4BQNA 1E3TA 1KYZA 1GYQA 4TKLA 3SC2B 4RZXA 2K5UA 1W2HA 1FEZA 1II8A 3EW7A 3F46A 3K73O 1OI2A 4JIMA 5EVCA 3ZNPA 2X42A 3N8GA 3H2BA 3SP1A 4I1UA 2JFUA 4TMFA 3OMXA 4HWSA 2OAQ1 4WLUA 2I71A 1NP6A 4IDNA 1YE8A 2Z8XA 4RGVA 4B43A 4BNDA 2D2IA 5KOHB 3T12A 2IYEA 4TUYB 1GFIA 2EJCA 5JSKA 1GQYA 2RGCA 5CT4A 5TXGA 1GRNA 4TTVA 1U8EA 3KUUA 1QKKA 3H5OA 2J6CA 5CAEA 2FZ4A 4MRMB 2O7QA 3NJ4A 4DHEA 3J7TA 4KXVA 3HU2A 4GOOD 5CCDA 5E9QA 1M6VB 1XAJA 3SGLA 4J07A 2H59A 3A25A 2FV8A 3M7IA 4N01A 1AH2A 1HWYA 1KJ9A 2R7MA 3QXJA 4Q4HA 1Q7EA 3RLIA 1TK3A 4MW9A 3OCCA 4NZYA 4P0TA 1G8FA 4CXMA 3R3WA 1Y63A 5GP1A 4RHYA 1XPJA 5DBHX 3PICA 1R6XA 1W36B 4JMLA 1RM4A 5FXMA 3M6MD 3OTWA 3QEKA 5EZYB 1RAGA 3JQAD 3I6IA 2QRVB 4YUVA 4MDEA 1WG8A 4HNQA 5A2QA 4FWBA 621PA 2I7DA 2P7IA 3IVMA 3MUEA 2OGSA 4M54A 4EF4A 3Q0TA 4MAAA 1MW8X 1O58A 2J3MA 1FNBA 1ZGJA 2A5FA 2PS0A 2Z8YM 3FKSA 4RF4A 1UBOS 5F23A 3K0SA 4Y6SA 4FLEA 3IUSA 5EXEA 1SFRA 1RQRA 3VU3A 1L4EA 2R5FA 1H2WA 4FE3A 3PSAA 4GP6A 1SCBA 4P7JA 3QWFA 3NKFA 4MVJP 3O92A 1DAHA 1QU2A 4O2BA 1DJMA 2CJXA 2HGZA 1Y89A 2Q41A 2W11A 3OA2A 4GBMA 1AX9A 4XX0B 5EWMA 5AVOA 4NBRA 2BMDA 3CLUC 4FHGA 1ZUNB 2VEDA 3VAZA 2FW7A 3TOZA 3ZHTA 4IF4A 5EZYF 1KDTA 4DSOA 3UF0A 4LISA 4JYZA 4MIKA 1FPMA 1N2OA 3C3EA 1N7GA 3M6IA 4O59O 4DNQA 1F0PA 3PFBA 4G0MA 3SJBA 1PLJA 4BEVA 2DBYA 1YULA 3ABQB 4RX1A 2WHPB 4TXHA 3THOA 3KOXA 4HNVA 4JJ7A 4R2MA 3ZQUA 2C57A 1CQJA 3L4JA 2CZGA 3JALA 2BVNA 4PICA 4ZC8A 4C30A 1T9CA 4REQB 3UK7A 2O7NA 4P08A 1EXNA 4W6ZA 2WJWA 1EFRD 3PQ6A 1XQ1A 4WOJA 4PLFA 4HDQB 4RE5A 2IS4A 3W90A 3SN6A 3NOVA 4GO1A 3WGHA 1PGQA 2Z08A 2YDXA 3VYVA 2FRVA 1DC7A 1E9CA 1PZNA 5CPFA 1NY6A 4HX5A 4OA5A 5AKJA 1KZ6A 3BD8A 1UADA 2XNDD 3WWZA 5F7OA 5K8TA 3RSSA 5TSDA 3TW8A 1X13A 3IO3A 3R3VA 2YN2A 1Z6AA 3GQBB 4Q19A 5A7FA 3F67A 3DZCA 3RS2A 1P1FA 2JCGA 2OXRA 4DFDA 5TY0A 4HNTA 2IZ0A 2MR6A 2Y1OA 2XNHA 3CFYA 1E69A 3GDHA 3OKPA 4XFDA 5A7GA 3TAHA 4P4GA 5H3CA 