1WKBA

Crystal structure of leucyl-trna synthetase from the archaeon pyrococcus horikoshii reveals a novel editing domain orientation
Total Genus 282
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
282
sequence length
807
structure length
791
Chain Sequence
LNFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILDYIIIKFELRENGEVIYLPAATLRPETVYGVTNMWVNPNATYVKAKVRRKDKEETWIVSKEAAYKLSFQDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRETEILEKYDIDPRIVFPAVEEVNKLGIKSQKDKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGIAEIMYEFAEKNVISRFGNRAVIKIIHDQWFIDYGNPEWKEKARKALERMKILPETRRAQFEAIIDWLDKKACARKIGLGTPLPWDPEWVIESLSDSTIYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLEEFSEDKEKELEKKTGIPAEIIHEMKEEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHWPKGIAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-tRNA synthetase
publication title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 282
structure length 791
sequence length 807
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 1wkbA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1wkbA01
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 1wkbA02
3ELBA 5IHXA 1NSYA 4EG6A 1H1TA 1O5TA 1O94C 4GU5A 1J1ZA 4G6ZA 1OBCA 1I6KA 4MQ6A 2H2AA 3ZUGA 3DO8A 1I6LA 4JXXA 4MUEA 2WB2A 3N05A 1ZH6A 4EG8A 2A86A 2E89A 3ILVA 3FHJA 2YWBA 1WZ2A 3MLBA 3AKZA 1H3NA 3HFJA 3K32A 2OQ2A 5H16A 2CSXA 1CT9A 1J70A 3ZGZA 1N2GA 1LI5A 1EFVA 2PZ8A 1KQOA 1YUMA 3TQOA 4Q16A 3D6VA 3IOEA 1K97A 4E1AA 4MW7A 2BYTA 2RE8A 3TQIA 1G8HA 3P0HA 5DK4A 4R2MA 1M83A 1JECA 3HZRA 4NX2A 1JHDA 2NZ2A 4MWEA 3NBAA 3MMXA 4I6GA 1ULHA 5H7XA 2CV1A 1VLHA 4R2LA 4JZYA 3MXTA 1MOPA 3FNRA 4KR6A 2TS1A 3K9WA 4PBTA 1GZUA 1QQTA 1KR2A 4MW4A 1O94D 4UZFA 1QJCA 4ZT3A 2WSIA 2X3FA 1EUYA 4KR7A 2R5WA 2VTBB 4MLPA 1WNZA 4JFAA 1JZSA 3VU8A 3AIIA 4RUKA 3SEZA 4K48A 1EFPB 4TS1A 3COWA 1BS2A 1JIIA 3O0AA 1YULA 1QRSA 1N3LA 4K03A 3L93A 1H3EA 2ZP1A 4YMIA 2DLCX 1O96B 1ZJWA 3IDFA 3CLSC 4MW0A 1ZUNA 3A04A 4DE5A 2WFGA 1WXHA 1WKAA 1FYDA 3NV7A 4XFDA 3M5WA 4A91A 4RPIA 5LLTA 4NAUA 2HGZA 2CT8A 2E0IA 1WK8A 4HJRA 1M1ZA 1JMVA 4U7JA 4MVWA 1ILEA 5TEVA 3ZJTA 4S1OA 3C8ZA 3S3TA 1O97C 2JA2A 2X1LA 2AG6A 5FNZA 1PG2A 2V0GA 3H05A 4G5FA 4KR9A 5AHWA 2J4DA 3P52A 5JBNA 1UFVA 3IUEA 3IVXA 2WQ7A 1R6UA 3IOBA 1O96A 1Q11A 3NBKA 1MJHA 4DDKA 2QUJA 2QJTA 4OUDB 4MVCA 4DNXA 4DLPA 4NAHA 3UMVA 5J58A 2VXOA 3RHSA 1JEEA 3SDBA 1J09A 1F7VA 4I6JA 5DB4A 5AGRA 1UE0A 4ZT7A 1WQ4A 3DLAA 2E18A 2QJFA 1O95D 3FG9A 3HGMA 1F7UA 1U7XA 5KWVA 1QU2A 4L2IA 1PFWA 4MW1A 5J5AA 2PG3A 3CLTD 2A1UB 2I1LA 3IUBA 4EFKA 2IP1A 2CV0A 3ZIUA 4YP5A 1NUQA 4DDHA 1N2HA 1KORA 3GUZA 4MUNA 2O8VA 3LCJA 5EKDA 4MW2A 1O6BA 5KHAA 1MC1A 3TNJA 5LFAA 4ND7A 4MWCA 5FO1A 1KP3A 1O0BA 2JANA 4OUDA 4CDNA 2X0KA 3P0JA 3N2YA 3FOCA 1G8GA 4CQNA 1N78A 1EJ2A 2JAXA 3Q4GA 1MRZA 1U3DA 2O5RA 2Z08A 1TYBE 1M8JA 1F9AA 1TFUA 4GRIA 2DETA 4MWDA 1TEZA 1I6MA 3LE8A 3P0IA 3RK0A 3KT8A 3SYTA 1R6XA 1KH3A 3PXUA 2D13A 1YUNA 3G6KA 4J75A 2XRZA 3FETA 4EG3A 2A1UA 1KAQA 1NURA 4EG7A 1KQNA 1NUSA 1J1UA 4P2BA 4YP6A 4AQ7A 1T6XA 2NSYA 5LM3A 1U0BB 1QNFA 3CVUA 1GTRA 4ZT6A 1MB9A 4AS1A 2DXIA 2AJHA 4F3RA 1XNHA 1IHOA 1YI8A 2J08A 4WNYA 1P7PA 2IELA 1R6TA 3D6UA 1T6YA 3ZXIA 1WXEA 1DNPA 3VRHA 4EG1A 3JXEA 3TZLA 1K92A 3PNBA 1NUTA 4NATA 2QUHA 3G59A 4XSVA 2EJCA 4YP7A 1UDZA 3FY4A 5DEOA 4PBSA 1WY5A 3ZJUA 2H29A 1N1DA 4ZCTA 2PZAA 4EG4A 3AG6A 3PRHA 1PG0A 4FZJA 3CA8A 1Y42X 1GAXA 1J21A 3IH5A 3ISJA 1IH8A 1LI7A 2Z3VA 3ZXSA 1K4KA 3PZ5A 3H97A 4DJAA 4MWBA 2B7LA 3DPIA 3L92A 1O0CA 1VBMA 1QTQA 3X1MA 1OD6A 2WFEA 2GOYA 4MVXA 1O95C 4Q93A 1OWNA 3MLAA 3KFLA 4CDMA 1K4MA 2YWCA 4MAFA 4I6EA 3CLTC 3H9CA 4ZCRA 5F23A 5HG0A 3F3MA 1X8XA 3U1VA 4L2IB 3Q10A 3HV0A 1VBNA 1WKBA 2YY5A 1NP7A 3LOQA 1F4LA 1KH1A 3FI0A 1V8FA 1N77A 3ZJVA 1X6VA 1EXDA 3AL0C 2AJGA 4PBRA 2G36A 3PNVA 1TYDE 5AGIA 4UZEA 4K47A 1NZJA 4OJMX 1KAMA 3KT0A 1D2RA 5J59A 4EGAA 3CVVA 1QRUA 3G5AA 2E21A 4MUIA 3COZA 1WXFA 1VL2A 3FIUA 1IVSA 4NZPA 2D5BA 2A84A 2HZ7A 3IODA 4XFJA 3CVYA 3PZ6A 4MUJA 1T6ZA 2J09A 5TEWA 1JZQA 1MAUA 5K0TA 1I2DA 1U3CA 1QU3A 2J07A 1RQGA 1N2JA 4KPUA 2A1TR 1XNGA 2A7XA 1WK9A 2C5SA 2EL7A 5IJXA 3UC5A 4QRDA 1J20A 1EE1A 2A88A 1QRTA 3IMCA 4R0NA 1T9GR 3AFHA 3IMGA 3DV2A 3SP1A 1YIDA 2QTRA 2D54A 3QTBA 3VGJA 3KT3A 1SURA 3INNA 1OWLA 4BWVA 4HK4A 4JXZA 2A1TS 1WQ3A 1KKUA 3CLRD 1JIKA 4ZCPA 2ZUFA 3CLUD 3PNYA 1N2OA 4WSOA 1JIJA 4ZT2A 1T9GS 1Q77A 3SZ3A 2WQ6A 4HJXA 4YBRA 4ZCSA 1IQRA 4ND6A 2DPLA 3IOCA 4MW5A 1FFYA 1PFUA 1COZA 1OBHA 1EUQA 5AGTA 1GLNA 3CVXA 2Z09A 1XJQA 5AGSA 3N9IA 4ZT5A 2CV2A 2PZBA 3ND5A 5KCMA 2AJIA 1WNYA 1PFYA 2CFOA 3H99A 4G5YA 3E27A 4H3SA 1NI5A 3CVWA 3RBAA 2BTEA 1KQPA 4U63A 4DDMA 3A4IA 2DEUA 2QUKA 1S4MA 1JILA 2CYAA 1TYAE 1N75A 1V47A 5FO0A 3UK2A 3UY4A 1IQ0A 1GN8A 3GLVA 1OWMA 2ZUEA 2CYBA 5HUJA 2QTMA 3FWKA 3COVA 2X1MA 4MUKA 4MUGA 1M8PA 3TZEA 1GTSA 3OP1A 4MVYA 1ZH0A 1NUUA 4MW9A 1JGTA 3TS1A 4CT0A 1A8HA 2XRYA 1WOYA 4MW6A 1U7DA 5TS2A 3BL5A 4HPWA 3RK1A 5AGHA 1MAWA 3Q12A 2QUIA 1M8FA 1WXIA 4J76A 1WJGA 2GM3A 1OWOA 1IFXA 1TQ8A 3X1KA 1YIAA 2J5BA 3OTWA 5TGTA 1WXGA 4QREA 4EG5A 3MUEA 3ND6A 4PY2A 2DUMA 4KPUB 3SEQA 2AZXA 1N2EA 2DR2A 1H3FA 3IVGA 4MUFA 3RJZA 1G59A 4X0EA 1B6TA 2PFSA 3CR8A 1IRXA 2VTBA 3HMQA 4KKVA 2V0CA 2DERA 3I05A 1JEDA 3HL4A 2IJGX 3QTTA 2OV4A 1EFPA 4K0RA 2WFDA 3IMEA 1OWPA 3CLRC 4EF6A 5AGJA 2GKSA 2HMAA 3A2KA 2QTNA 3KT6A 3CLUC 5BNZA 1N2BA 1M8GA 2A4MA 1MBZA 1KP2A 5K0SA 3AG5A 4ZT4A 4ARCA 1PFVA 1NUPA 3A05A 2PXHA 1VBKA 3PZ0A 2RD2A 2CUZA 3QE4A 3CLSD 3GMIA 3UOWA 1Q19A 4F4HA 1KH2A 1M8KA 2AKEA 3FH0A 3ND7A 1MB2A 1TYCA 4JYZA 2CYCA 4QBTA 4NDAA 1NYLA 3IVCA 4MUHA 5HUHA 1G8FA 3SZGA 2PIDA 1Q15A 3N8HA 3H9BA 1IQUA 1N2IA 1LW7A 1GPMA 2QJOA 1O97D 3RFFA 2YXNA 1EFVB 3FDXA 4MULA 1HYBA 3X1JA 3COYA 4ZCQA 1XNJA 4ARIA 5DASA 4U8HA
