4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
b'SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMAL1b
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/activator
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
1OTIA 4DJ2A 1XJ3A 5I5LA 2QL2B 3UMEA 1T18A 3LI8A 2D01A 2V0WA 1P97A 3LICA 3F1PA 2INWA 4H6JA 4WL9A 3LUQA 5HWVA 2Z6DA 5HWWA 3CLOA 4LLOB 1UWPX 1TS0A 2V0UA 3VOLA 4GHIB 1MDYA 4WF0A 3P7NA 4EEUA 1V9YA 5HSQA 2WKQA 2YPBA 1S66L 4ATHA 3A0VA 1TS8A 4HNBA 1OTEA 1X0OA 1T1BA 2QHKA 1GSVA 1UGUA 2YKFA 1NLWA 5IU1A 1N9LA 4LPZA 4HH3A 3BY9A 4JGRA 4GW9A 3D72A 1P0ZA 1XJ6A 1DP6A 2CMNA 1F98A 3EWKA 5DJTA 3NJAA 1VB6A 1UWNX 1N9NA 2L4RA 3GECA 5J7EA 3FG8A 1AN2A 4NXGA 5DKKA 5F5YA 4HJ6A 4HJ4A 1NWZA 1TS7A 3RH8B 3U5VA 3LIAA 3MFXA 2ZOIA 3MJQA 5I4ZA 2VLGA 1OJGA 1S4SA 2PYPA 1LSVA 5J3WA 1S67L 4I39A 1LL8A 4HOIA 2P7JA 2H28A 1R05A 3H7WB 3MXQA 4HP4A 3LI9A 5TBMA 4XT2A 4HH2A 3PYPA 4I3IA 1KOUA 3K3DA 4WN5A 2VV6A 5I50A 3LIFA 4EETB 1T1AA 4R38A 3BWLA 5G4YA 4WUJA 4HHDA 5AVFA 1OT9A 1D06A 5HDCA 1Y28A 2JN7A 3H9WA 1XFNA 2VEAA 3C2WA 3ICYA 4LRXC 1TS6A 4L9GA 3F1NB 4LRZE 4YWZA 2Z6CA 2W0NA 5KIZA 4LRYC 1DP8A 4GHIA 1OTBA 1LSWA 3MQOA 4B9OA 4GS9B 3F1OB 4L9EA 1UKLC 1V9ZA 4I3JA 1AM9A 5EYOA 1OJ5A 2V1AA 5HZHA 1NKPB 3HJIA 2YPAA 4KUKA 2QJ7A 3NOTC 1N9OA 4HJ3A 4MN6A 2A24A 2OWJA 2BASA 3K3CA 3UB8A 4I3AA 3LIBA 5HDSA 5F68A 1G28A 4KUOA 5IS1A 1MDYB 2QJ5A 4BBVA 4HQAA 2PHYA 2PYRA 5AVEA 5J4EA 1D7EA 4L9FA 4EEPA 2KX6A 3ZQ5A 3HJKA 1NLWB 4EW7A 2VV7A 1OT6A 2V1BA 3H7WA 5DJUA 4MN5A 3LYXA 4H10A 2QKPA 4R3AA 2PD8A 3LIDA 4GCZA 2OWHA 3NOUC 1XJ2A 3E4OA 4K08A 3IS2B 3BY8A 2HV1A 3LIEA 1XFQA 2R78A 1MZUA 4EERA 1S1YA 4F3LB 1EW0A 3E4PA 1OTDA 4PKYG 3CWFA 2M1CA 3NHQA 2VV8A 4NXBA 2I9VA 2QL2A 3H82B 2QWSA 5HDDA 3VE3A 3ULFA 2MH3A 1T1CA 4DJ3A 2OOLA 2WKPA 2PD7A 4AYAA 5TBMB 4BBUA 4XT2B 2L0WA 4WLAA 1A0AA 2ZBBA 1T19A 3UB6A 3A0RA 3PHYA 1S1ZA 4E04A 3RTYA 5HD5A 1XJ4A 3UE6A 2ZOHA 3NOPC 4EXOA 1NKPA 3UMDA 1LSXA 2V9AA 5DKLA 1AN4A 2JHEA 4NXFA 2LFHA 2WKRA 3MUJA 4KQDA 2YKHA 3F1PB 4JGQA 4H6JB 1GSXA 3IBRA 3KX0X 1BYWA 1DRMA 3T50A 5EFWA 4R70A 3C8CA 1HLOA 5HWTA 2EA9A 3SW1A 1GSWA 4R6LA 5HD3A 2YPBB 2YPAB 3FC7A 3OLOA 3G6OA 5F6AA 1WA9A 2PDRA 3CAXA 2J80A 1F9IA 2A24B 4I5SA 4HY8A 4NXEA 4JGOA 3MR0A 2PR6A 4HIAA 1OTAA 4EESA 4EQ1A 2W27A 3IS2A 2D02A 3EEHA 5G4ZA 4ATKA 2K7SA 1LT0A 4F3LA 1S4RA 4HI4A 3E4QA 4M4XA 4BBTA 3H82A 1ODVA 4I38A 4ATIA 3A0SA 1DP9A 4HP9A 3F1NA 3B33A 4H10B 4RQ9A 3UB7A 3MQQA 4JGPA 2GJ3A 2L1MA 1JNUA 4PKYA 2KDKA 3GDIA 2B02A 4GS9A 3F1OA 5F69A 3VE4A 2PR5A 5A8BA 3UB9A