1OLSB 2JH9A 2PFGA 4EUKA 4OXKA 2HQ1A 2Q4OA 4UEQA 1GNQA 1GOTA 5HK9A 1U1DA 1TF2A 3GJ8A 3OZBA 3DLCA 4HB0A 1QHHB 1AUXA 2BIFA 2CFOA 3OX1A 4MQUA 2F1KA 4LJAA 4OQPA 1WNZA 1I4OA 2GCGA 2RGGA 3PYXA 4C0QC 5AM2A 1Z4PX 3EZXA 2PAFA 4I2NA 1RI3A 3QBEA 4Y1GA 4GZ6A 4YP7A 4D25A 2NQTA 3R3SA 4DLRA 1NW7A 3C97A 2XCUA 3NGXA 4Q1EA 4ZCSA 1HRDA 4J2HA 3AKCA 2ID8A 3UUWA 4N0QA 2QX8A 1XU4A 3KOUA 1W1IA 3WRXA 3FYSA 3CC8A 3CNHA 2RJNA 2I3DA 4JOSA 4RTPA 6NULA 1QAQA 1SBIA 1V1RB 1GA1A 3ESBA 3MYRA 1N3YA 3IC5A 3ND8A 4KYUA 3FE2A 3OC0A 3WMGA 4A6DA 4R68A 1FVFA 1QH9A 3VHLB 2JLUA 4CT0A 1HOTA 1DVRA 3R8XA 6PFKA 2JANA 4B80A 1G18A 1VZ3A 3LDAA 5KU7A 1JZSA 2G9QA 5ILOA 3AM3A 2JGEA 3F3YA 1ZO8A 2YRFA 2ZU6A 4KJXA 3WKEA 4A2QA 4KW7A 3ROEA 3EXEB 5SYMA 5AHOA 1WV1A 3MW8A 1XFAA 3H1PA 2PEYA 1JGTA 3KUCA 3K92A 1G20E 1X7XB 3G0BA 1D03A 4DIDA 4F3YA 4MMXB 1WLSA 5EHZA 3PI6A 3VX3A 2HQSA 4MYHA 4QOJA 3IA7A 2YVKA 4Z3OA 3HB1A 4DTIA 3U3DA 3IIIA 3TLCA 2NVUA 1JPUA 3AILA 3K0EA 3QQ5A 3TSCA 4FILA 3X1DA 3UAGA 4YMLA 1KFEB 3IURA 2Z8YA 3KJQA 4M89A 3UFXA 5KX5B 2P40A 3COVA 4B3DA 2C42A 2D54A 1NWHA 2JFBA 3S0JA 1I5RA 4BBAA 4UAGA 3X44A 4PXYA 3E9DA 3GMSA 4TS1A 4G4GA 4D74A 4KAFA 5J4LA 3KUXA 1G8YA 1QHSA 4FUQA 3A7EA 3LDGA 1EE2A 5BVGB 5HKAA 3JAKB 2DQ4A 1RJDA 3C6YA 2J0SA 2PX8A 5MFPA 3D9QX 3RR2A 2ERYA 2Q2NA 2A0FA 2Q9CA 1CF2O 2XYPA 2C98A 2YR0A 4ZVSA 4C76A 3I64A 4M1EA 5CB0A 1WX1A 1NIJA 2OCLA 1PFYA 4YJ3B 2NU8A 4E14A 3BJMA 3TLAA 4IHJB 4J90A 4EKIA 2G4VA 1E7WA 2AMYA 3UMVA 4R8RA 1BO6A 1HE3A 1I4DD 4D3YA 1CUCA 1L4FA 4GX2A 2NNLD 3I1YA 4IQGA 5FLKA 4O4HB 5ED0A 5KOYA 2HBZA 3T1NA 2YJZA 2D2FA 4KTTE 3LKVA 2X19A 3V4PB 3WQHA 3WV5A 821PA 2P30A 5HGXA 3N2EA 3PJEA 4RJ2A 3A9WA 3CLSD 1PZGA 1OYVA 4GKAA 4EY3A 3ZDRA 1OKKD 4K7JA 3IPCA 2VHTA 4PPQA 1AB6A 4LGMA 2I2CA 3EXHB 1G7SA 1DQZA 1FP7A 2E1RA 2PRJA 2V6FA 3C4JA 4R9VA 5K8IA 3GLFE 3DXXA 4WGGA 1N8KA 2BR3A 3COWA 5SYAA 4CEJB 2CDBA 3PGVA 2D06A 4UDNA 2C59A 