chains in the Genus database with same CATH superfamily
4MR7B 4GUAA 1L7OA 3H9UA 4PX9A 2G28A 1Y81A 2R47A 2ZR7A 4MV3A 2R8ZA 2HWYA 4P22A 1T25A 2B5WA 2JK0A 1NZFA 4YJHA 1L5GB 4JLKA 2VWHA 1KOFA 3HO1A 1FFSA 2FFAA 3RYFB 3S2EA 5FLXA 2GYWA 1HDCA 1OSNA 1H0HA 1JBQA 1NULA 3UAVA 3PXEA 1G6Q1 2V7TA 3OZEA 4K40A 3ABQB 3JQFA 5TMBA 3WLAA 1Y1KE 2UUPA 1UDBA 3MB5A 4E5VA 3K32A 2O8BB 5JJBA 3T3DA 3K15A 4D98A 3L8HA 1QYVA 2NSLA 3C3PA 4ANFA 4BE7B 2DX7A 1XU7A 2GYUA 3OESA 5H81A 1YO6A 2VKQA 3PLNA 1O4WA 3W77A 4NMWA 5JARA 4NE2A 3OM8A 1O03A 4IDAA 2ZOSA 3HSKA 4F8EA 4H7EA 3KR9A 1HNWB 2EDCA 4J16A 4BIMA 3W6PA 5HGXA 2XCRB 5IARA 1R18A 1ZBDA 2PS0A 1EFCA 2OM2A 4HAZA 5LSAA 4YT4A 2ID9A 3H2IA 3O3NB 5FWYB 4UFPA 1UBHS 3TI9A 4RENA 2QY9A 2H3HA 3SZUA 2CV1A 1SK9A 2IF0A 3FPSA 4PVDA 3PEUA 2EL9A 2H4YA 3IA2A 1VSQA 2DQ4A 4L28A 3ZHSA 3FNRA 1Y3IA 1GDDA 3CF0A 2YNMC 1IWPB 4J03A 2QT9A 2V6MA 1AXEA 4G89A 4MPRA 3S2IA 4AZTA 5TY0A 2TRSB 4DT1A 3WRWA 2VZ0A 3I9JA 4WLNA 5FIUA 4W1QA 3I28A 3GLUA 3VH1A 4O63O 1XD2A 3ENQA 3VZBA 3BDIA 1PR0A 1E0JA 1RJWA 5F33A 4EKIA 3DFFA 4E2WA 1EFPB 4EAAA 3LXMA 1FC0A 2DQSA 5ENZA 3SEFA 3H1GA 3VNRA 1SBYA 3ZCVA 1AHPA 4EHNA 2BWJA 1H3EA 1LDBA 2OYRA 4RGQA 3NDRA 2OGUA 3UC9A 1O96B 1RHKA 2JLVA 2MSDB 4HYYA 1PLJA 1JXMA 2PJUA 4UQPA 4AMUA 4LNUB 4U2KA 3VAYA 4KFUA 5KJFA 1ESCA 3AEKA 1W4AA 3I92A 1VSVA 4UMEA 3ILSA 2WPNA 3WFIA 3Q5DA 3DLCA 2ERCA 4B4VA 1YHNA 4O2LA 5CB6A 4OQLA 1L7NA 1QV9A 1VMDA 2IXDA 2X58A 4MRRA 2IUEA 2GI4A 2OZEA 1JSLA 4RHXA 1I94B 1CQJA 5TEVA 1ZL2A 4OIFA 1E59A 3HDYA 1HKHA 3C8ZA 3CR3C 1EEXB 4Y2HA 2AG6A 5TIIA 2ZYAA 1IG0A 1GRRA 3A36A 4TTPA 4QUGA 1L5SA 2I3GA 4EPRA 2Y67A 2J4DA 1XZKA 1ONSA 5ELXA 4P58A 4YUXA 4OATA 1Z07A 2GPYA 1U31A 2CDBA 4RVGA 4AG6A 4BDTA 1MEOA 1QHHB 4JEMA 4N8SA 3STUA 5BN1A 4F85A 1C3OA 4ZVKA 1YJ8A 1XEXB 2Y77A 3VKVA 1HYHA 4QNMA 3R6GA 4FX5A 3GGSA 3RVLA 3DF7A 2NQ8A 4IOLA 3UB2A 2V7WA 4UUBA 3ROFA 3LYLA 4WXYB 3RODA 5J4YA 3DGEC 4LKRA 1NZDA 3BGDA 2HBYA 1RWVA 2X5JO 1A9RA 3P9PA 3F8TA 5DW3A 3STVA 1H9AA 4E4TA 5HK9A 2G72A 2JFWA 2PTGA 2BEKA 3H3JA 1MXFA 4LX0A 1TUBB 5DIFA 5J2UB 2GZ2A 2IH5A 4ZT7A 2BSXA 3O4HA 1U0FA 1VKHA 3A1EA 4K7JA 2W6NA 2O19A 3VYWA 3GEEA 3EGEA 5KVSA 2JAPA 1NVAA 3JU3A 1TC1A 4BB9A 1ANKA 5A2GA 1JG4A 1TW2A 1JI0A 2D5IA 2GD0A 1TQ6A 2ZVJA 2YJZA 1JIVA 1YNOA 4J3NA 2FMFA 1OYOA 3VHXA 5BUCA 3L8EA 3LCMA 5DX0A 4UUOA 5DV9A 3MTBA 4KRYA 3U3RA 5AVQA 5KTYA 2VOJA 1XJ5A 1ONOA 3M6MD 3QNUA 1L1QA 1P77A 3R20A 2JATA 3Q8WA 4FKBA 1C2TA 4HGYA 1I1OA 4MWCA 1NP3A 1JHRA 1D8AA 1OGYA 3JARB 3TM5A 2GILA 2J9FA 3AQ4A 3NGXA 1C3VA 3DZKA 2WNIA 2C3UA 3SVZA 1Q0ZA 3EARA 1YIOA 5I7WA 1TT7A 1EP2B 1D8TA 1UXGA 3IMFA 4LXHA 5KOJB 2YINC 3DWGA 5EIHA 1NP6A 1NBEA 1TQ4A 2QZ9A 4MCHA 5CP8A 4PRLA 3EODA 3BFXA 4HLQB 4PZZA 2ZBQA 2PY6A 3WKAA 4R71A 2XRZA 3TW6A 3ZWQA 4M0UA 1I3OA 2AK2A 4YI3A 1P60A 3JY6A 2HDOA 3NIBA 2H18A 4TYQA 2F3PA 1VL6A 2CXXA 3QM1A 2XKJE 4YP6A 4JBYA 1HLFA 2PSEA 5LOVB 2K2QB 5EE1A 2NVUA 4DR5B 2FP4A 2OXCA 2Q5EA 2W6PA 4BVFA 3F1KA 2PKYX 1UZNA 1Z5WA 2BKUA 2PDAA 1QYCA 2BD0A 1SU8A 2QE7D 3G8CA 2CN1A 1E9DA 4JLMA 4U7WA 3FGZA 3TJZA 5A7FA 5D7BA 4E13A 5CDUA 5EQJB 4AS3A 1K86A 3SY8A 3OBIA 2A0WA 3LGAA 5F5NA 1A7AA 3NOXA 5LDGA 4MYCA 5MGBA 4KIGA 2BN4A 2R8XA 3SSMA 2H31A 2WJAA 1VTKA 3S8EA 2H16A 1VKJA 5GWXA 5KC8A 4DLTA 2Q5FA 4CF3A 3B6ZA 1U8UA 4R2HA 1N1DA 4I4CA 2OG2A 1XOIA 2O2JA 3AHDA 3LL7A 2BFDA 5ITZA 5IKXA 5EP4A 1EWQA 3VKGA 3QKTA 1ZINA 3E5MA 2PGIA 5BNWA 2NV2B 2ON6A 4OK5A 4DS3A 1USVA 1JVSA 1W93A 1X8LA 4M0EA 4C78A 1J21A 1TA0A 2X23A 5JVDB 4LY0A 4M60A 2P9HA 3ZU2A 2RHTA 5EWMB 3I37X 2ZT7A 1AX9A 4LYAA 3HVIA 3TSCA 1MU0A 4KJZA 3U37A 1GKKA 1YC5A 2IBTA 2Y66A 3M6AA 4AX8A 4FNAA 4IDDA 4RA9B 4IKPA 4CKWA 5JY6A 3BWBA 3BXOA 4TYWA 2VYNA 1NQVA 1OFTA 1ZIXA 3R3ZA 4K9SA 4MYUA 5DLDA 2YWCA 5G4KB 2EW1A 3V7NA 5CK5A 1DCMA 2FMXA 1WIWA 3KSBC 1A4UA 1SQFA 3TRJA 2Z0MA 2WKRA 3GAZA 5AI0A 4AIRA 2SICE 4ZHQA 5F78A 4PW0A 4WY8A 1U2DA 1NP7A 4NU6A 5KSZA 2NIPA 2G5PA 1SC4A 2NTEA 4ND8A 4UE2A 1SXJC 5ARDA 1U9ZA 4MVJP 3KM0A 2QD1A 1N8KA 3N53A 2Q2OA 2QNBA 3VA7A 2DQYA 1G5HA 4YC7A 5I51A 2G36A 1QZZA 1SCBA 3B2NA 3CKMA 2Z58A 1A2BA 1NZJA 2OHGA 3HYLA 5BQ5A 3W2IA 4RABA 2VJNA 1EHCA 2I3AA 5EIXA 1QRUA 1XTJA 1L6IA 4GZ6A 1R5BA 2RI6A 1ZPDA 2XLCA 2ZROA 1AKEA 4TKLA 3CTPA 3O2NA 1JTFA 4U7DA 1JHMA 3C3EA 3GT3A 3R5KA 4XYMA 4BMYA 1K06A 2JJQA 2F3UA 4HQNA 4YYEA 4AMVA 2CVOA 3PRKE 2OCYC 1UK8A 1LV8A 2EJUA 2HZ7A 4X7RA 5BW5A 3PZ6A 2ATVA 1VHWA 3IT0A 1W581 1UXOA 1FDSA 2BGNA 4ADSG 4AXBA 3Q1LA 4F9TA 5JDIC 5KS2A 3L82B 1YZGA 2PXXA 3OEHA 3UHAA 3WHLA 4Z9YA 5ILQA 3ZG6A 5KCZA 2J3JA 3HDVA 3AO0B 1TIBA 3AHEA 4Y9UA 2J3QA 1XNGA 1JYSA 3K9BA 3LCUA 