The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
73
|
sequence length |
216
|
structure length |
216
|
Chain Sequence |
DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and mechanistic studies of Escherichia coli nitroreductase with the antibiotic nitrofurazone. Reversed binding orientations in different redox states of the enzyme.
pubmed doi rcsb |
| molecule keywords |
Oxygen-insensitive NAD(P)H nitroreductase
|
| molecule tags |
Oxidoreductase
|
| source organism |
Escherichia coli
|
| total genus |
73
|
| structure length |
216
|
| sequence length |
216
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
1.5.1.34: 6,7-dihydropteridine reductase. |
| pdb deposition date | 2005-01-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00881 | Nitroreductase | Nitroreductase family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | NADH Oxidase | NADH Oxidase |
#chains in the Genus database with same CATH superfamily 1V5Z A; 4TTC A; 3BM2 A; 1F5V A; 3X21 A; 4QLY A; 1YLR A; 5KRD A; 1KQC A; 4BN9 A; 4QLX A; 1OO6 A; 4EO3 A; 5J6C A; 2YMV A; 1DS7 A; 2ISK A; 4BN6 A; 1NOX A; 3H4O A; 3QDL A; 3EOF A; 4XOO A; 2R01 A; 3HOI A; 1YKI A; 2FRE A; 1OOQ A; 3GE5 A; 4BN8 A; 2ISL A; 4URP A; 3GFD A; 3GE6 A; 2BKJ A; 3N2S A; 3KOQ A; 3GFA A; 4G8S A; 3GB5 A; 1V5Y A; 2I7H A; 3GAG A; 3M5K A; 3TNZ A; 3K6H A; 1ICV A; 3HJ9 A; 1ICR A; 3OF4 A; 1VKW A; 1OO5 A; 3EK3 A; 3GR3 A; 3E39 A; 3TO0 A; 3E10 A; 3G14 A; 3BM1 A; 1YLU A; 2IFA A; 1NEC A; 4XOQ A; 1OON A; 3BEM A; 3EO8 A; 2WQF A; 3PXV A; 5KO8 A; 2WZW A; 2B67 A; 4BN7 A; 1YWQ A; 5HEI A; 1BKJ A; 1IDT A; 1KQD A; 1KQB A; 2ISJ A; 3KWK A; 1ZCH A; 4DN2 A; 4BNB A; 3X22 A; 3GH8 A; 3EO7 A; 5HDJ A; 1VFR A; 4XOM A; 1ICU A; 3HZN A; 3GBH A; 2H0U A; 2WZV A; 4TTB A; 2HAY A; 5KO7 A; #chains in the Genus database with same CATH topology 1V5Z A; 1J6R A; 4TTC A; 3BM2 A; 1F5V A; 3X21 A; 4QLY A; 1YLR A; 5KRD A; 1KQC A; 4BN9 A; 4QLX A; 1OO6 A; 4EO3 A; 5J6C A; 2YMV A; 1DS7 A; 2ISK A; 4BN6 A; 1NOX A; 3H4O A; 3QDL A; 3EOF A; 4XOO A; 2R01 A; 3HOI A; 1YKI A; 2FRE A; 1OOQ A; 3GE5 A; 4BN8 A; 2ISL A; 4URP A; 3GFD A; 3GE6 A; 2BKJ A; 3N2S A; 3KOQ A; 3GFA A; 4G8S A; 3GB5 A; 1V5Y A; 2I7H A; 3GAG A; 3M5K A; 3TNZ A; 3K6H A; 1ICV A; 3HJ9 A; 1ICR A; 3OF4 A; 1VKW A; 1OO5 A; 3EK3 A; 3GR3 A; 3E39 A; 3TO0 A; 3E10 A; 3G14 A; 3BM1 A; 1YLU A; 2IFA A; 1NEC A; 4XOQ A; 1OON A; 3BEM A; 3EO8 A; 2WQF A; 3PXV A; 5KO8 A; 2WZW A; 2B67 A; 4BN7 A; 1YWQ A; 5HEI A; 1BKJ A; 1IDT A; 1KQD A; 1KQB A; 2ISJ A; 3KWK A; 1ZCH A; 4DN2 A; 4BNB A; 3X22 A; 3GH8 A; 3EO7 A; 5HDJ A; 1VFR A; 4XOM A; 1ICU A; 3HZN A; 3GBH A; 2H0U A; 2WZV A; 4TTB A; 2HAY A; 5KO7 A; #chains in the Genus database with same CATH homology 1V5Z A; 1J6R A; 4TTC A; 3BM2 A; 1F5V A; 3X21 A; 4QLY A; 1YLR A; 5KRD A; 1KQC A; 4BN9 A; 4QLX A; 1OO6 A; 4EO3 A; 5J6C A; 2YMV A; 1DS7 A; 2ISK A; 4BN6 A; 1NOX A; 3H4O A; 3QDL A; 3EOF A; 4XOO A; 2R01 A; 3HOI A; 1YKI A; 2FRE A; 1OOQ A; 3GE5 A; 4BN8 A; 2ISL A; 4URP A; 3GFD A; 3GE6 A; 2BKJ A; 3N2S A; 3KOQ A; 3GFA A; 4G8S A; 3GB5 A; 1V5Y A; 2I7H A; 3GAG A; 3M5K A; 3TNZ A; 3K6H A; 1ICV A; 3HJ9 A; 1ICR A; 3OF4 A; 1VKW A; 1OO5 A; 3EK3 A; 3GR3 A; 3E39 A; 3TO0 A; 3E10 A; 3G14 A; 3BM1 A; 1YLU A; 2IFA A; 1NEC A; 4XOQ A; 1OON A; 3BEM A; 3EO8 A; 2WQF A; 3PXV A; 5KO8 A; 2WZW A; 2B67 A; 4BN7 A; 1YWQ A; 5HEI A; 1BKJ A; 1IDT A; 1KQD A; 1KQB A; 2ISJ A; 3KWK A; 1ZCH A; 4DN2 A; 4BNB A; 3X22 A; 3GH8 A; 3EO7 A; 5HDJ A; 1VFR A; 4XOM A; 1ICU A; 3HZN A; 3GBH A; 2H0U A; 2WZV A; 4TTB A; 2HAY A; 5KO7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...