chains in the Genus database with same CATH superfamily
3TSGA 1BULA 3IWOA 1BTLA 3UMEA 1T18A 2PU4A 4E6XA 1P97A 5A90A 3LICA 1K57A 4X25A 4MLLA 2INWA 3DTMA 1KE3A 5GLCA 3VSKA 1UWPX 4WF0A 3P7NA 3VOYA 1O7EA 3HUNA 1EROA 1U60A 3UDIA 2YPBA 1S66L 4ATHA 1OTEA 3AGDA 3W4OA 1GSVA 5L10A 5E2GA 4IBXA 4PPRA 1RGZA 2YKFA 1NLWA 3N8LA 1VEUA 1N9LA 4LPZA 3BY9A 4GW9A 3D72A 3MS6A 3KSGA 4P6ZM 1IYOA 2FZ0A 2HGVA 3NJAA 1N9NA 2ZQCA 4FH2A 2L4RA 2ZMAA 3IXHA 4NXGA 3Q7VA 5F5YA 1RCJA 3IH8A 3N6IA 3RH8B 3U5VA 3MJQA 2J8YA 5I4ZA 3IF5A 1OPXA 3IX3A 4N9LA 1LSVA 1ZG6A 4R0QA 5CTNA 1LL8A 2PU2A 2P7JA 2HJEA 4MNRA 2OLUA 1GA9A 4HP4A 3HLWA 1HD8A 3PYPA 3K2NA 1KOUA 3K3DA 4C3QA 3G34A 2V2FF 4LV0A 5I50A 2BLSA 1KGEA 2K2NA 4HBUA 5CTMA 3BWLA 2C5WB 4FOFA 5GLAA 1XX2A 3DBAA 5E2EA 3SOIA 3BW6A 1D06A 1Y28A 3SS4A 4JXWA 2Y2KA 3HLBA 5DTSA 3VP4A 3NCKA 3CHWP 3H9WA 1XFNA 3C2WA 3N8SA 4LRXC 1TS6A 3U2AA 4WBGA 4L9GA 4QY6A 1PZOA 2W0NA 5EVEA 1K56A 2UWXA 3V3RA 1PNEA 4OP8A 1GHMA 2VKSA 1FCOA 4OPQA 4KZAA 4KQRA 1J3WA 4OOYA 4BMWA 2V1AA 4DKIA 1MWTA 5HZHA 3GR2A 1YLPA 2P9VB 3HJIA 2BG1A 5CRFA 5CHJA 5KZHA 5EVID 5FEGA 1H8YA 4G3VA 1ZZAA 4JXSA 2HP9A 3KSFA 3GMWA 4WZ4A 2X01A 3S22A 3OPHA 1HTZA 2Y79A 2BASA 3K3CA 4JXGA 5HAIA 4I3AA 2WAFA 3LFVA 1I2SA 3IXBA 2HPBA 2EFUA 3OC2A 4YOFA 1YT4A 3CPTA 4QY5A 4HEFA 3IXDA 1L0FA 2OSUA 1NZOA 2DMWA 2C6WB 1ESIA 4PMAA 4E3JA 2X02A 2WGWA 1GHIA 4GJ4A 1OT6A 2KOIA 3H7WA 2WUQA 1ZTUA 5DTKA 4DDSA 3T1XA 2XA7S 1YLTA 2A49A 5FAPA 3D4FA 1LI0A 4CLCB 4KG2A 3ZG7B 1STZA 3UB5P 2ZLYA 3BY8A 5HARA 3OCNA 3MBZA 3LIEA 2EX2A 2R78A 4F3LB 1ALQA 3Q1FA 3CWFA 3GV9A 4Z9QA 1LI9A 1ZHHB 2I9VA 5HDDA 3VE3A 3DTKA 4DJ3A 4LV2A 3W4PA 1YMXA 3D9YA 5TBMB 5A91A 4XT2B 4OOLA 4IEDA 5FATA 2B5RA 5GHZA 1F5MA 1T19A 2ZMFA 4BL3A 3R7WA 1ZKJA 1S1ZA 5FL3A 4E04A 3PXPA 4E3OA 1JWZA 3UE6A 4DF6A 1FCNA 3IH9A 4MMNA 3UMDA 4E3MA 3Q07A 3HLGA 4KZ8A 1NRJA 4P85A 4OPZA 4WM9A 1G6OA 5DKLA 2XRNA 1PW1A 2Q9NA 3U4LP 4HBTA 3OPLA 2WKRA 3RJUA 2LB5A 3UE0A 3PBSA 3ZYTA 3GRJA 5EOEA 4JGQA 3E2KA 4WEKA 5E2FA 3IBRA 2QYBA 3PBOA 1YAXA 1CF0A 3C8CA 1HLOA 1BSGA 3EQUA 3UDFA 1MBLA 1GSWA 1PFLA 1FIKA 5HD3A 2YPBB 2V8FA 1KE0A 2YPAB 3T1QB 4KENB 3G6OA 2W1RA 2ZQ7A 1F9IA 2IWCA 3VFHA 2OAP1 1VEUB 4X6TA 4NXEA 4BD1A 2ZC3B 5FQJA 4JGOA 3BM6A 3MR0A 4YFMA 1OTAA 4RA7A 3V39A 2WGIA 4RVAA 5M18A 2D02A 3Q81A 1PW8A 2K7SA 4OVDA 5AQAA 3PBTA 4PM5A 1BLCA 5CXWA 3E4QA 1XXMA 4U0XA 4DE3A 3CUEC 1W7FA 3SH8A 4QJGA 5EOOA 4S2NA 4GLQA 2Z2MB 4D2OA 4HP9A 3IF6B 4JF4A 4H10B 4IHQA 1IELA 4NK3A 1VM1A 1JTGA 3PR6A 4Z1WA 2GJ3A 