1D5WA 1J0EA 1EP1B 1Z16A 1NYRA 2G77B 2Q62A 2CNKA 2XDAA 5CW1A 4ZEMA 3QIVA 1LSJA 3KKLA 4ERNA 3L40A 3GRUA 3KYJB 4AX4A 4B5KA 4D4JA 4PHFA 3EEQA 3PEVA 2VPQA 4HBGA 2WA2A 2IXTA 1DQPA 3T3PB 4R0NA 4F8JA 3WOVA 1BE1A 3ZWYA 1WR8A 4GDFA 1JG7A 1CUGA 1Q22A 3N07A 3VM6A 1B00A 1GSOA 4JVLA 2DPYA 4UJ5A 5FJIA 1IOWA 3B6KA 1M2VB 4JA0A 4L4RA 4RX1A 4NPHA 3RVQA 1R9NA 4ACBA 4BWVA 4K6MA 4FYJA 5K2OA 3A28A 2NO7A 4PV7A 4Y67A 1TFRA 2C84A 2ZJ3A 3ZBTA 4G37A 3GBSA 3NPMA 4BV9A 2HMYB 2G1PA 4C2UA 1ZOLA 2QQ5A 4Y6PA 4TMZA 5CFQA 2J85A 3BFVA 1S8AA 3PQEA 3VOTA 3AUUA 2JH8A 3SM9A 1QK3A 2ZUWA 2VUIB 4X6LA 5ALHA 2DTDA 2ZTUA 4JY7A 4LCJA 3G8BA 4LBVA 1KMQA 4REMA 4TYPA 4NABA 7ADHA 1AG9A 4GLLA 4MV7A 4JU9A 3H1PA 4LHXA 1GXSA 1EI9A 2DPLA 4IV8A 4KP7A 4ND6A 4BASA 4WD3A 4I50B 3UA3A 3CZ4A 3UXEA 4HNAA 2IOFK 4G1MB 2Q5HA 3PWKA 3Q2KA 5KUTA 4B8WA 1AJEA 1OQAA 3N9IA 4HP8A 1V9CA 4M1KA 2NVOA 3DHWC 1XYGA 3WE7A 5ICGA 2PS3A 1QBKC 2C77A 3K09A 2REBA 2HMWA 4FFVA 4NONA 1GUFA 1PFYA 4Q3KA 4E94A 4WZBB 2QJRA 1ML4A 1C0IA 4JVMA 4WCFC 1NI5A 4G0YA 5CFZA 1KARA 1M6VA 1XMJA 2O7VA 3DDOA 3HFGA 3F6PA 3QF4B 2KWIA 4FYXA 5A3QA 2ZUCA 5IKOA 3JQPA 4MDYA 1JFFA 4XYGA 3EVZA 4GF5A 3K1AB 1RNLA 3KFXA 1ZXXA 4J1NA 3WYFA 3MTAA 4KREA 2NUPA 1NV8A 2LGJA 4J0HA 4XUCA 1UPCA 2HV9A 4RQUA 4YRAA 4S35A 5COQA 1UT8A 2VK4A 1SFRA 1E5TA 5L51A 5K6AA 1BYIA 1HRDA 1XCJA 1QXSA 1B3BA 2XE4A 1M33A 3NW9A 1XN1A 3L84A 4MUGA 2L2QA 5DCLA 5ILOA 1XD9A 4BB0A 4G25A 2JAWA 1L4FA 1EM8A 4F56A 2QRVA 3B38A 3HHPA 3TTXA 1QIJA 1UKBA 5KTSA 1YFZA 3U0BA 1AKVA 2VT6A 3RK4A 5F2OA 4WBNB 5I7VA 2WF9A 4M1EA 2WYWA 5LP6B 3Q3VA 1GITA 1QQ5A 2O4UX 2FF5A 2X5XA 4OB8A 4ZWNA 3M5PA 3MFYA 2Z8YM 4DYDA 3RK1A 1ZP6A 4K6KA 3Q12A 3Q85A 2GJKA 5F9MA 2OFXA 1PJRA 4N49A 2V7QD 2WD9A 3A4MA 3GRAA 3L7MA 4DY4A 5DN9A 5TGTA 2WAOA 4W9RA 3HBAA 1PS9A 2UZ3A 1KBQA 3ETCA 2HSZA 3L18A 1E0SA 1BFKA 4MP3A 2AXEA 3QLUA 4DJFC 4RD4A 2DR2A 1ISHA 1NVEA 2XXBA 1KA9H 2D6FA 4QM7A 2XBMA 2FLKA 4Q47A 2JFNA 1H2EA 2VF7A 4TROA 2H1VA 3PHIA 1IEXA 3HVUA 2IFTA 2O2YA 4LMBA 5KYTA 3FRHA 1SCKA 5FKJA 1F8GA 3AWDA 4JLAA 2O52A 3U7QA 1RXCA 2WUEA 3F67A 4M37A 1QO0D 4ETWA 4K0RA 1Q16A 4RSMA 4RBNA 3V2IA 3MAAC 4PC1A 3ZCPA 2R5FA 4Z0NA 2QF7A 1WPRA 2LD4A 1FW6A 3VX3A 4B09A 1NBWB 1V6SA 2Q0QA 4TVBA 1N2BA 2WJ6A 3VR2A 1HMPA 4OI0A 4WN9A 3RVMA 4OJYA 2VDVE 1CR4A 5G41A 2DULA 4HDMB 1TM1E 2O57A 2VTDA 3HCAA 3FZNA 3O3CA 4ZCTA 4JQYA 4MZXA 1G98A 2GUWA 5F1PA 2PXHA 1ZGHA 1Y33E 2O2ZA 3OC0A 3I30X 2AR9A 5LZ7A 2AN3A 1E6CA 2QT0A 3ROMA 1CJVC 3EVBA 4ZOLF 1RI5A 4H08A 1TYCA 3O4JA 1K3TA 3TRKA 5KYWB 3DMHA 1LS1A 3K5IA 4NDAA 3OC6A 4KEAA 4U7PB 5CB8A 5IDWA 1D07A 1NVBA 5EPEA 2BGRA 1IXRC 3EDRA 2X7JA 3NHKA 3TECE 4YR9A 2YIVX 1JWAB 2Q5OA 2C2BA 3K4QA 1X7XB 3OZRA 4LXXA 4RVFA 3CFYA 4BEVA 3VO1A 4ZVRA 3PXDA 3LM8A 2CLHB 3HK2A 2YXNA 4MPDA 2FZGA 2MYPA 2R7AA 3UUWA 4JD5A 3BKWA 2A59A 4OL9A 1YGPA 1Q21A 3DEIA 3FMIA 2H2WA 3OHMA 2W22A 4I1VA 2X77A 4L16A 1VZ3A 3N70A 5CFLA 3WLSA 3L0PA 2P9YA 2UZAA 1U28C 5DX1A 4ALNA 3H3FA 4TT8A 4NCBA 1WCIA 3T9EA 4NXNB 1C7ZA 1KJZA 1L5OA 3OZVA 3DYVA 1U2GA 4ERXA 2G9NA 5JECA 1TU4A 1J49A 2Z2KA 4I81A 1RAAA 4W5OA 4AYTA 4B0PA 3VTZA 1IB6A 1U4NA 3ZXXA 2F9FA 2XNDD 3M49A 3PC8A 5HRCA 4ZYWA 1U11A 3KPUA 2O14A 3EWAA 3GVCA 3LV8A 5FPTA 4MYTA 2PUCA 1P4GA 1F2VA 3V5NA 3KU1A 3HJAA 3BZWA 3IPXA 3FHJA 3BTOA 4LXGA 3T3HA 2Q4BA 1RXYA 2FUG6 3NLLA 4I9UA 4QTYA 3KR2A 6NULA 1NG9A 2F8SA 2UZ4A 2JEYA 2GCOA 1PLKA 1X14A 3WQRA 2QBYB 2B9VA 1FFXA 4MRAA 3JD2A 4X6XA 1IMJA 2DCUA 3QV1A 2JIMA 5DH9A 3ZY5A 3LDAA 2HCFA 1UJMA 1ZCZA 5HCIA 1E20A 1KHTA 3MA0A 3KYCA 4RVDA 1XTUA 1JFTA 3NEAA 4GOLD 1D2CA 4YS6A 3SE0A 4ASUD 4G0WA 3EJWA 1E79D 3FNGA 2LWIA 4NX2A 2Q3CA 4O4JF 3NAZA 4A8PA 1Y7IA 4PS0A 4UULA 3NBAA 4I6GA 3T94A 1ULHA 3WWCA 1KFKB 1NXOA 1VLHA 3HU5A 3TIXB 2ETXA 2V6BA 1IZ8A 3SX2A 1BTOA 4ZVTA 3BGIA 3QPBA 3K73O 3OPXA 5HZMA 1T8PA 4KH0A 4LDPA 5I9MA 3RTAA 1OGJA 4BGIA 3O1JC 4G5XA 4OB6A 4MW4A 4TWRA 1UWLA 2W4MA 3SEAA 1QJCA 2X3FA 3BJEA 1TEXA 1D6SA 4DCOA 2VHQA 5IXYA 1TD1A 4TTRA 1JAHA 4K48A 1RAHA 2ZB7A 3X1YA 5JS7A 1GKUB 2V7QA 2O2HA 3DJFA 3OETA 1X7WA 1ZZEA 1QGAA 4KGZA 2DLNA 4KIFA 2I1VB 3FYUB 5AJUA 3IPCA 1U3VA 4PF1A 3VC7A 1NRIA 4BVJA 1RZRD 1F17A 3TR5A 1QRSA 4Y9TA 4CM3A 1CG6A 1DG9A 1NC3A 1XZEA 1N3YA 3VNVA 2Y4OA 3NDPA 3RTGA 1PN3A 4TLAA 4H7KA 3RVJA 4XOIA 4LHYA 6ABPA 1I5RA 3UIEA 2EX0A 2AQHA 4AL4A 3MJCA 2HJRA 3T1TA 1JXQA 4JBXA 3SM3A 4UBJA 1W35A 2HHLA 5FAKA 3SIRA 1N77A 1R4AA 1J97A 1IPFA 3L8GA 3LDGA 2I6SA 4G97A 1XN4A 1G5TA 1NYTA 1FIUA 3GB9A 3B2QA 2CFRA 2IOHA 1TZKA 2ASEA 3RJTA 4GL4A 1NOIA 3QFTA 4QJ4A 2FA9A 5IBCA 8MHTA 2EBHX 4YLYA 1P81A 3E5RA 4OSOA 4W9NA 4BNUA 4OXNA 3BBPA 1C1YA 1PW5A 1U8AA 2V5AA 2NTJA 2WP0A 2B30A 2XYPA 1K6MA 3DDUA 1QRRA 2EEPA 2W58A 3MRXA 1FW8A 3A4LA 3MT8A 1FZQA 5AHWA 5AH0A 3X2FA 1T4GA 2IUUA 4IIVA 1NVTA 2OR3A 2DECA 3OQ1A 4JOQA 3ZY2A 1X1QA 4Q3OA 2D59A 3FYDA 1SKUA 1S3IA 3RHFA 4JC8A 4BMPB 2TMYA 2JJMA 4RTJA 1QRDA 3T1HB 3O90A 4KK3A 1CJUC 1PU2A 1YJCA 2G0AA 3HBMA 3WFZA 3OPQA 2I1QA 2ZIGA 4LEIA 2PZJA 1GCGA 5HR5A 2BGJA 4EQZA 3CMMA 2NXWA 4KDFA 1JVBA 3M6LA 4QO7A 2WFMA 1K7FB 1G0OA 1P2GA 3EEIA 1D1QA 1XFDA 3HO6A 1GA6A 3FTPA 3ILXA 4MWSA 2FPLA 1PG5A 3HWWA 2D2FA 4D8XA 3V8RA 2P4SA 1G6HA 3KEGA 4GR4A 4DLUA 3W2TA 3UMFA 3WDSA 1U7XA 4J7UA 4UNSA 