2GI4A 4Q6WA 2C94A 3V46A 4ESHA 4UQPA 2P77A 3SM9A 2Q1WA 1PK8A 1GPUA 1P75A 4B4WA 4PBSA 4GFDA 4N6OA 3V00A 1FMLA 2DWOA 1KH3A 1E62A 2BELA 3G0DA 1PSDA 1CRQA 1NULA 4FFVA 4P58A 1L7DA 4OLHA 4YJ3F 5E7IA 4R0MA 2B20A 4LHZA 1MG0A 3G1WA 3HZHA 3IYLW 2PJUA 3ZBQA 5ALEA 4LQ4A 4RVCA 4O4HF 2FPUA 4GZ5A 4J0EA 2AF4C 2E7ZA 4BVLA 3OCVA 3VNUA 2JC3A 3V7FA 3F6PA 5AI0A 4TMTA 5BN3B 1XL1A 2ECKA 1TEHA 1YONA 4BMDA 1NF9A 2BGKA 3KXLA 2XADA 4Y6PA 2D00A 1DIBA 2ZWAA 3U3JA 4LRUA 3ST7A 4FMCB 5K4GA 2NO5A 5C0OE 1XZCA 1SH7A 3FGOA 5AFSA 1GNLA 4TKUA 3A70A 4WKGA 1D0VA 4FJ0A 3TLXA 4C3ZA 3QX9A 1I4EB 1K27A 2Q28A 5B7GA 3SWWA 1DKUA 4RH1A 2DTDA 3WFIA 3IJEB 3IPAA 1LPMA 3OT4A 4KGZA 3EXIB 3HS3A 3M5WA 3NUZA 4LRSB 4EUEA 3H8SA 3OCYA 3GOHA 3WLKX 2G9UA 2LKCA 4W9NA 4XWOA 2WHXA 4YWJA 3KQPA 4HYEA 1BC5A 4KDRA 4QAJA 3SHVA 3U26A 1Y6QA 4C03A 5HJ5A 1K5GA 4BP9A 4FHCA 4D9HA 4V39A 3KK0A 4NBKA 4G1BA 4KN6A 4ZRDA 4D81A 1GAJA 3ELWA 1L5WA 4TV9F 2XYQA 1PJ8A 3MZ0A 3ZWAA 1BMFD 3FKJA 3QYPA 4P80A 1RXCA 3SS7X 3GC6A 4I8XA 5AGJA 3HB9A 2VHYA 4EITA 2G6BA 5HS4A 1SUFA 1X9HA 3GFVA 3IAM1 3K1AB 2ZE6A 1PKXA 3UMMA 2X8AA 4S0ZA 4HQNA 4EPYA 2Q0XA 1G7TA 3RANA 3I2HA 3O9MA 1J49A 3QW4B 4OGLA 5HQTA 2H0QA 1S01A 3S81A 1PQWA 4M36A 3RFXA 2YMPA 1VI2A 3C3AA 3PQ7A 4GOND 2PKQO 2X9LA 2GBLC 3OZAA 4PSCA 4TRRA 3UWPA 2QUHA 3KHTA 1UPCA 3AMVA 1L7OA 3IXMA 3QPVA 1LK7A 5E6RA 2FNAA 2JF0A 2QQFA 1Q95A 1DAOA 1W0JD 5EN4A 1S9HA 4L74A 5HEKA 2IHKA 4FDUA 4DBVO 3ZJ5A 5KNBD 5KINB 1DJLA 4AY3A 1T4DA 1JIUA 5E3HA 1ICIA 4JV5B 4RORA 1N2SA 2XUDA 3R8CA 2O8CB 2IELA 3L84A 1YVDA 3DE3X 5C4IA 2IYQA 3ZQ6A 2YZNA 4HDRA 4PY2A 1HE4A 2WKWA 3RSOA 3KZKA 1NVAA 5I9SA 5I9LA 3WBFA 1RLIA 3F47A 5IMSA 1LSUA 3JV7A 1II8B 4BWYA 1BWQA 5FF9A 1C3EA 2DLDA 3ANNA 5C52B 1DAGA 1FU8A 4Z3DA 4PCVA 4ZHQB 1ZXBA 4MWZA 5T3YA 3O93A 3QTBA 5IP5A 4K9QA 5JC1A 3IP8A 2XRZA 4BNDB 4GNRA 1T36A 1Z0AA 3BD6A 4IIGA 1NUUA 4OI1A 3N6VA 1GT91 1X9IA 1QB8A 3PUVA 4PG6A 