4IBRA 1JNUA 1FCMA 4PKYA 1MPLA 2BTFP 4GD8A 2HZ5A 2KDKA 3OBFA 3P01A 5F69A 1O07A 3NDEA 3CJMA 1XKZA 2XK1A 2ZC6B 1PWDA 1W63M 5A8BA 2WKIA 1CI9A 3HUMA 3T4TA 4PHTA 1HZOA 1JTDA 1TDGA 1TEMA 1XJ3A 3S7QA 2QL2B 5KMWA 3WS2A 1E3UA 3IT9A 4B4ZA 3KYQA 3HBRA 4Y2FA 3TOIA 1ACFA 2P08A 2V0WA 3LR4A 4MBKA 3W2ZA 5J8XA 5TJJA 4CLCD 3F1PA 3TRCA 4WL9A 3ZNTA 1C3BA 2B18A 5HWVA 2Z6DA 4IVIA 3L9KA 4EBNA 4MN7A 2W3GA 1TS0A 3VOLA 4WZ5A 5FSRA 3A3IA 3QNBA 5HSQA 4S2LA 5DF8A 2R9XA 1W5DA 4RX3A 1PWGA 2W3HA 1UGUA 3ZDJA 1AWIA 3BQ8A 4K0WA 1YLJA 4JGRA 1P0ZA 5FAOA 2CMNA 4OQIA 2Y2NA 1Z6FA 2XA7M 3HCYA 4IUKA 3T4KA 2JCHA 1PYYA 3E2LA 4AFIA 4C6YA 4PM9A 1MXOA 4L0LA 3G35A 2WZZA 3FG8A 1AN2A 4WEJA 5DKKA 2ZC4B 1NJ4A 4CPKA 5FDHA 4HJ6A 5CERA 3UY6A 3BFCA 4JXVA 1TS7A 2VLGA 1IYSA 4OP5A 4HOIA 1FOFA 3M2KA 2WGWB 4FUWA 1K4FA 1JVJA 2H28A 3C4OA 1R05A 3H7WB 4N9KA 1M40A 4KG6A 5TBMA 2DCFA 4XT2A 4HH2A 2XF3A 3FPVA 3LEQA 3T4SA 5HPIA 3LY3A 1K54A 4S2JA 4Q0IA 3OPPA 3NECA 1KVLA 4EETB 4BWIA 3I7JA 4WUJA 4UQIM 3A3DA 1L0DA 3MKFA 2ZL1A 1OT9A 2WZXA 4OQGA 3G2ZA 4EQIA 5AQ7A 4UAAA 1FILA 2VEAA 4IVKA 4A5RA 3KYZA 4LRZE 2JKFA 2J3TC 1N9BA 4P0MA 3EEAA 2E8IA 4UEYA 3GSGA 1FQGA 4GHIA 2GX5A 5A92A 4LGWA 2Y2LA 4B9OA 3QP4A 2DRWA 2ZQAA 2Q9MA 1UKLC 3R7WB 4I3JA 2EX8A 3GTCA 5EYOA 1WYCA 1KGGA 3HLEA 2YPAA 3QP6A 2M7VA 4KUKA 4BENA 4ZAMA 1IYQA 4DDYA 3T4QA 2VZWA 5HDSA 1CJFA 4U0TA 5AQ9A 5FI7A 3LR3A 4KZ7A 3NIAA 1MDYB 2QJ5A 4BBVA 2HDRA 4HQAA 3FWLA 3FYZA 1L0GA 4DMZA 4PM7A 1PI5A 3IBJA 2PYRA 1D1JA 2EWWA 3LR0A 2GNXA 5J4EA 1D7EA 1ES4A 4L9FA 4PAUA 1LL9A 2KX6A 5FAQA 3ZQ5A 1F2KA 4OPRA 1MY8A 2VV7A 5DJUA 1DY6A 3IF6A 4NEED 3HLDA 2RL3A 3LYXA 1K56D 4H10A 4NG2A 3B42A 2QKPA 4OQ0A 1NYMA 4R3AA 4IUHA 3TJZC 2PD8A 1KDWA 4II7A 2PBYA 5FQMA 5FQIA 1ERMA 1K6SA 4KQOA 3PBRA 5GLDA 3ZGAB 3C7VA 2HV1A 2XQZA 4LCMA 1DJAA 3VP0A 3SS3A 3ZCZA 2QZ6A 2M1CA 1FR6A 4BL2A 4NXBA 2QL2A 2QWSA 4GKUA 2VGJA 3PBNA 1K25A 1GA0A 1KE4A 2OOLA 2XSSA 3VFFA 3MFDA 4AYAA 4BBUA 2IWBA 4WLAA 3MXRA 3VOZA 1A0AA 2XDMA 3A0RA 1MKIA 1TDLA 3VV4A 3G4PA 5HD5A 1E4DA 2ZOHA 3NOPC 4ESPA 2ZQ8A 5JYOA 4E6WA 1LSXA 4R23A 2V9AA 4FTXA 5AQBA 3BLSA 2VGLS 3ZG8B 3S7PA 3UNWA 2LFHA 3CMZA 3N7WA 5CECA 4Y0OA 4EUVA 2Y2QA 2PRFA 3F1PB 2H10A 3KX0X 1L3LA 4C75A 5DFYA 3O87A 5EVIC 4Y15A 5FI2A 3BFGA 3SW1A 4XUXA 2O9BA 1ES2A 3OLOA 2EWVA 3P09A 5F6AA 2PDRA 3JVVA 5DF9A 4I5SA 3NC8A 3AGEA 2IA2A 2WAEA 3FKWA 5IHVA 3UPPA 1IYPA 4N1XA 3EOIA 2GDNA 4O7DA 3IS2A 1H3QA 2O9CA 3EEHA 4PM8A 1A0KA 2XH9A 2HJ9C 3TW8A 4HI4A 4WELA 4M4XA 4S2PA 2Y2JA 2IWDA 3IX4A 2G2UA 3JYIA 2WGVA 2ZJ9A 