1KVQA 2CEAA 3DT6A 5K8VA 3CLHA 5EMJA 16PKA 1EVZA 2BF4A 1C4WA 1XROA 2GJ8A 3UWPA 5JW6A 4J4HA 3ZIUA 1HOTA 3RC7A 1OOEA 1DC4A 1ZJ5A 1Z28A 4UHEA 4CR8A 4WN3A 1A72A 4HO1X 5JAHA 5KX5A 4Y6GB 2HSGA 1ECGA 1GSIA 5EKTA 1QO7A 4BNWA 2QX7A 2BM1A 4PG7A 3TW4A 1UEIA 4DXAA 1DWQA 2TYSB 3V42A 3VPCA 4ZMSA 5LFAA 4I4TA 4D9MA 4F7DA 1XMVA 1QWOA 2X0KA 1AK2A 1VPDA 2AUMA 1L1FA 3UW1A 4C4XA 3OIGA 2F59A 2NO6A 1UOPA 2NYVA 3FOCA 3OURA 4Z2YA 5T67A 1WHTB 1OZGA 3AFNA 1EJ2A 3D64A 1CY8A 2F3QA 4P1ZA 2PRKA 3ZU3A 5TLSA 4YJ2A 3FGPA 2JLZA 2PK3A 4YROA 4DIEA 1V39A 4FCWA 1YS1X 4J9VA 4KLCA 2BMAA 3OFKA 4QQNA 1QFYA 3LE8A 2PV0A 1MABB 1Y3CE 3LHDA 1YUNA 2OORA 3A6FA 3F2IA 5HZKA 5GIOE 4W9MC 2JFFA 1FJGB 4OXXA 5NLLA 4WJKB 1YQUA 1E1RD 4RSGA 4ZYUA 4GYJA 4WXMA 2J8ZA 4G4GA 4KR2A 4UREA 2AN5A 1W49A 1L1EA 3UUFA 5DF1A 4W82A 2I29A 5DTRA 4FEAA 2DAPA 1M2FA 1RACA 4F6RA 3BFJA 4J0EA 4P33A 3VSEA 5ADWA 1JDJA 1DJPA 1FFCA 3MSCA 5CIQA 4LZPA 1PJBA 3F47A 1VC2A 1SQSA 1AKNA 1GLVA 2JD2A 4PYIA 4XR4A 5JJKA 3V7UA 4EATA 4O4IB 5EXSA 2WAYA 4KGVA 4MTCA 5IC6A 3D59A 1XJ0A 2Z1DA 4IKEA 4KJXA 2OXTA 2N0SA 1HE4A 2FSFA 4OP3A 4TWBA 3S29A 3B52X 3GJ5A 3X1ZA 4BLVA 3SMVA 2XTMA 5TC4A 1LFDB 1OFIA 3DVLA 2RCNA 3HCNA 4HDKB 5IAAA 1RZRA 2GM4A 4NBUA 1T5BA 3LCRA 4FFDA 3RRYA 4EQ6B 5ALUA 3ABSB 3I64A 2FPIA 1A5AB 1HFEL 4FGKA 4QX6A 4EJ6A 2NZVG 4PLWA 1G2OA 4GBMA 1AY0A 4LVCA 3PVZA 7GPBA 4MZDA 4KUHA 2R6R1 4UAVA 2P90A 2NO5A 2XUFA 1J2JA 3DMTC 3JAMA 3LUHA 2VQFB 1PG0A 1UBJS 2CZCA 1QKIA 3FJOA 2J1LA 2XDQB 3EIWA 1EK6A 4IGFA 1E66A 2NPFA 1Y1SA 2WRZA 3ONFA 3V8BA 4OEHA 2AKYA 3ZD8A 3CF4A 3Q15C 1CRZA 3GDOA 2HLDD 1VBMA 3OF3A 2IIQA 2Q4DA 1R4MB 3AIOA 4R3UC 4E88A 2ZT8A 2D2XA 4L5AA 1OD6A 3CB2A 2ADFA 1XZ8A 2ZYTX 2H63A 2GOYA 4EEZA 1O95C 1TI7A 1BX0A 4EH1A 2UZIR 4L1KA 5JAQA 1IZ9A 3PD0A 2C9MA 2J32A 2H9AA 2IXFA 1QANA 3NXKA 1P7ZA 3EZ6A 4RIEA 2OXFA 1A9ZA 5DBGA 3QUBA 4YXWA 4MVJI 3N7AA 5EIBD 5BOSA 4QYIB 3NKLA 3EDYA 4KITB 1KJYA 3HRIA 4N5LA 5LXTA 5FEMA 1KDZA 1F4LA 4FB4A 1KH1A 3H1FA 5E7IA 1E18A 3JQ6A 3JALA 3UYLA 1EDDA 3QOFA 4W7SA 4FINA 4AULA 4BAZA 1M2OA 3EHDA 2CNWD 1XU4A 5H4HA 5B3AA 5BWBA 1HF3A 1OPRA 1XRRA 1KYTA 3BFPA 2AN1A 5DYYA 3V9AA 4EHBA 5C8XA 2PUFA 5E6UA 4MVJH 2P62A 2IV3A 5MHTA 3Q5EA 2RHLA 4QRIA 3TM4A 3T99A 5KNCD 3HU1A 2V5UA 1QYWA 1Y7LA 4EHJA 2G0NA 3CNBA 1RCUA 4KXUA 5H5JA 4CF4A 4GMDA 2HK7A 1EWRA 2ZVPX 4TTJA 5AW9A 1TT5B 1M10A 1SG6A 1Y6QA 2B0JA 2ISSD 2JJ8A 3EZXA 1SNYA 2D5BA 2A84A 2VAXA 4XFKA 1MX1A 4XFJA 1KJ9A 4ALMA 5A3JA 3CVYA 3Q0TA 5KMGA 2NTYC 1HQCA 1TJYA 3IEUA 3K2BA 1SBNE 4FOSA 4MYSA 4WKBA 3CUEF 2GBLA 2H5JA 2GVZC 4I36A 5AVUA 2QXYA 1XZLA 3LVQE 1YCGA 2QTGA 3MYYA 1HT0A 3H5RA 3IAS6 4JXKA 4R2JA 3AXSA 5CHEA 1INLA 1KKMA 1SKMA 3QMMA 5DBEX 2ZU0C 4AJPA 3VVLA 1USKA 3RU3A 4AKHA 3MS7A 4EX7A 4A6PA 4H1VA 4WLVA 4RKEA 3LZDA 3VOAA 4UFNA 3CF6R 2Q3DA 2JJ2D 1J20A 4GR9A 2WE7A 2DOKA 1UDCA 3BE5A 3MG9A 4D74A 1H9CA 4MB0A 4G1UC 2BSQA 1XC7A 4DREA 3V9PA 2IYRA 5HEKA 1MOZA 3F6SA 1FF9A 3H0CA 4QXQA 3ZUPA 1WETA 4DUYB 3TLMA 4I14A 1PNRA 4QDKA 4X1KB 4V1CI 4GI2A 1VE1A 3PJRA 1XTTA 2EGUA 3GX1A 4JXZA 1V41E 3AW9A 1RYDA 4I1YA 1XD8A 1DMRA 2O07A 2B6NA 3NTVA 1NM5C 1S5PA 2VAMA 2QE6A 4F5DA 1P5JA 2BTQA 2NUTB 2R79A 3HNPA 5CVEA 2EQ5A 1EFTA 3ZD6A 1E98A 2B25A 4KIUA 3R3UA 4S2EA 1PI3A 3OX4A 3FLEA 4ECEA 3EW7A 3AEQA 1OHHD 1ZISA 2AW3A 4IOJA 4LDRA 4KQ1A 4UOQA 2RGWA 2QUZA 2QPAA 1R0RE 2Y1OA 4RF4A 1COZA 1OBHA 3MVEA 4QJIA 2EZUA 3M70A 3ZDXB 2AUNA 4C20A 3K70C 2R00C 4G84A 4QOIA 3GJ6A 3NB0A 4TL8A 1P3Y1 2C4NA 4HEA1 1PZXA 5BR4A 2G1UA 2WUWE 1CNMA 1TO1E 2PZBA 3PFHA 3BICA 3RS9A 4BNIA 4CL3A 4LN1A 4DA9A 3U13A 1P29A 1GZ5A 3E27A 1GCIA 4NJOA 4CV2A 1ZK4A 3I32A 4QOSA 4YPOA 2D8MA 1SPXA 4ZVUA 1ODSA 2RK6A 1U81A 2QJWA 1TYZA 5CJJA 1U80A 1AU9A 3CPEA 1S4MA 2XIJA 3HP1A 3HXKA 4UDNA 1JJAA 2ROQA 1E7MA 1X7YB 2JPDA 5FI3A 3D8NA 1KZGB 1KEVA 4KR0A 4A5OA 2GHIA 4N3CA 4CLRB 4D6YA 3I2GA 2O7RA 3C41J 3DDNA 1EFLA 3NHPA 4EHIA 3U2QA 3VU9A 4ZGWA 1WZEA 1WSDA 4P4LA 1E3TA 2NSJA 4Y0NA 4UM7A 3DMNA 4YI5A 1S1CA 5IZ4A 3Q2IA 2PU5A 4IFBA 4YRMA 2RHGB 2XZDA 2DFKB 4ZVPA 4BFXA 1QGZA 4OGLA 5KPDA 2FQWA 2P2YA 3T1OA 3I01M 1ZK1A 3ZGVA 2GZHA 1CUCA 1K9SA 1T0UA 5K4GA 4TTAA 4U0KA 5FNVF 1JU4A 3AWIA 3OTQA 1QV6A 2QM8A 4JCOA 2PBRA 4P35A 2WMOB 4IH4A 3VVMA 4JI3B 4DA6A 1AKYA 1JMYA 1N0UA 1SOVA 5TS2A 5B6JA 5IG2A 5IT4A 3MHTA 5AGHA 5CRIA 3WYGA 2VRCA 1W8DA 3D4IA 1YV9A 1UMBA 4YRPA 4BP1A 3OQOA 5M5BA 2OGZA 3HJRA 5CYPA 3CISA 4PONA 2O6HA 4TZ0A 2EOAA 4K9PA 4LJLA 4Y1EA 5ER9A 3OTWA 4LJ9A 3BTSA 3WGUA 1OA0A 2Q3JA 4OXRA 5EJIA 1QTIA 1U65A 3D3EA 4RTRA 4D9GA 4MIOA 3G0HA 1ZJ6A 2HGSA 2K5UA 2F1IA 1OILA 5H1YA 3AR4A 3WTBA 5JZOA 4ZV9A 5HIMA 3OE7A 2XCTB 1CIVA 3DZCA 4YJFA 4HH0A 4CIDA 2EARA 5ALMA 3AZPA 2YMLA 1DBSA 4M55A 3W04A 3RKSA 4HXYA 4OHYA 1UBSB 1Q7EA 2QXTA 4XWGA 3WY9A 2QRNA 3P0RA 2J31A 4ZEWA 3PX2A 3ZIAD 4F4JA 1DBPA 3FSEA 2EZ9A 3U7JA 3KJEA 3MILA 4EUSA 1GIAA 1JX6A 1LK7A 5G0VA 4BLRA 1DO8A 2G70A 1D6MA 3EPJA 5KOHA 3I6ZA 5T6BA 5K45A 3GAFA 2Q4RA 4N7BA 3DL4A 4Z9AA 3JQ7A 3BS4A 5T8KC 4EFDA 5BRNA 2QTCA 4R5HA 4OF4A 3ADKA 4PC3A 1I2MA 2F00A 1WB6A 2EHDA 2D74A 1VBKA 2G80A 3G23A 3ML1A 4JASB 1J33A 4NICA 2YASA 4HGZA 4OQXA 1C41A 2J45A 2XBLA 2C2GA 3AR8A 4MUMA 2X9NA 3JQGA 3F97A 2IYYA 3MPUA 2Q3FA 3D6TB 4N82A 3I0NA 1Y4ZA 3RV3A 