3FPSA 3U3XA 3ZDCA 2QR3A 1S02A 1JHDA 1SQ5A 1PNOA 3QVGA 2DHQA 5JD6A 3SFZA 1MPTA 2FGJA 5CAEB 3KZMA 3ZE7A 4WERA 4YP6A 3MUFA 1XMVA 4RL6A 3AUKA 4FD2A 4DCVA 5AD1A 5HIAA 3Q8MA 4ENVA 4EYKA 3T7SA 4YV7A 1Z0ZA 3B70A 2WWTA 2PLWA 3FYUB 3HN2A 2QM3A 4KITB 4FMDB 1TRHA 1UAGA 2QHXA 2XUGA 3B1KA 4Q4HB 2ZE8A 1HSZA 4N3BA 3M2PA 3ZV3A 5LPNA 4UULA 2QP4A 2CXNA 3IX7A 1OOEA 5E38A 5JTTA 1IZ8A 2PZEA 3LUFA 1UBEA 5EJAA 1HG0A 3UKOA 3B52X 1XZGA 2AGVA 2XPCA 4A26A 2ZT7A 4Y2RA 1A8QA 5AVTA 4EVQA 3RC3A 4Q0MA 3GJTA 2A1TR 3SPXA 4E4TA 4EELA 5CVCA 3OFJA 2D4HA 4YRJA 4FGUA 3IVGA 3G8YA 2MU1A 5DI9A 1STOA 1XHFA 2PBLA 2VT2A 2GNPA 1FCJA 2MR5A 1BS1A 3G1TA 1HYQA 1N6NA 5AJYA 3U2QA 4DIEA 4EJ0A 5GIOE 1EHYA 4GZ3A 1CUEA 4UREA 1CDEA 1OXTA 2C20A 2JFOA 3FTCA 3IMKA 4XWTA 1N6OA 1XMOB 4DLBA 3VZCA 4Z49A 1JMYA 1GVNB 3KIPA 3WXMA 1R9MA 5HUJA 3O3NB 3A9CA 1IB0A 1J2EA 4YBRA 5JCZA 3RCBA 2RGAA 3KETA 4N7JA 5CT6A 5LL6P 1L4NA 2MOKA 1ZA1A 5SZJA 2AEMA 1QUEA 2FUG6 2I91A 4QPNA 4YAIA 1N25A 4YV0A 4BXOB 4NCJA 2GETA 1I7LA 1J8QA 1Z2DA 2NZ2A 2WSSD 5C7OO 2R7LA 5EWMB 3O8QA 2TRSB 2HDOA 3D6MA 4DBLC 1IAVA 2H1RA 4I5GA 2R0QC 3H11A 3LKZA 1QVVA 3L4SO 3H5AA 2HD4A 1Q14A 3PNOA 4M99A 1CEYA 3M6FA 2EARA 2NT4A 3H9GA 4DY4A 4E4RA 2Q3HA 3OEHD 3VJMA 2R2GA 1HYBA 2I34A 3PUHA 4R6WA 2XQIA 2KMLA 4MWCA 4P93A 5GJCA 3ZBTA 1CQJB 1BW9B 3JALB 4REOA 2CBGA 4DC9A 1NBOA 1TVKB 3UCFA 2P78A 1WBJB 3PC4A 2I7CA 1ODTC 3CNNA 3MWLA 2XQFA 4P3YA 1NU8A 5HE9A 1WMDA 5TMBA 2PZFA 2VHQA 3V4ZA 1E99A 1PR3A 5FUBA 1COWA 1GP2A 4XPIA 3S68A 3RVBA 1N6IA 4IGIA 4DLWA 2EFGA 4G86A 5CA0B 4O2BF 1PWXA 2B8WA 3DMDA 4M53A 5BVHB 3A1UA 3PFWO 5THKA 3TW8B 4ABTA 1RWXA 3AHEA 5KTYA 4LWOA 1QBKC 1SXHA 1YKGA 3QVUA 4JH0A 4TROA 4F4FA 3UOWA 1L7VC 4B6RA 5H5JA 3QOYA 3L4KA 421PA 5D3ZA 1ZM7A 1USWA 2NZVG 1G21E 1M2OA 5PNTA 3QU9A 5KOJA 4ZP1A 5J3JA 3SF8A 1ZSNA 1IULA 1FTGA 1YFZA 1VDMA 2PVCA 2PFSA 3HPRA 3P4UA 4YT2A 4RAQA 4HX9A 3W5HA 2LCIA 2COEA 3UENA 4B32A 