1S6RA 3LR5A 4MDZA 4IJGA 4BD0A 5EPHA 4OH0A 3QP5A 2HDUA 3GDIA 4GZBA 2VGKA 4BQMA 1YLZA 1HVBA 3VE4A 4CQHA 3N4IA 3T4JA 3RFBA 3S1YA 3G30A 1K55C 1GCEA 3HREA 5CHUA 3AGFA 3BLMA 2ZL1B 4E3LA 1W79A 4S2MA 4DJ2A 5HAQA 5I5LA 3FZCA 1SKOA 2H0YA 3LI8A 4Y7PA 3NULA 4G3KA 2HP5A 1M6KA 4JKTA 1WYBA 3N8RA 1MWSA 2OLVA 3UN7A 3NDGA 1P9RA 5K5BA 5HWWA 3CLOA 1NZUA 5L07A 4GHIB 1MDYA 4DRTA 1QMEA 3JPUA 4Q0JA 2QPNA 3O3VA 2XR0A 2WKQA 3WS1A 4LCLA 5CGWA 2Y2OA 4UA6A 4WYYA 3KSHA 3S4XA 1TS8A 5TGFA 1T1BA 1JWVA 5IU1A 3ZVTA 1ZC2A 3V5MA 1XJ6A 3DAVA 1DP6A 3MKEA 2XGNA 1Z09A 1K6RA 3Q82A 1BT5A 3SH7A 3ITBA 5TR7A 2VA0A 1UWNX 2G7UA 3C7UA 4UA9A 4DE2A 3MSHA 3GECA 1QMFA 5J7EA 4NKPA 3D3OA 4XXRA 4S2IA 3ZFZA 4WMCD 3WS5A 2PBDP 4HJ4A 1NWZA 2ZM2A 2VJWA 4EBLA 2ZMVA 1YLWA 3QP1A 2PYPA 1E3UD 1KDSA 1S67L 3E98A 4OLDA 1ES5A 4JLFA 2JKRM 5CX7A 4I3IA 4KZ5A 4WN5A 3UE1A 2VV6A 5GL9A 3ISGA 4KZ4A 1LL5A 4EWFA 3O5YA 2FH5A 3LIFA 5G18A 3MZEA 4F94A 5DFXA 2ZQ9A 4WMCA 1K38A 4NETA 4JPMA 3G31A 5HL1A 3DTEA 3TE8A 3WWXA 1W8YA 4ZTKA 3BQAA 2VGLM 3MQ0A 4O01A 2WK0A 5KIZA 3CUEA 3HLCA 1H8MA 2W3DA 1DP8A 1CI8A 1OTBA 1DJCA 4ARZB 1RGYA 1HLUP 1PIOA 1BLHA 4GS9B 3F1OB 3VSLA 4L9EA 3UPOA 5D3OA 1V9ZA 1AM9A 4K0XA 2P04A 2JC7A 5HAPA 5FEFA 5U47A 4U3TA 2XFTA 5HPFA 3ZG9B 4D60A 4B93A 1H8ZA 1Y54A 5F1GA 2FFFB 4CLCC 3GVBA 4KZ3A 1TVFA 1EI5A 3NOTC 1N9OA 4HJ3A 4MN6A 4QWOA 1ES3A 2XD5A 1YLYA 2QMIA 3BFFA 3JVUA 2M7UA 2EX6A 2J3WA 4E3KA 3DWZA 2PHYA 2AVXA 2OAQ1 2XFSA 2JKRI 2X71A 2GZAA 5DTTA 1BLPA 3BFDA 2Y91A 3ZG0A 1BLSA 4EEPA 4X68A 4ZRRA 2JKGA 3HJKA 4HESA 4O0PA 5CGXA 4QB8A 4BJPA 1ERQA 4M3KA 1WE4A 4B88A 4R4RA 2Y4AA 3V67A 1NLYA 4GCZA 4OQHA 3WRTA 5CGSA 4B4XA 3E4OA 4X56A 3IS2B 2H5SA 3R4KA 4ETXA 3HL9A 5FQ9A 4UA7A 4K91A 1FSWA 3SS5A 1EW0A 1K57C 2EXAA 3S7OA 3VP1A 3B47A 3NHQA 3BRMA 2VV8A 2H0TA 5IT5A 1T1CA 5HW3A 1NLZA 2HF6A 1G5UA 2XLNA 2ZD8A 2ZBBA 3V50A 2O99A 3UB6A 2P74A 3RTYA 1XJ4A 1G6AA 2JKTM 3FV7A 4OOMA 4EXOA 1NKPA 5FDSA 4MBHA 4QHCA 4ETZA 1W63Q 2W1TA 1SKOB 1S0WA 3S7NA 1TF1A 3MF0A 3G32A 3MXSA 5TFQA 4ME4A 3IHBA 1I2WA 3OZHA 2J7VA 5M1AA 3IF6C 3TG9A 3T50A 3M6HA 4R70A 3A3FA 2EA9A 4R3BA 5DVAA 1NRFA 5EECA 1SCWA 4R6LA 5HFOA 3LCEA 1PI4A 4XUZA 2Y2IA 3FC7A 3HUOA 1K4EA 3IXGA 1XGJA 4G3WA 2A24B 5EUAA 2ZM8A 1MKMA 3Q7ZA 4BLMA 3CG5A 3OPRA 4EESA 3SZTA 3BECA 4KZ9A 3LEZA 5G4ZA 1N4OA 1S4RA 4GNUA 1XA1A 1OMEA 2O0YA 3DW0A 3H82A 3DWKA 1SZVA 4I38A 4ATIA 1AXBA 3A0SA 2OV5A 3SH9A 1DP9A 1ESUA 3B33A 4ZBEA 2JKTI 4Y13A 4FSFA 2A2LA 1YPRA 3KO6A 4EU0A 2V8CA 2B02A 2EXBA 2Y2HA 4GD6A 4ARZA 1PRQA 1VETB 4GS9A 3F1OA 3T1RA 