The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
90
|
structure length |
90
|
Chain Sequence |
GSMSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure, dynamics, and membrane topology of stannin: a mediator of neuronal cell apoptosis induced by trimethyltin chloride.
pubmed doi rcsb |
| molecule keywords |
Stannin
|
| molecule tags |
Membrane protein
|
| source organism |
Homo sapiens
|
| total genus |
25
|
| structure length |
90
|
| sequence length |
90
|
| ec nomenclature | |
| pdb deposition date | 2005-06-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09049 | SNN_transmemb | Stannin transmembrane |
| A | PF09050 | SNN_linker | Stannin unstructured linker |
| A | PF09051 | SNN_cytoplasm | Stannin cytoplasmic |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | MYOD Basic-Helix-Loop-Helix Domain, subunit B | membrane protein stannin |
#chains in the Genus database with same CATH superfamily 1ZZA A; #chains in the Genus database with same CATH topology 2YPB A; 1NLW B; 5I50 A; 1R05 A; 4F3L A; 2LFH A; 2YPA A; 2YPB B; 1ZZA A; 4H10 A; 3MUJ A; 4F3L B; 2MH3 A; 1MDY A; 2YPA B; 1AN4 A; 1NKP A; 1AM9 A; 1A0A A; 1UKL C; 1AN2 A; 5I4Z A; 1MDY B; 4H10 B; 1K1F A; 1NKP B; 4ATH A; 2QL2 A; 1HLO A; 4ATI A; 4ATK A; 1NLW A; 2QL2 B; 4AYA A; 5EYO A; 3U5V A; #chains in the Genus database with same CATH homology 1ZZA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...