1XKQA 5A0VA 2AN9A 2J9FA 1U7OA 2HA3A 1RMQA 3BF7A 2AEEA 1JI3A 4Q39A 3UA4A 4M0PA 2ZR0A 1SCJA 4YAFA 1HKUA 2XA1A 5E2AA 3DDWA 3QM1A 5DYNA 3OX2A 4DG5A 1MTZA 1OVGA 2C58A 2P6PA 1O08A 2W00A 3E3OA 4IJWA 4CDMA 5IVPA 3KJIA 1B6GA 2F55A 2CVZA 2YN0A 4FYYA 3ONWA 5EY5B 2PL9A 4WZ6A 4COKA 2C2WA 2VQSA 3EEIA 2O0KA 3MMNA 3AP2A 4NOJA 4AIIA 1M10A 2C29D 2OEPA 5KPDA 3A9TA 1KJJA 2FSVA 4MULA 1F48A 3UO8B 4Z54A 2A78A 2GHIA 4XLZA 2IYSA 5AW1A 5K4HA 3HKEB 4GKJB 2GEBA 1TCAA 1DRUA 3DFIA 5IVIA 1NBMD 1Z28A 3LS2A 4ZIRB 2I4TA 4PNEA 3ZGVA 2H4JA 2Y0PA 1IUOA 3DDOA 3Q8XB 3V4OA 1QGAA 1F6BA 1U9ZA 4QDKA 4YMHA 2X4IA 3FPGA 4XIYA 5AICA 3H99A 1KH2A 1QIKA 1UXKA 2XCSB 2R96A 4FFWA 2A0KA 4F2WA 4ZMRA 5K2OA 5LXTB 1HYGA 1YS9A 3OPYA 2ZQZA 4I0WB 4L0DA 4J94A 1RAFA 5AW8A 3N3AC 1P0FA 2XYVA 3C15C 2IVZA 4MW0A 5DISB 5GADl 1SA0A 1JH8A 1R8QA 2XKBA 4R84A 5EC8A 1YR3A 1BQ3A 2V7WA 3EDCA 4LJ4A 3ESYA 5CLIA 4L8LA 2Z9CA 2O52A 3O83A 3OIVA 1L5HA 2WVAA 1PCXA 2Y0BA 4RIHA 2R25B 2NVUB 2V5AA 1X1SA 1MAWA 2HFKA 3GCXA 4FOTA 4IGFA 3FD8A 4TLBA 1WCXA 1DSSG 1WXFA 4KPFC 4DPKA 3LW8A 1K6IA 1TD9A 4FDVA 5GV8A 2D7DA 1IMOA 2FW6A 3RTEA 1Z4OA 2GEVA 5HMLA 5JJBA 1DC3A 1XZMA 2UYHA 4MKZA 3LZ6A 3DBIA 2D1SA 3LRXA 3SYMA 2OP0A 3FPHA 4Z7OB 5JAUA 5JQWA 1UPXA 4D3ZA 5T8KA 1CUGA 3CX6A 4L0CA 4GAEA 1UXOA 1TOAA 1VG1A 3KC2A 1TC1A 4KMSA 4MLDA 4INZA 5AJHA 3SKXA 1GTRA 1RHJA 2QN8A 3RTBA 3MOGA 4RS3A 1GG5A 4E5VA 2E9SA 4PX5A 3QKIA 4RKYA 3L0SA 3RYFA 2FAXA 3GFRA 1MKYA 2GJKA 4IQFA 1U7PA 3MT9A 3VZQA 1MQSA 3WNZA 4EUFA 5DO9A 4K0KB 2I9PA 3LQ2A 4C1NA 4DDHA 2HA0A 1MOZA 3BK7A 2WOOA 2NU6B 4R9NA 3TB6A 4U2EA 1SRQA 1TPZA 1ZP6A 4PLTA 4BIMA 4ZYUA 1F2TA 1SIOA 2CLLB 4QQNA 2VXBA 1WUHS 1I0ZA 1Z2PX 2YWJA 2CLKB 4P3NA 3E5NA 3THXB 3KEGA 3T9FA 3EPPA 1K1EA 2J30A 4OKSA 1UBRS 2WD9A 3RD5A 2GAAA 4UOQA 2P2DA 3QVVA 1Z47A 1ZXLA 4N5HX 1C9MA 3GJSA 1NBWB 2C92A 2VDNB 3H2IA 4QBIA 2MMCA 1T8SA 4X41A 2AJLI 4XM0A 3SIXA 3CZAA 2ZUVA 1V3TA