3L43A 3Q9LA 2PRIA 2DWPA 4PAOA 4ZU1X 2CC2A 4YWHA 1GG9A 2CHUA 2D2EA 3UN1A 1SCQA 1UBOS 5LDDC 1OLXA 1OMOA 1V8DA 4LC9A 4BB6A 1JHZA 4YRFA 2J0EA 2R6DA 1T4CB 4L4XA 1N2IA 5A4FS 2Q28A 2B6HA 3BE6A 1SBZA 4EITA 3AONB 3I4CA 4H6XA 4FYIA 3I5YA 3H2YA 3FDXA 4MDEA 2UXBB 3FMVA 3H86A 4PZCA 1FLVA 4YPFA 3C5HA 3EFBA 4CCYA 3DEHA 3H2ZA 2XVXA 5D6OA 3C6XA 3QJGA 1IK6A 4I4LA 4BQSA 2WMNB 3NCTA 1S2GA 1CYDA 3DEYX 1JKXA 4DPKA 5DASA 3EW9A 4BP8A 1N1EA 2IDZA 3G68A 4LRQA 1U99A 2CXNA 3WLIA 4P0QB 3L1JA 1O5TA 3N1UA 1YVUA 4TKZA 3RS3A 4DABA 1YS7A 2IPAB 1GL6A 4IZIA 2C96A 1NASA 2V7GA 1YAHA 4FDMA 3M4XA 1E63A 2XHEA 4GYYA 4OHZA 3ZNPA 3ZUGA 1SWWA 2BDEA 3KP1A 4DTIA 3PGLA 1GOTA 1L3CA 5I4CA 4JBWA 1ZOSA 2DT5A 3AR5A 4RGVA 3ELDA 4UOEA 2RBKA 4DSAA 4ZQFA 5JE8A 3FDZA 3WOHA 1S8OA 1TF5A 3OTOB 2YMQA 4BRWA 2H4WA 4Q4HA 4QTUB 5AT1A 1SC3A 3KOZA 5K99A 1XI2A 3EXG1 3EZFA 4B43A 1M1UA 2PSSA 1K2VN 2CNOA 2GLTA 1KQOA 1YUMA 3DDHA 3LPDA 4Y1RA 3H04A 2H52A 4ZARA 3IOEA 4FC7A 5L4LA 3M6FA 4M7RA 4W1RA 5ISMA 1IUOA 1L4LA 1GZ6A 3STTA 1Z4OA 3WWOA 2Z83A 1E94E 1TJ5A 4QOEA 4KQ9A 4EVIA 4ZMBA 4ZOBA 5CPBA 5ALZA 4IHJF 4PYOA 4RH1A 3KKMA 4OYRA 1JECA 3HG7A 4C5CA 5E6SB 3TTYA 8ADHA 3BXHA 3DKPA 1Z0IA 2J9GA 2O50A 3Q88A 4IMPA 2ZWIA 1VGRA 4X24A 1VYUA 4PO3X 1DSSG 2H1IA 2O3SA 1AT1A 5KVVA 4N0PA 3DEAA 4V0KA 2OPHA 1P5HA 4G63A 1WBJB 1IZYA 1QQTA 1KY4A 4CEIA 1JR3A 1UM9B 5HRAA 1UMCB 4WOKA 2O2GA 4M8IA 3M7IA 2V5VA 3GVPA 4MAAA 1QK4A 2WM9B 3KKKA 2EFJA 3CPHA 4X7MA 4FQ8A 1E2UA 2WUGA 2YZ7A 3LD9A 4JFAA 1CHDA 3AIIA 4RUKA 2WIJA 3GGDA 4PSAA 2B4RO 2E4YA 1D3AA 2GZAA 3RQIA 3COWA 3MNFA 5G1PA 4EYKA 3LWBA 2WQZA 1NQTA 1B41A 5MN5A 2Q3LA 1E7YA 3ANNA 2UZ0A 3R75A 1IZZA 3VHLB 2ZI7A 3PD7A 3PE3A 4GVLA 2ZPTX 3R0XA 4D56A 2Z9CA 2ZIXB 3AERB 4OSPA 3LBFA 4WXHA 4PG8A 2FEXA 1AV7A 2XSZD 1HG0A 4JLPA 4ZYVA 3GDHA 2FWAA 4DJ5X 2QUAA 2E6KA 2E2WA 3EVDA 4UEOA 5LD2B 1P75A 2HEGA 2HXSA 4IDGA 1X9GA 1YMUA 3UJNA 3LGSA 3ZWDA 4OGFA 3WS7A 1Q44A 2BUCA 1YFJA 3A3NA 4HN2A 4LRYA 4X65B 3W6ZA 3G2IA 1G5QA 3NM6B 4NU5A 2ZBDA 5CB4F 5G53C 3TSAA 1N34B 4B80A 1XTRA 1PEAA 3L79A 3HBNA 4EMUA 1HY3A 2L0XA 2HIGA 2NN3C 4LC1A 5ENDA 2VDPB 3EASA 3T9BA 3NC0C 1JR3E 4IWYA 2RK3A 5EIFA 5A62A 2DF8A 1Z6AA 3E5NA 5JOQA 4RTMA 5DN6D 4NBNA 1DQRA 2C9OA 2D1RA 4CDRA 4FUTA 2VK2A 3MWFA 4FK8A 4F71A 4HEQA 1QVAA 3LZCA 1EP3B 4XIFA 4B4UA 1XZIA 5B64A 2JHAA 3B5JA 2SKCA 4H7FA 4D02A 3U4GA 4E2FA 2H9YA 1GPAA 4KDRA 4O25A 4K5QA 4KQXA 4BZPA 1GGVA 3M83A 4OUDB 4JJ8A 4S3MA 1KMCA 1SWVA 1FNBA 2O1EA 1GNLA 2QU7A 2X6RA 3F71A 1ORRA 4AZVA 3A11A 3SDBA 3HBFA 1DX9A 2EKDA 4QDOA 4H0NA 4D5GA 1LX6A 1Z6YA 2HT6A 4FWBA 3SS7X 1N6OA 5AHOA 2BGGA 4DR7B 2QG4A 3BMXA 1C7IA 4RXUA 1GQ2A 3C4VA 4HX9A 3QLVC 3PQDA 3AJDA 1YQTA 3HNRA 4LE1A 3WLLA 5JNLA 3I1YA 2XUJA 4G5GA 3LO8A 1EFRA 4RK0A 4RLHA 5GONA 5P21A 4C4AA 3NJ8A 4MW1A 4RKYA 4GXQA 2BR5A 1Z2EA 5KNLA 2VAPA 4WACA 2XKAA 4PANA 3WLJA 2YQ4A 1N2HA 1GO2A 1Q0HA 3ET5A 2I4RA 1TPYA 3MZ0A 1O6BA 2V7PA 2BAGA 5BYKA 1GNVA 1QGUA 1U1DA 5LZ9A 1DE0A 1SUDA 2P1RA 2Q1XA 3NHSA 1AZTA 4Y2XA 5B1HA 2WF8A 4YT2A 1S3FA 1E1QD 1TK2A 4Q9AA 3UYKA 3Q8LA 1VHDA 3K05A 5L95A 3RC3A 3VOBA 3S5JA 1J06A 3TGWA 3U3XA 3VU1A 2JH3A 4C0XA 4TUYB 2KX7A 4EHHA 3AMVA 3SX0A 3VI3B 1L5QA 3NHWA 4DT1B 3OOWA 4FMPA 3OCVA 2Q6OA 1UEJA 1G3RA 1Q1NA 3CRMA 1VM6A 1XD2B 1YRLA 3E4DA 3PT5A 4FZVA 5A9SB 5F3DA 2XUIA 3CW2A 2FMHA 1RLOA 1U7PA 4EDHA 4FT2A 2P3SA 1C8VB 4KQ6A 5K0NA 4F92B 1V35A 5JSQA 4QASA 3CX3A 1ULZA 1HURA 1QP0A 4Q12A 2HV8A 3A70A 3O8BA 4UU7A 2R87A 4JSYA 4LDNA 1KS2A 1PZGA 2H8KA 4P7JA 2IV7A 2F64A 5JSKA 3W8EA 3R1IA 4WEOA 2C8LA 2WSSA 2YOGA 3WDLA 1YTLA 1YR7A 2EWVA 3O4VA 4IZOA 3TPCA 4YT5A 3U4DA 3AEKB 4MQMA 3UV7A 3UUEA 5A0VA 5TGDA 4E03A 4IIJA 1KWGA 1U0SY 1IUNA 5K3SA 4EW6A 4BQFA 3VDMA 4YQZA 2PSDA 3QPUA 1Q20A 3A6HA 5DPMA 3SF8A 2PFGA 1EX1A 3HXPA 4NMXB 4QU9A 1G2IA 1W5SA 2YYAA 2CB0A 3BEOA 4IDEA 1C29B 3RHTA 5IAOA 3MGKA 6REQA 1JF8A 1RMQA 1THZA 4BX9A 1JW9B 4MUYA 2H29A 3DOFA 4N54A 3OSUA 1P62B 1T4DA 4ZVVA 4BQEA 1H6DA 3L7KA 3SXPA 3ZWAA 5CM9C 2VDWB 2VQ3A 3GF4A 3VGPA 2VT3A 5F2NA 1ZESA 1E1LA 1H93A 3G5MA 3LY9A 4L08A 4U4AA 5EXEA 3ZBQA 2IYWA 5IYZB 1W52X 3LX8A 3IRUA 2B69A 4IIHA 4YUAA 1K4KA 4JJAA 3I61A 1B15A 2Q99A 3KR0A 5KBYA 3KVVA 3WRXC 3L92A 2L18A 1O0CA 2C9YA 4W8OA 3ZWPA 4GI7A 1TJNA 2IHTA 1NATA 2Q0HA 4FVTA 2A67A 2R68A 4J43A 4P2GA 5AXCA 1HX7A 5KJ6A 1PEKE 1TEVA 3OPVA 3QE9Y 4MVXA 4ON9A 4R1QA 4EKGA 4DCPA 4YEDA 4XJSA 5DN6A 1AK1A 4YXFA 4S05A 1BW9A 4PYKA 4YJ3F 1LBEA 5FLKA 2JI8A 3VC3A 5BSFA 2CLDX 3F49S 2Z6VA 1ACJA 3FLMA 2WM8A 1Z06A 3LS2A 3OFJA 4LSWA 2H4HA 1X8XA 2ZI3A 5CEFA 2XYRA 5SY6A 4C4RA 4DPLA 2PTHA 4NZOA 4NOMA 2EFGA 2VYCA 1U94A 4DJTA 1SVNA 2HWXA 3E81A 3GRRA 4L9WA 1VJTA 1XP5A 2YBDA 3LVRE 3QSGA 4QBHA 5EHGA 4XLTA 9ATCA 4B0OA 1V6AA 2JLSA 1QFJA 1KMIY 2DQZA 5CT6A 4WFKA 3MWJA 3D8HA 1P19A 1FMCA 1U1IA 2DH6A 2QDKA 3TL3A 1REQA 2OVFA 2XUQA 1OBVA 2ZI5A 4GEGA 3FRJA 4JA2A 4UZEA 5DLEA 3GJTA 2XYVA 3M6XA 4OK6A 4FEYA 4UBNA 4AJHA 1P0MA 4HNTA 3CUKA 1ISJA 2ISCA 4Z8XA 1XDZA 3R0VA 2AN9A 3BMQA 4UAGA 3SC2B 1SZCA 2ES4A 2E21A 1XLUA 2D8AA 1WKVA 3LPNA 1VL2A 4KV9A 4AP9A 2IS1A 1GV0A 3I04A 1OI3A 3M9XA 5HQJA 1BKDR 3AK4A 2I71A 5IXJA 3N2EA 3OZSA 1PR9A 4FDTA 2A9VA 2FFQA 1ACLA 2RSLA 2P8JA 2WBLC 4LF9B 4GBED 3HEAA 1RKQA 5E8RA 5LQAA 