1VQQA 4R1GA 2PR5A 5L8MA 1ONHA 3VMAA 2Y2GA 1CQAA 3UB9A 1OTIA 3EGDC 1PZPA 5HX9A 5E43A 1ZG4A 2D01A 4DE0A 4LV1A 1G68A 1IOUA 4H6JA 1P9WA 1Q2PA 3LUQA 5C5KA 4X55A 3LY4A 4Y0TA 4LLOB 2V0UA 1L0EA 3IWIA 5FQKA 4EEUA 1V9YA 4N1HA 1TD5A 5EV0A 3BJNA 5FQQA 1YM1A 4Y0UA 3KSIA 2Y55A 3A0VA 4HNBA 1X0OA 2QHKA 5CEDA 1CK3A 2PAVP 5KSHA 2V20A 4HH3A 1ONGA 5JYPA 1IKGA 1F98A 2MJ6A 1LHYA 3EWKA 1PWCA 2XEPA 3T4LA 5DJTA 1VB6A 4EV4A 5CHMA 1EWZA 1W8QA 2R9WA 5F82A 2O9AA 4CLCE 4S2KA 1K0KA 3IX8A 2J9OA 3LIAA 3MFXA 2ZOIA 3IQAA 4OONA 1OJGA 1S4SA 1YSPA 1SDNA 2CC1A 5EVIA 5J3WA 4I39A 2B95A 3PAGA 3C4PA 3LO7A 4LENA 3UE3A 3ZVWA 5GHXA 3MXQA 3LI9A 4JBFA 5DF7A 3ZG5A 2WKEA 4FCFA 4DN0A 3QP8A 2I72A 4KZBA 3WS0A 1T1AA 4R38A 2A3UA 5G4YA 1DJBA 1SKFA 3VP3A 5FA7A 4YINA 4HHDA 5AVFA 5HDCA 2JN7A 4Y17A 4Y5FA 1MWUA 3ICYA 1H0MA 1XA7A 3BEBA 3F1NB 4X69A 4UHUA 4YWZA 2XD1A 2Z6CA 3T4OA 2NUPC 4CJNA 2HP6A 3M6BA 4LRYC 4UQIS 5AJGA 3MQOA 1LSWA 3KYEA 1IKIA 4ZDXA 1KGFA 3E0YA 5EM1A 4OKPA 1OJ5A 1NKPB 3BYDA 1L2SA 3RXWA 4MEZA 3ZHHA 1Q2QA 1CEFA 1NXYA 4FD8A 4R4SA 4KZ6A 2QJ7A 1K55A 2A24A 1I5QA 2OWJA 3UB8A 3T12B 3UO9A 2W1TB 3OOVA 3NY4A 3LIBA 3T1SA 5F68A 1G28A 4KUOA 5EE8A 5IS1A 2ACGA 2ZC5B 4H8RA 4Q0HA 4S2NC 4JF5A 5L2FA 4RX2A 3OCLA 3QNCA 1JWPA 4FH4A 1NY0A 5AVEA 1YMSA 1H5XA 1KVMA 5EVLA 5L09A 1RP5A 2G2WA 1FSYA 3IHAA 2WYXA 3FPWA 1NLWB 3O88A 4EW7A 2V1BA 4OPYA 4MN5A 4P6ZS 2Y8HA 4X1MA 3CITA 2Q0OA 3CZDA 3A3JA 1LLBA 3LIDA 2OWHA 3C38A 3NOUC 4N92A 1XJ2A 1VETA 5FASA 4K08A 3Q7VB 2W3FA 2VX8A 4EUZA 1XFQA 1MZUA 4EERA 1S1YA 5A93A 1YKDA 1YSQA 3E4PA 4Y3IA 1OTDA 4PKYG 4P87A 3PTEA 5KSCA 3B3XA 3MZFA 1BUEA 5BOHA 4E3NA 4S2OA 3H82B 4X53A 3ULFA 2MH3A 2WKPA 4ZJ1A 4ZJ3A 2XROA 2PD7A 4E3IA 4WZ5C 1MC0A 1YQSA 4GN2A 3RXXA 5I94A 2K31A 3C30A 1BZAA 4EBPA 2L0WA 3G2YA 2J9PA 1XPBA 3PHYA 1J9MA 2PT7A 3MMHA 3WS4A 3P98A 5CEBA 4KQQA 2JBFA 3LGOA 4DXCA 4LV3A 2V1ZA 4O8GA 4OLGA 2RCXA 3L7HA 2P9VA 2KLIA 5E2HA 1SDEA 3NI9A 1E25A 1AN4A 2JHEA 4P6BA 2W3EA 4NXFA 2VK3A 3MUJA 4KQDA 2YKHA 2NUTC 4KG5A 4H6JB 1GSXA 4GOGA 2ZQDA 1VHMA 4QD4A 1BYWA 1DRMA 3UDXA 5FI6A 5EFWA 3HVFA 5HWTA 4QU3A 3NBLA 3IWQA 3EGXC 3HLFA 5GHYA 4ZJ2A 3O86A 3WRZA 3PBQA 3W8KA 5M19A 3CI6A 3DTIA 3M2JA 4YNRA 1WA9A 3CAXA 1GHPA 2J80A 1K54C 4ID4A 4Q8IA 2LB9A 1Y4OA 3BFEA 4GB7A 2Y2MA 4HY8A 2Y2PA 5EM0A 2UV0E 4MBFA 3UPNA 3GQZA 4CLCA 5HL6A 2PR6A 2E8JA 4HIAA 4EQ1A 4LFUA 2WADA 1CEGA 1XGIA 2W27A 3C5AA 2HDSA 5GLBA 4JF6A 2ZM0A 2EFXA 4GDBA 1XP4A 4DXBA 4ATKA 3CPTB 4RYEA 1LT0A 1FR1A 1IEMA 4F3LA 3QP2A 2JE5A 2Z2LB 4BBTA 1K1FA 1IFQA 1ODVA 2FFYA 3PAEA 4MCWA 4GDNA 2EX9A 2WKHA 3F1NA 5EVIB 2DNSA 5F1FA 1MWRA 4DE1A 4RQ9A 3UB7A 3MQQA 4JGPA 2L1MA 3ITAA 3W4QA 2HDQA 3VP2A 3MZDA 3A3EA 4R3JA 2J3TD 3QHYA 2Y59A 1SHVA 5MC7A 1NYYA 2ZC7A 3V3SA 3ZNYA 5F83A 3EQVA 5LBRA 3FKVA 4PM6A 4X1LA 4QPRA