5EJMA 1E1QA 4R6XA 2ZVQX 4C2BA 5D5PA 2D7DA 3W90A 2UUBB 3V80A 3N0RA 5G40A 5JZBA 5A03A 1RVDA 2AHOA 4JENA 5DM2A 2NVUB 5AJYA 3U7FB 2FP4B 2XVZA 2Z2XA 1ZOOA 3KCNA 3P9KA 4DMFA 2EQAA 1PSZA 1OREA 2C99A 3K1TA 2IE0A 1VKZA 2A88A 3GJXC 3HLKA 3MCZA 4I5DA 3T6KA 5I3ZA 1UFOA 2HYDA 1GPNA 5CJPA 4PNEA 1IAQA 2HK6A 2OQRA 4EVRA 1EVQA 1YIDA 1QF6A 1DJMA 4PZUA 3UPUA 3LHFA 2ACEA 1MZVA 4YRDA 3DE4X 3HCCA 5CLGA 5CFMA 2IGBA 2BCEA 2NM0A 2ZJ4A 3WLRA 2PRJA 1QIGA 3AU8A 3QLJA 3ADPA 3EY9A 3V4LA 5INTA 4YRRA 2BFDB 5ITZB 2OCAA 4N5DA 1XQ1A 3OOEA 4B4KA 4IDCA 4V38A 4AKSA 4R2IA 5EJAA 1FE8A 4WAUA 4D3YA 2Z57A 4A6EA 1I4LD 4G86A 5L40A 5EY5B 1ZLYA 2XY4A 4BXOA 1KY2A 1WO8A 4I8IA 4LY9A 2VKTA 4EY7A 1DS6A 4NG5A 1WUHS 1J9GA 4MQ5A 5DI3A 1NBMA 2FK7A 2XNCA 3LC1O 3GT0A 5HFJA 5IC4A 5LYJF 1WZNA 1XJQA 4G24A 3T54A 3CT4A 1K27A 2C4KA 3GARA 4RDIA 2IHZA 5C32A 2WTAA 3ND5A 3GOHA 1NNEA 3D8RA 4RY0A 4OD0A 5BQXA 3H99A 4B3DA 4MK4A 3OX1A 4X00A 1DEAA 4TLCA 3ER9A 2QQFA 2ILVA 4OQFA 2CLEB 3ZK8A 4ZI7A 4LHVA 1J8YF 2WUVA 2PKEA 2WMYA 2C94A 2PGXA 5KYUA 5C52B 2FETA 4OLHA 3UJ3X 3AVOA 1NBOA 1FRNA 3HUFA 2YW2A 1IBMB 3SQLA 4GYKA 4ZHQB 1T5SA 4ZAYA 3TLAA 3ZWVA 5CR9A 1ML3A 2IYQA 2P11A 1YZHA 3ETJA 4XVHA 3DBRA 4Z7OB 1X39A 5I8WA 1RRMA 2R8RA 2QEQA 4CMJA 1ZM3A 1PF7E 1KU6A 1VB3A 3KB2A 4QE3A 1Z4MA 2WP8J 3KKOA 3DVQX 3O8RA 1H4VB 1LSOA 3VZSA 4MTLA 1J2UA 1M8PA 4PAMA 1K5GA 1M3SA 3TZEA 1GTSA 3ZHCA 2BELA 1ZYUA 1KYXA 1AHNA 1LLDA 1SY7A 4LGYA 4YFVA 1P5FA 1TCAA 5TF4A 2O3QA 4ZO7A 1V1JA 3NOVA 1UXIA 4RV5A 5BN4A 1NBME 3RSGA 2XRYA 1IBSA 1U8CB 3ETHA 4RIIA 3URKA 2IHKA 5JMOA 2R1UA 3IEIA 2OBYA 2JCBA 1H1DA 1BWPA 2OBLA 3ZE8A 1HL3A 2Z04A 3CHYA 5IM5A 4TZTA 3C8UA 2VJBA 4WERA 3L6BA 3CCFA 1X13A 1K88A 2IX3A 2RH9B 4ZEOA 5EFZA 3MWDA 4EMBA 2TMDA 2XB6A 2E49A 3K9NA 4B2LA 2BMWA 4LXUA 2XCSB 3T7EA 4IOMA 1Y4DE 2F8TA 2HA6A 3K6KA 4DM7A 1RZUA 1IY0A 1AGRA 1HTWA 2JZNA 4D0RA 1EWVA 3UMGA 3OT1A 3QE0A 3GL9A 1H8HA 2VS1A 1OXSC 4J0DA 1JQKA 2VPYA 3R5JA 4RESA 4X0EA 4A1FA 2ZG6A 2YNMD 3HRKA 3SGLA 2GN8A 1N4DA 1ZU5A 3LT2A 5FBWB 3ZVRA 2Q1YA 1P1IA 2W4IA 3BMOA 2B21A 2F1JA 1Y34E 3W5SA 1HDXA 4KWHA 3IBSA 3LLSA 4F1KA 5A06A 3R40A 3QV2A 4ZGGA 4EF6A 5J5VA 2OUIA 1S8NA 2QM0A 4WRRA 1UZLA 1M8GA 2QGNA 2WICA 1IM5A 4JUBA 5BSRA 3IPRA 3JPWA 3TB6A 3FOFC 1RLJA 3O8QA 2R4TA 4CMBA 3AH8A 4ZZ0A 1Y98A 2J3HA 1SVOA 5T4BA 3QP9A 1WW3A 1YE8A 1VRWA 3G82C 3IAM1 4KYUA 4RZQA 4RYDA 1EA7A 2JVIA 3PZ0A 1E6UA 4LDAA 3CONA 1Q19A 4V03A 4UMVA 4L4ZA 4DM4A 1GXSB 3LIPA 3CKKA 4EKNB 5FLYA 4Z3KA 1NR5A 3H84A 2GWHA 4HNAB 3O1LA 5IZCC 3BREA 4EIWA 1PL8A 4KNWA 1CUFA 4JBGA 2EYQA 5C4GB 2B78A 1PZHA 1ZSNA 3OF2A 4OBEA 3UXYA 1RLIA 4PCVA 1Y3AA 3DVSX 4XQGA 4AQYB 2HQ1A 4G8DA 4HB4A 2VYFA 4RD0A 5IJ0B 5ALFA 1UKAA 4A27A 4EO7A 3JQ8A 2CDCA 3P2EA 1RJDA 2FXIA 1GKLA 1UR5A 2HFKA 3STWA 3D5TA 1K6JA 4NCJA 1Z4QA 2I2XB 2E48A 4UVEA 4HAIA 1G64A 1DELA 1SCUA 1XJCA 1JFFB 4L15A 5AHRA 2NUAA 4M9SA 5JNRA 2XE6A 2XMZA 2GPAA 2C97A 5DGDA 5JU6A 2GSWA 3D3QA 3T61A 2KLHA 2NUPB 3C1TA 4CM5A 1M0EA 2I91A 1J0BA 3MC1A 3RYHA 4RVOA 4YMWA 1DC3A 4G67A 1KO4A 1HE2A 1Z36A 1J1ZA 1NAHA 2XLBA 2H2AA 1XT6A 2D2VA 1ZM4A 2NVWA 2PVCA 3RBZA 3VNSA 2WB2A 1ZUIA 3C7KA 3KDAA 1KU0A 2WZDA 3O3MB 1KZ7B 2QRVB 1UMKA 2C2YA 4QWMA 1IXYA 1AMUA 5HE9A 5EP3A 3O03A 4B85A 4R1PA 1WB4A 1C8LA 4CI0B 2M2IA 4QBFA 3MN1A 4FBLA 5JSZA 5ADVA 3A1VA 1UBKS 2VJMA 5D3MA 4EHAA 4CQLA 1B1CA 1PX2A 2PIAA 4JP8A 4MPPA 3PFCA 4R68A 4QG3A 2RONA 1G7RA 2B4QA 1OKKA 2X1HA 4IKOA 4M46A 4MNTA 3KDPA 3VR3D 5HKAA 3UTDA 4YP1A 3IJEB 5KNBA 1V45E 1SVWA 3TQIA 4Q15A 3V4SA 3KQPA 2VJYA 3R7SA 3T9CA 1L6RA 4Z1OA 1WVIA 1E0AA 4R2WA 4O4HF 2NZ2A 3DEKA 1UDWA 2H6EA 4RGYA 4C6HA 3HCWA 2TSYB 5AXBA 5TVGA 3COJA 1JUDA 3FPGA 4MR8A 2W0MA 4JT8A 4LF7B 1QC5B 4ZQBA 1GEEA 4JI1B 3RNOA 4PQRA 4RF3A 2X41A 3HDGA 4D9CA 2UVPA 1KSGA 4N12A 3IV9A 1P1CA 2OD7A 3HA7A 3UK6A 1UZAA 1Z68A 4ZZ2A 1X1CA 4RF5A 2R5WA 4CKBA 3U7QB 3CCBA 3L6OO 3NETA 4M38A 1M75A 1OX4B 2IYVA 5AYVA 3U0VA 3R5XA 2APJA 3LA6A 1EJ0A 1XZHA 2P0EA 1VPTA 2Q3MA 4HTAA 1JE1A 4LRUA 5FORA 3R44A 2HDNB 2PVSA 1O58A 5C34B 1E5DA 2OHHA 1G4UR 1GL3A 2Z8XA 4JKOA 4V0RA 5EINA 5TMPA 2B2CA 1TMOA 1H8EA 1IOLA 5EJ2A 3M1AA 5BN3A 4Q4JB 1J7JA 1RWPA 1YOVA 2AXNA 2Y76A 2Q49A 3R3XA 4WN9B 1SZDA 4BQPA 1XQYA 2YFYA 5TMEA 1SKAA 1XIVA 4I19A 1JJVA 1T4BA 3U3MA 1Z17A 3AM5A 5EEGA 4AC9A 1WKAA 2H5EA 3N2ZB 4MKFA 1VJGA 3M33A 1GAQA 1T24A 1DRUA 1E3WA 4HZGA 4YQYA 2Q7DA 2F43B 2RAPA 1JIQA 1QLHA 1CUXA 4ENRA 2BLLA 4QOHA 4B8ZA 1HFJA 3FNIA 3BRSA 4GPZA 4WNCA 5E3IA 1WUKS 2DBYA 4OLJA 3L0YA 4L3VA 3FNBA 3S3TA 2ATXA 2AJBA 1YA4A 3LYUA 2AF4C 1C3XA 1ORDA 1U02A 1RPTA 3H05A 3LSYA 1V1MA 2RARA 4GP9A 2H2IA 4N1AA 4O2BB 4W1SA 3CH6A 2Q7OE 2I62A 1SJ9A 1E96A 2FZEA 3DZGA 3RVBA 1LK5A 3GZNA 1SZJG 2X22A 2XAUA 4INAA 1CQZA 1R9GA 1L4UA 4Q7MB 4BTVA 2ZDHA 4S1PA 3O31A 2ZJ5A 4L74A 4DG5A 3E9ZA 3GDGA 1WCIB 2N3ZA 1DT3A 1LVHA 3QPCA 4JR0A 1SELA 3EAQA 1YI1A 1PWXA 1YJAA 3F6EX 4LQLA 4BPRA 4HQ6A 4C7XA 3KG2A 2OLKA 3AJ9A 4NAHA 1BQ3A 2HOQA 4JJGA 1HFKA 4XGQA 4Z0TA 1UZUA 1E9AA 2W6JD 3I8OA 2PRSA 3HABA 2XNHA 1ZVKA 3O1IC 2V58A 4G65A 3PUHA 3R2JA 5DWQA 1GD1O 4K6OA 1Y8QA 3JWIA 4OOEA 1Z5GA 3AHIA 5ECWA 1F7UA 1ZRSA 2OESA 3THWB 4Q3LA 5FA8A 1OAOC 3U4AA 4F86A 1V1RB 3LNCA 4EFKA 1A2KC 2GCOB 3F96A 5IVKA 4RSHA 1FFXB 3I9NA 