chains in the Genus database with same CATH topology
1OTIA 3EGDC 4DJ2A 1XJ3A 3S7QA 5I5LA 2QL2B 3UMEA 1T18A 3KYQA 3LI8A 4Y2FA 2D01A 4G3KA 2P08A 2V0WA 3LR4A 3W2ZA 1P97A 5TJJA 4CLCD 3LICA 1IOUA 3F1PA 2INWA 4H6JA 3TRCA 4WL9A 1P9WA 3LUQA 2B18A 5HWVA 5C5KA 2Z6DA 1P9RA 5K5BA 4MN7A 2W3GA 5HWWA 3CLOA 4LLOB 1UWPX 1TS0A 2V0UA 3VOLA 4GHIB 1MDYA 4WF0A 3P7NA 4EEUA 4Q0JA 1V9YA 5HSQA 2WKQA 1TD5A 3BJNA 2YPBA 1S66L 4ATHA 3KSIA 3A0VA 3KSHA 1TS8A 4HNBA 1OTEA 1X0OA 1T1BA 2QHKA 1GSVA 2W3HA 1UGUA 2YKFA 1NLWA 5KSHA 5IU1A 3BQ8A 1N9LA 4LPZA 4HH3A 3BY9A 4JGRA 4GW9A 3D72A 1P0ZA 1XJ6A 1DP6A 2CMNA 1F98A 2MJ6A 3KSGA 2XA7M 3EWKA 3HCYA 4P6ZM 4IUKA 2FZ0A 2HGVA 3T4KA 3T4LA 2VA0A 5DJTA 3NJAA 1VB6A 1UWNX 1N9NA 2G7UA 2L4RA 4AFIA 4L0LA 3GECA 5J7EA 3FG8A 4NKPA 1AN2A 3D3OA 4NXGA 4WEJA 5DKKA 5F5YA 4HJ6A 2O9AA 4HJ4A 4CLCE 1NWZA 1TS7A 3RH8B 3U5VA 3LIAA 3MFXA 2ZOIA 3MJQA 2VJWA 5I4ZA 2ZMVA 2VLGA 1OPXA 1OJGA 1S4SA 1YSPA 2PYPA 1LSVA 5J3WA 1S67L 4I39A 1LL8A 4HOIA 3E98A 2P7JA 2H28A 2JKRM 3UE3A 1R05A 3H7WB 2HJEA 3MXQA 4HP4A 3LI9A 5TBMA 5CX7A 4XT2A 4HH2A 3PYPA 3FPVA 3K2NA 4I3IA 1KOUA 3K3DA 4WN5A 3T4SA 5HPIA 2VV6A 4DN0A 5I50A 3O5YA 4Q0IA 2FH5A 3LIFA 4EETB 4BWIA 1T1AA 2K2NA 4R38A 3BWLA 5G4YA 4FOFA 4WUJA 5DFXA 4UQIM 3DBAA 4HHDA 5AVFA 3BW6A 1OT9A 1D06A 5HDCA 1Y28A 2JN7A 4Y5FA 3H9WA 1XFNA 2VEAA 3C2WA 3ICYA 4LRXC 1TS6A 3U2AA 3TE8A 4L9GA 3F1NB 3KYZA 4LRZE 4YWZA 2J3TC 2Z6CA 3BQAA 2VGLM 3MQ0A 2W0NA 4O01A 3T4OA 5KIZA 3CUEA 2NUPC 3EEAA 1H8MA 2W3DA 4LRYC 4UEYA 4UQIS 1DP8A 4GHIA 5AJGA 2GX5A 1OTBA 1LSWA 2VKSA 3MQOA 4ARZB 4B9OA 4GS9B 3F1OB 4L9EA 1UKLC 3R7WB 1V9ZA 4I3JA 1AM9A 3E0YA 2P04A 4BMWA 5EYOA 1OJ5A 5HPFA 2V1AA 4B93A 5HZHA 1NKPB 3HJIA 4CLCC 2YPAA 2M7VA 4G3VA 4KUKA 3KSFA 2QJ7A 3NOTC 1N9OA 4HJ3A 4MN6A 2A24A 2OWJA 2Y79A 2BASA 3K3CA 3UB8A 2W1TB 3T4QA 3OOVA 4I3AA 3LIBA 3LFVA 2VZWA 5HDSA 5F68A 1G28A 3OC2A 4KUOA 3LR3A 4YOFA 5IS1A 1MDYB 2QJ5A 4BBVA 4HQAA 3JVUA 2M7UA 4Q0HA 2J3WA 4DMZA 2PHYA 2OAQ1 2JKRI 3OCLA 3IBJA 2GZAA 2PYRA 2EWWA 2DMWA 5AVEA 3LR0A 2GNXA 5J4EA 1D7EA 4L9FA 4EEPA 4PAUA 2KX6A 3ZQ5A 4ZRRA 3FPWA 3HJKA 4GJ4A 1NLWB 4EW7A 2VV7A 1OT6A 2KOIA 2V1BA 3H7WA 5DJUA 1ZTUA 4MN5A 4O0PA 2XA7S 2Y8HA 4P6ZS 4NEED 4BJPA 3LYXA 3CITA 4H10A 3B42A 2QKPA 4R3AA 3TJZC 4IUHA 2PD8A 4II7A 3LIDA 3V67A 1NLYA 4GCZA 2OWHA 4CLCB 3C38A 1STZA 3NOUC 1XJ2A 3E4OA 4KQOA 3PBRA 3IS2B 4K08A 3R4KA 4ETXA 3BY8A 3OCNA 2W3FA 2HV1A 2VX8A 3LIEA 1XFQA 2R78A 1MZUA 4EERA 1S1YA 1YKDA 1YSQA 4F3LB 1EW0A 3E4PA 4Y3IA 1OTDA 4PKYG 3CWFA 2M1CA 3S7OA 1ZHHB 3B47A 3NHQA 2VV8A 4NXBA 2I9VA 2QL2A 3H82B 2QWSA 5HDDA 3VE3A 5IT5A 3PBNA 3ULFA 2MH3A 1T1CA 4DJ3A 2OOLA 2WKPA 2XROA 2PD7A 1MC0A 1NLZA 2XSSA 4AYAA 5TBMB 2K31A 3C30A 4BBUA 4XT2B 2HF6A 4OOLA 2L0WA 4WLAA 1A0AA 2ZBBA 1F5MA 1T19A 2O99A 3A0RA 3UB6A 3PHYA 2ZMFA 3VV4A 2PT7A 3R7WA 3MMHA 1S1ZA 5FL3A 4E04A 3PXPA 3RTYA 5HD5A 1XJ4A 2JKTM 4O8GA 3UE6A 2ZOHA 3NOPC 4OOMA 4EXOA 1NKPA 4MMNA 3UMDA 2KLIA 1LSXA 1NRJA 4ETZA 2V9AA 1G6OA 5DKLA 2VGLS 2XRNA 1AN4A 2JHEA 1W63Q 3S7PA 2W1TA 2W3EA 4NXFA 2LFHA 2WKRA 3MUJA 3S7NA 4EUVA 1TF1A 2LB5A 3MF0A 4KQDA 2YKHA 2NUTC 3PBSA 3ZYTA 4ME4A 3F1PB 4JGQA 4H6JB 1GSXA 4WEKA 3IBRA 1VHMA 3KX0X 2QYBA 1BYWA 3PBOA 5DFYA 1DRMA 3T50A 1YAXA 5EFWA 4R70A 3C8CA 1HLOA 5HWTA 2EA9A 3EQUA 3SW1A 1GSWA 3EGXC 4R6LA 5HD3A 2YPBB 2YPAB 2O9BA 3FC7A 3OLOA 3PBQA 3G6OA 2EWVA 3CI6A 2W1RA 4YNRA 5F6AA 1WA9A 2PDRA 3CAXA 2J80A 1F9IA 4G3WA 3JVVA 2A24B 2LB9A 5DF9A 4I5SA 2OAP1 1MKMA 4HY8A 4NXEA 4CLCA 2IA2A 4JGOA 5HL6A 3MR0A 2PR6A 4HIAA 1OTAA 4EESA 4EQ1A 3EOIA 2W27A 3IS2A 1H3QA 2O9CA 2D02A 4QPRA 3EEHA 5G4ZA 4ATKA 2K7SA 2HJ9C 1LT0A 4F3LA 1S4RA 3PBTA 3TW8A 4HI4A 4WELA 3E4QA 4M4XA 2O0YA 3CUEC 4BBTA 3H82A 1IFQA 1ODVA 4GLQA 4MCWA 4I38A 4ATIA 3A0SA 1DP9A 4HP9A 3F1NA 3LR5A 3B33A 4H10B 4IHQA 2JKTI 4MDZA 4FSFA 4IJGA 4RQ9A 3UB7A 3MQQA 3PR6A 4JGPA 2GJ3A 2L1MA 4Z1WA 1JNUA 4PKYA 2A2LA 3KO6A 4EU0A 2KDKA 3GDIA 2B02A 2J3TD 4ARZA 4GS9A 3OBFA 3P01A 3F1OA 5F69A 5MC7A 3VE4A 4CQHA 3T4JA 3EQVA 3RFBA 2PR5A 5LBRA 5L8MA 1W63M 5A8BA 3T4TA 4PHTA 3UB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTI A;  4DJ2 A;  1XJ3 A;  5I5L A;  2QL2 B;  3UME A;  1T18 A;  3LI8 A;  2D01 A;  2V0W A;  1P97 A;  3LIC A;  3F1P A;  2INW A;  4H6J A;  4WL9 A;  3LUQ A;  5HWV A;  2Z6D A;  5HWW A;  3CLO A;  4LLO B;  1UWP X;  1TS0 A;  2V0U A;  3VOL A;  4GHI B;  1MDY A;  4WF0 A;  3P7N A;  4EEU A;  1V9Y A;  5HSQ A;  2WKQ A;  2YPB A;  1S66 L;  4ATH A;  3A0V A;  1TS8 A;  4HNB A;  1OTE A;  1X0O A;  1T1B A;  2QHK A;  1GSV A;  1UGU A;  2YKF A;  1NLW A;  5IU1 A;  1N9L A;  4LPZ A;  4HH3 A;  3BY9 A;  4JGR A;  4GW9 A;  3D72 A;  1P0Z A;  1XJ6 A;  1DP6 A;  2CMN A;  1F98 A;  3EWK A;  5DJT A;  3NJA A;  1VB6 A;  1UWN X;  1N9N A;  2L4R A;  3GEC A;  5J7E A;  3FG8 A;  1AN2 A;  4NXG A;  5DKK A;  5F5Y A;  4HJ6 A;  4HJ4 A;  