3TNDA 2FJPA 3RYCA 4ENTA 3UMCA 3GUZA 4J0KA 3KYCB 4M1WA 4Q3EA 4YV2A 2Y1LA 1BDIA 1ZGCA 1YCDA 1V7ZA 1DBIA 5IN4A 1QQ7A 3L7AA 1ORVA 3CMCO 2O05A 4N6OA 3VPGA 5K3FA 1SXJD 4CDNA 2ZR0A 1ID1A 9LDBA 4YRIA 2RC6A 3RD5A 4UVHA 2IYFA 1VRCA 2QRMA 2O5RA 4J1TC 1E9CA 4O1HA 4BWGA 1YVPA 2CXTA 1GNSA 1O1YA 1F9AA 4GRIA 3RS7A 1M2GA 2RG1A 1UL1X 4AU1A 4C0JA 4JJFA 1Y6ZA 4ZPJA 4OQNA 2A0KA 3OOYA 2OV6A 5FOXA 5LZ2A 2JFOA 1YQQA 2DY0A 4HADA 4LUCA 1NF8A 1W0KA 1ZH2A 5GINE 3FFBA 1X7WB 3QW2A 3DHEA 4P3PA 5TGZA 2O20A 4M8NE 3FHTA 2YUTA 4PLCA 5L53A 3KKPA 3CINA 1EZZA 1KGSA 1XQ6A 3FZQA 4X92A 4BNKA 5F98A 1C7QA 2HJHA 4HTFA 3KRTA 3ESCA 2I3ZA 4P2BA 4CT4B 4D82A 5FX2A 3CUYA 4IMJB 1WCYA 4UEQA 4W5HA 1RTKA 5EMNA 1JG3A 2PKCA 3ASVA 3TLYA 4I5EA 5EJ5A 4NFHA 5DFAA 3Q3IA 1RYNA 2AV6A 3G2JA 2RGNC 2GDJA 3DAYA 1KC3A 3A4TA 4WNYA 3KQKA 1XZBA 4H77A 1C9JA 4N8EA 3CJTA 1RI1A 3FCXA 3INRA 4DHWA 1TF7A 1OR8A 4PU0A 2J6IA 1WUYA 1HI9A 2XWJI 4MWZA 4WBXC 5AK5A 5EHNA 3BMCA 4PPNA 2ZATA 1J23A 2D4HA 2SECE 2LCIA 5THKA 4CW7A 4QGFA 3CE9A 4JMPA 3HL0A 3AF3A 3VYSB 1II8A 1XDSA 4L73A 1TK9A 4TKVA 1Z0FA 1FDOA 1N5KA 1UEXC 3QVWA 4B6FA 2FDRA 3C4JA 1UOEA 1ST3A 1B8OA 2VN8A 2VSOA 3FPJA 3G6WA 4LQCA 2PGNA 1VG9B 3G1WA 2CJWB 1GUDA 1JLMA 1DTEA 1GSAA 1CUBA 1GGFA 1J42A 3AHJA 3ISJA 3D8UA 4L4SA 3W3AD 3WNVA 3A6GA 2W42A 4IUYA 1ACMA 2PMWB 1H4QA 2RGDA 2R7NA 1QO9A 1U9IC 3DPIA 5JPCA 5CLQA 4Q01A 5FYDA 1YVDA 3CKLA 5A4MS 2RDMA 3LQRA 3OQBA 4EX6A 4YLGA 4AP6A 1FTYA 3LQYA 1UAGA 3MLAA 3PPYA 3D9QX 4X62B 2PL5A 1I30A 4MQFA 4DB2A 1K4MA 4MGZR 3H9CA 2I8CA 2FP3A 3BHNA 3CX8A 4NENA 3SOZA 1LF0A 1E3QA 3GIWA 4NMLA 1MZPA 4FHDA 3QUTA 1DEKA 4D2IA 3I6MA 1K8QA 2FE1A 1HA3A 1PNVA 2FH5B 2QN6A 2PT5A 2IDJA 3OZXA 1IPHA 4M83A 4UXHA 4D3FA 1XA0A 5KYVA 4G23A 5H9VA 1I5EA 2ZW9A 1BXZA 2OBNA 4KYVA 1J1IA 4DNFA 2W6IA 4FU0A 1FTWA 1L4HA 3FSGD 3HY3A 2N47A 2DFTA 4LYDA 2NZXA 4MCJA 2ZCVA 4NIMA 3PRYA 4L0MA 5F2EA 3I9V1 2EKLA 1L5NA 5HSGA 4I4TB 1WAMA 4DB4A 3W05A 2QU8A 2XOKA 1TYDE 5HX7A 1ZLXA 3GWGA 4Z54A 1E69A 1VA5A 4MROA 3WZ2A 1DO2A 3Q7SA 5J59A 3N0WA 1T9KA 1BEEA 1YHZA 3CM0A 4CKCA 2I34A 1WTCA 4YJ2B 1QF7A 2Y6VA 1NOJA 3QPVA 4C7VA 4DZZA 5AKJA 1NXWA 1K89A 1V43A 1ZD8A 2GA9A 3JVVA 3VSCA 2OKGA 3WJAA 2COUA 4DANA 4QXRA 1JDBB 3FIUA 4CFSA 3AM4A 2I2DA 3A4NA 1R64A 1R9MA 5A7GA 3VX4A 3ZX4A 4C4SA 4UPDA 5KQSA 3HH8A 4FWTA 2X4DA 5FI1B 2D5CA 3GFGA 3CU5A 4S04A 4IH9A 1OXXK 2J09A 2ST1A 3SYRA 1ZO8A 1W36B 2JG3A 2CBXA 4YHHB 4E5DA 1SU4A 3NXSA 1XPUA 2Z2IA 1YH3A 2IPNA 3D0QA 3GZ4A 3ISTA 2HLHA 1QG6A 1RQGA 1SXJA 1DAEA 3E82A 4D3ZA 2EFEB 2EP5A 2H9IA 1NJSA 3E8SA 2Z1NA 4DQKA 2C2MA 3GNQA 5HBGA 4F9FA 2B99A 3MRTA 4XA8A 1ZN8A 2EL7A 1L4BA 1WKCA 4BDSA 4KVZA 2VDMB 5JSHA 1VLZA 5KTKA 1DARA 1T6BY 1XAIA 2HNKA 5CA1B 2V1UA 2GEDA 1CUZA 1E3DA 4FJ0A 4WLEA 1JZTA 1ZICA 3C6MA 3IMGA 5DLPA 4HWPA 1JPJA 5K2MA 1LQUA 2WU4A 1JEQA 2D54A 4XH9B 1GG2A 1LSSA 3JX9A 3TZQA 1D4ZA 5EESA 3N3BC 5F2KA 3SJCA 1SU6A 4CF6A 3X0DA 1EXMA 2TECE 2X2EA 2ZJBA 3ACDA 3P97A 4KQEA 4Q1AA 5LWHA 3QA3E 1KKUA 4KQ2A 3O3OB 4N5MA 1WV1A 1Z8FA 3C3MA 3D6MA 2I6FA 4F0JA 5CXUA 2WU1A 4RMHA 2GTPA 3NKVA 3LY8A 1FLDA 2GPSA 1D1PA 4JGBA 4U3JA 1UMDA 1B8PA 4OAQA 3NRBA 5A7HA 4FQ5A 3R0QA 1P73A 3G5TA 3KHTA 5FBQB 2O54A 1T0HB 3UTCA 4J9UE 4EELA 2B5VA 3UT6A 1C5KA 1R0LA 5AGTA 2ZTSA 1KJ8A 2XRFA 4LF4B 1E2FA 2BEUB 3DCJA 5ALJA 4RTSA 4NU0A 1KZYC 4JQCA 2LUOA 3HS3A 3OIWA 4UCXA 4WJLA 2BP7A 1P1RA 4ZT5A 1PJ4A 1T9BA 4WOJA 3U9TA 3I23A 2BFEA 5DU2A 2FX3A 3NIDB 3L1HA 4DW8A 4CPDA 2JD0A 1JJFA 2P7IA 3I2YX 4G5YA 1DDIA 1VKOA 4FHEA 1P5ZB 3LQ2A 4QUDA 2YJ6A 1L1RA 4YGXB 3TRFA 2IEZA 1WMBA 2FEKA 2V7UA 4EVQA 5AW8A 1DUIA 4XZ3A 4DKXA 1PSWA 4X45A 4URXR 3LT1A 1CNFA 2CXQA 4Q34A 1VG8A 3TFOA 3LLVA 4TV9B 4B4OA 3U9LA 3I2FA 1VECA 2GN4A 1AQLA 3JALB 2ZUEA 3A9TA 1KMHA 3R5FA 3AR2A 4V3BA 5DCYA 5HUJA 5I7RA 1M2OB 3I6IA 1LPMA 1A71A 1NF9A 4BYGA 1Z12A 3D2LA 4ZAVA 3ZJ4A 3WIDA 1GFSA 3OP1A 5E6UB 4ZDWA 1WQ1R 2B5OA 1W88A 2L19A 3OWOA 5BSTA 3IE2A 1OLSB 3TRIA 3H83A 1GL9B 3F8WA 2V45A 2BI8A 1OF1A 4N01A 1JLHA 3WSWA 3ZPXA 3BWCA 2B1QA 1R0CA 2ZRDA 2CK3A 1M67A 5IEBA 2UXDB 4KC0A 2IZ5A 3WV4A 3BL5A 2XE7A 2EC5A 1GKIA 3KEFA 3THOA 4BP9A 1V8ZA 4NOJA 1NW6A 2VBFA 4HVTA 5B58C 5KMGB 4QBGB 5A0FA 5K51A 3A9WA 1YIAA 2CFSA 1ABBA 2GLUA 4LDZA 3TPFA 1JA9A 3RRXA 2YJ3A 3ND6A 4RDXA 2GN0A 2V54A 5GVRA 2O5CA 2P5TB 2Q6TA 4NVRA 1BIFA 3N2LA 4LHEA 4NCXA 1O57A 2QZSA 4Y2SA 3PENA 5AVJA 1R0ZA 4YWJA 4E6PA 3RSZA 1EK5A 1HG1A 5D00A 1R5OA 3LAWA 3JW8A 4CLHA 3C98A 2FN8A 3WLEA 2XGMA 3AVQA 4PYMA 1VXRA 2B8NA 1B74A 4JU8A 4FGZA 5E1OA 1KVUA 3KZCA 5C7OO 2JGNA 2GPTA 4ZPXA 2QTZA 3TVDA 4P9NA 2VYVA 2HMVA 3OOJA 3QOYA 4UDYX 1PL7A 5ECDA 4IS2A 1NR1A 3AESB 3IMEA 2W7TA 4ZOAA 3BG5A 1ND6A 3VO8A 1OXVA 1PNQA 4KZPA 1ZOIA 4JV5B 5AGJA 1Z83A 1XVUA 3A2KA 2WOOA 3I73A 4YRLA 3M5CA 5E3JA 3OE1A 4YP9A 3WMRA 1WULS 1RC0A 3FYSA 3GBVA 3DE6X 2OK8A 4JUFA 1QOQB 2BTQB 4LOIA 2R66A 4RS4A 5EHQA 3WI7A 4YRNA 3VQTA 1XZDA 2NQ2C 2ZYHA 3BH7A 4KGDA 4BQOA 4ENWA 2B8TA 4ZEXA 3IERA 1E7WA 3HLYA 2ZE5A 1N7HA 1VMAA 4JCCA 1W87A 1XLWA 4TYMA 1XCPA 2GO7A 3PHJA 5G1OA 4ZOCA 2CL6X 3RWBA 2V7VA 3ZC3A 4WY2A 4BEBA 4JYZA 4I1SA 1R4NA 3V2HA 4TWIA 3ND9A 4WH0A 4BPBA 2QK4A 5CX1A 2DJ5A 1S6YA 1FNNA 2KBEA 2ODTX 1JAIA 1KBOA 4TV8A 3AF0A 4XUEA 2HK8A 3D3JA 3FUUA 5THXA 3CZMA 5G0WA 4P0PB 3C3DA 3ORRA 3S7ZA 5J47A 3HLTA 1H6BA 2VH1A 4JLOA 4YT8A 2KW5A 1IK4A 1QHIA 2IVFA 3Q8XB 3SIWA 1QH0A 3OU7A 1YQ9A 4N41A 4U2CA 1GWNA 2ZIWB 3II6X 5AHXA 4IAOA 3SR3A 1ZZGA 1QE5A 2X4GA 4B32A 4GGPA 4OLAA 4HWKA 1RAFA 1QWSA 4U8HA 1KHHA 4KW7A 5ALPA 1NSYA 1RXUA 1CY1A 9GPBA 3VU9B 2PSFA 1O9HA 2A9QA 4EPXA 4GLJA 3K0FA 5CM2Z 3Q3GE 5FOSA 2BL4A 5B7QA 1LBQA 4DR6B 3H4VA 3HA3A 3M1YA 2ZVDA 4PAGA 2BJWA 2JIPA 4GX5A 3ORFA 3ZU6A 5CBKA 4AMBA 3NOQA 4R54A 2I3DA 3CBQA 3FTDA 3V4RA 2XXAA 5TQVA 1BZYA 4YDRA 1U7HA 3NEYA 5KHOC 1ZUD1 5BN5A 3CJQA 2ZJ6A 1AF4A 1FU4A 1X7ZA 2YWFA 3E9QA 2AJDA 3EXHA 3AUFA 1RRKA 2AMVA 2VJPA 1TVKB 5WRFA 5AVTA 1IULA 5KU1A 4QFMA 1UMBB 3NBQA 1U28A 3NGLA 5E1DA 1ADFA 2HF7A 3PF9A 1V2GA 4M0FA 1NAIA 3CZ5A 2FPMA 3SNKA 4CG3A 1JFSA 1JU3A 3HZRA 1DAKA 1VE7A 4LYEA 3IL2A 1J5EB 4RQAA 4JYAB 4DSZA 2Q5IA 4TLDA 2C61A 2EP8A 2BFMA 2WSYB 4JR2A 3AI2A 1IMOA 3WNCA 1OYWA 3SCZA 1JFLA 3O94A 4RMNA 2IP4A 3MXTA 2QN9A 2IYEA 3NEJA 5DSZA 1BMDA 2F3SA 2PE5A 1EH5A 4YJFB 1GZUA 4DMGA 1UC8A 4AICA 3C6ZA 1G3UA 3GJYA 5JH7B 1FJ2A 1E4YA 3KLNA 5A1JA 1FU7A 1QHNA 1JLLA 3ESZA 3F2VA 1JMKC 3KAQA 4C07A 3SEZA 1UIMA 3FM9A 2I6XA 4TS1A 5J2TF 1M2EA 2QL5A 3L8CA 2CMGA 4JDPA 3RBVA 3B9RA 5ADHA 5BNFA 1V7CA 5HVNA 2VNAA 3DKVA 1M1XB 4GM0A 5IMSA 1EX9A 4PLPA 2YBEA 3ZR4B 5KOHB 3N8NA 3RS2A 5L6MB 4XJTA 3NJ4A 4U8GA 5I7UA 1DXYA 1UJBA 2MU1A 3JQ7B 3GRKA 1KJWA 2JVJA 3BD9A 4FNOA 2PMEA 4QJ3A 3N6RA 4K9LA 4WE3A 3UAOA 3P9NA 3NPAA 1A1SA 4RV4A 5CVCA 5TT0A 1P31A 1FYDA 2Z3ZA 3OEYA 4XVUA 3S2GA 4RVNA 4EOGA 2QTAA 1TEHA 4G41A 1PVVA 3A3PA 3LFUA 4YREA 2F67A 5K0GA 3B3QA 4KO2S 4GIBA 3CEAA 4LVUA 2FOXA 3M2PA 5MFPA 1AH2A 5K01A 4LHWA 4PZLA 4LOJA 3D5QA 5I9TA 4S1OA 2WIKA 3FKJA 1E60A 4UDXX 5DK6A 1QSGA 1JEYA 1UKZA 4LJYA 5FNZA 1LY1A 4FOPA 4DHEA 4G5FA 1H85A 5FUMA 4NPAA 5JNTA 3A6EA 2CXOA 3Q7IA 2J59A 4FDAA 4L5JA 521PA 4E33A 2CMDA 2A9PA 3D2AA 2VHCA 1MD9A 3LNTA 4HDQB 4K9NA 4KU4A 4R1SA 3AUKA 3V7WA 3ZBPA 4DNOA 5JBNA 1FS6A 4CCYB 2BFPA 4MS1A 4RZSA 3VV3A 4MLCA 4TUYF 1DRWA 1Y9AA 2OGSA 2CJXA 3IOBA 2E6UX 4GE0A 4FZRA 3TFWA 4EMTA 3Q7EA 5JQGA 3BRWA 1VJRA 1R0YA 5CNKA 1KPHA 4HQRA 4YCNA 2NXEA 3TOZA 1U8EA 1RQPA 5U4QA 4CODB 2PL3A 5HKKD 3T7KA 2J67A 5HYVA 1J09A 3BK2A 1R0WA 5FBHA 1E0DA 2MMGA 4TTQA 5LKAA 5EA2A 3ROXA 3IKMB 1V96A 2DFDA 3OZUA 4JXJA 2PLRA 5LBIA 3HWX1 4HD8A 3FDZB 1O95D 3UBTA 1EP9A 3C5VA 2X0NA 1HGXA 1DGQA 1QU2A 1NR7A 4R5MA 4Q4HB 3SBEA 3TN7A 1X92A 1V2HE 4FCTA 3LC7O 3IUBA 2XDWA 1DC8A 1XAGA 4Y1RB 1LBSA 2VH2A 3IEKA 3SHVA 3VPHA 2UDPA 1OFUA 2YICA 4QNRA 3ZEIA 3K31A 1FY2A 1AZSC 5J4LA 4FD2A 1IU9A 3D0RA 4OQEA 1GCUA 4CYMA 5JSUA 3FIJA 1WP9A 1KFBB 5F7XA 1QDLB 3N2YA 1U2PA 1KZ9A 2OV1A 4KB5A 1Z4PX 3VH2A 5CNJA 4FMDF 1XRLA 4DIUA 3GU3A 3BERA 3FPLA 1NE7A 1UFQA 2I5PO 1KK0A 5HF8A 1X1EA 2F7SA 2C95A 2O7SA 4MYRA 3IJRA 2ZBPA 5DRTA 2CL7X 2FRDC 3S70A 4C0SA 4UKDA 2VHTA 3T12A 5JXHA 1ZL0A 2DKNA 5EZYA 3UJBA 3VR4D 3E1SA 3P0IA 1SG0A 1GU0A 1MJGA 3E1KA 3L6CA 2W4QA 4WESA 5IYZF 1ZY2A 2HDWA 2EWMA 3SQDA 3TRHA 4DBZA 3CXUA 1O5OA 1RWKA 1HSZA 4MQBA 2H7YA 3ZWOA 4AJLA 3SIPA 4A2PA 2FR1A 4UUNA 5B7NA 5BR8B 2FW9A 3BK1A 4UUPA 2HPVA 3ZGNA 1J1UA 1M7HA 4BJ1A 1KDOA 2WWRA 1U0EA 5JI2E 3VDNB 2Y05A 3IX7A 1TVCA 2G1JA 4E5KA 3MUOA 4NCNA 4YMHA 2QI9F 1U0BB 3I4FA 5GJCA 1QK5A 1JWBB 1J8FA 5H0IA 2J08A 1SIOA 4M9CA 3W1VA 2P6NA 4L6AA 2W43A 4NBLA 4OYYA 2OC9A 1G5PA 2AQIA 2EFCB 3F6RA 5TVKA 4KAXA 1WXEA 2IZZA 2VHZA 1OAAA 4UNNA 3A58B 2BM8A 2WOJA 3CBGA 3JXEA 4G4SP 1XE3A 1K92A 2GO1A 4RQTA 3HYCA 1B1AA 1YS6A 2OO5C 3HZHA 2LKCA 4GLOA 3C3YA 1B73A 2ZUVA 3FKSD 3ICCA 2ZB4A 4JEUA 4ZDIA 1ZD4A 2BCJQ 3GGJA 3NFRA 3WHPA 3N8KA 5C8YB 1SUFA 3KE9A 3D8SA 5T4HA 4CMEC 1YQXA 1P1KA 1VIMA 1Y1LA 3DTVA 1X2EA 3P20A 4K2HA 1JJ7A 4W6QA 3RVOA 1F06A 1PYOA 4L0DA 4EG4A 4ZRMA 2CWWA 2FPGB 2I2FA 3LXRA 4FZJA 4HEA6 4II3A 4Y2TA 3C6QA 1E9SA 4IICA 3ZD7A 3RAEC 1GZ3A 1ZHFA 1Y3BE 4OO3A 3DO5A 1NI4A 3JAWA 1NW8A 4I2VA 2DLDA 2M6SA 1NLYA 5IAEA 5AIBA 4WVLA 3IB6A 1UODA 2VPIA 1CVIA 4F60A 1CRQA 2VRWA 1I1QB 1QTQA 4Y6OA 1BE0A 2X15A 1OFGA 3HR8A 5KINB 3K70D 1W0CA 2PWYA 4XE5A 1GNQA 3U4CA 3LGXA 1JTVA 1UM8A 1USGA 2OILA 4PGFA 3EIOA 1NWHA 3AKCA 3IUJA 2JBAB 2P5SA 1H2HA 4ND4A 5IK2D 2KBFA 4HZUA 1A8SA 5LUAA 2G8NA 1T9CA 1T1JA 5FHQA 3TJRA 2ZKLA 1ZNZA 5GONB 4HXFB 2AI3A 3U1VA 3SKVA 3VYTB 3U5TA 1XB2A 4BS9A 5KREA 3R9XA 1CUEA 1CEQA 2BR4A 4X20B 4C0HA 1NN5A 3EQ6A 3LOQA 1XFAA 3ZCTA 2KE5A 1XMXA 3M4NA 5KYYA 1T3HA 2WTNA 1QGUB 2ID8A 3PJGA 1EXDA 4QBIA 2QTWB 3GQBA 2M6RA 3PPWA 3VC1A 4TMTA 1KBZA 2V7XA 1QHYA 4G4SO 1BYUA 1Q1BA 4KN6A 4MVJM 3DHNA 2PH5A 5C5EA 1DOZA 1AOXA 2FSHA 1M6NA 2PGLA 2B8JA 4AUKA 2B92A 2XEXA 5F76A 2MYUA 2PWBA 1KEUA 3EF3A 4WXRA 4DRZA 6ADHA 1M74A 3ASZA 4GRDA 2YC4C 3KSAC 3AUSA 2JH9A 5I5GA 3LHIA 4NHEA 2EXXA 1Z7WA 1VYTA 4KNVA 5T64A 3SJZA 2VBIA 3O9ZA 2J9ZB 1R5JA 1ORWA 3IODA 4RELA 4UM8B 3EZ2A 1CXZA 3GR6A 1K7EB 4M6WA 2HRCA 3RRBA 4L51A 4E12A 3SC4A 3W6NA 3DZBA 4JLJA 2Y0DA 3GLTA 1QGDA 5K0TA 4JT9A 5DHTA 3CIFA 3NIGB 2CVPA 4AURA 3MJEA 4A6XA 4BNFA 5FEUA 3ZOZA 2ARKA 1YS4A 4B82A 4JS0A 4HLNA 3G8DA 1LF5A 1M6YA 4HYQA 5AJZA 4EEXA 2C5SA 1VL0A 4TRMA 5DNWA 5G1NA 4BEJA 1CF2O 2P9TA 3LI2A 3SLKA 5TPZD 1T0JB 2H0AA 2AUTA 4XQCA 1W48A 3T7AA 4EG0A 4O4LF 4F11A 3CVOA 3OVMA 4IIJB 3N5CA 5DM4A 4M1SA