1NWZ A;  1TS7 A;  3RH8 B;  3U5V A;  3LIA A;  3MFX A;  2ZOI A;  3MJQ A;  5I4Z A;  2VLG A;  1OJG A;  1S4S A;  2PYP A;  1LSV A;  5J3W A;  1S67 L;  4I39 A;  1LL8 A;  4HOI A;  2P7J A;  2H28 A;  1R05 A;  3H7W B;  3MXQ A;  4HP4 A;  3LI9 A;  5TBM A;  4XT2 A;  4HH2 A;  3PYP A;  4I3I A;  1KOU A;  3K3D A;  4WN5 A;  2VV6 A;  5I50 A;  3LIF A;  4EET B;  1T1A A;  4R38 A;  3BWL A;  5G4Y A;  4WUJ A;  4HHD A;  5AVF A;  1OT9 A;  1D06 A;  5HDC A;  1Y28 A;  2JN7 A;  3H9W A;  1XFN A;  2VEA A;  3C2W A;  3ICY A;  4LRX C;  1TS6 A;  4L9G A;  3F1N B;  4LRZ E;  4YWZ A;  2Z6C A;  2W0N A;  5KIZ A;  4LRY C;  1DP8 A;  4GHI A;  1OTB A;  1LSW A;  3MQO A;  4B9O A;  4GS9 B;  3F1O B;  4L9E A;  1UKL C;  1V9Z A;  4I3J A;  1AM9 A;  5EYO A;  1OJ5 A;  2V1A A;  5HZH A;  1NKP B;  3HJI A;  2YPA A;  4KUK A;  2QJ7 A;  3NOT C;  1N9O A;  4HJ3 A;  4MN6 A;  2A24 A;  2OWJ A;  2BAS A;  3K3C A;  3UB8 A;  4I3A A;  3LIB A;  5HDS A;  5F68 A;  1G28 A;  4KUO A;  5IS1 A;  1MDY B;  2QJ5 A;  4BBV A;  4HQA A;  2PHY A;  2PYR A;  5AVE A;  5J4E A;  1D7E A;  4L9F A;  4EEP A;  2KX6 A;  3ZQ5 A;  3HJK A;  1NLW B;  4EW7 A;  2VV7 A;  1OT6 A;  2V1B A;  3H7W A;  5DJU A;  4MN5 A;  3LYX A;  4H10 A;  2QKP A;  4R3A A;  2PD8 A;  3LID A;  4GCZ A;  2OWH A;  3NOU C;  1XJ2 A;  3E4O A;  4K08 A;  3IS2 B;  3BY8 A;  2HV1 A;  3LIE A;  1XFQ A;  2R78 A;  1MZU A;  4EER A;  1S1Y A;  4F3L B;  1EW0 A;  3E4P A;  1OTD A;  4PKY G;  3CWF A;  2M1C A;  3NHQ A;  2VV8 A;  4NXB A;  2I9V A;  2QL2 A;  3H82 B;  2QWS A;  5HDD A;  3VE3 A;  3ULF A;  2MH3 A;  1T1C A;  4DJ3 A;  2OOL A;  2WKP A;  2PD7 A;  4AYA A;  5TBM B;  4BBU A;  4XT2 B;  2L0W A;  4WLA A;  1A0A A;  2ZBB A;  1T19 A;  3UB6 A;  3A0R A;  3PHY A;  1S1Z A;  4E04 A;  3RTY A;  5HD5 A;  1XJ4 A;  3UE6 A;  2ZOH A;  3NOP C;  4EXO A;  1NKP A;  3UMD A;  1LSX A;  2V9A A;  5DKL A;  1AN4 A;  2JHE A;  4NXF A;  2LFH A;  2WKR A;  3MUJ A;  4KQD A;  2YKH A;  3F1P B;  4JGQ A;  4H6J B;  1GSX A;  3IBR A;  3KX0 X;  1BYW A;  1DRM A;  3T50 A;  5EFW A;  4R70 A;  3C8C A;  1HLO A;  5HWT A;  2EA9 A;  3SW1 A;  1GSW A;  4R6L A;  5HD3 A;  2YPB B;  2YPA B;  3FC7 A;  3OLO A;  3G6O A;  5F6A A;  1WA9 A;  2PDR A;  3CAX A;  2J80 A;  1F9I A;  2A24 B;  4I5S A;  4HY8 A;  4NXE A;  4JGO A;  3MR0 A;  2PR6 A;  4HIA A;  1OTA A;  4EES A;  4EQ1 A;  2W27 A;  3IS2 A;  2D02 A;  3EEH A;  5G4Z A;  4ATK A;  2K7S A;  1LT0 A;  4F3L A;  1S4R A;  4HI4 A;  3E4Q A;  4M4X A;  4BBT A;  3H82 A;  1ODV A;  4I38 A;  4ATI A;  3A0S A;  1DP9 A;  4HP9 A;  3F1N A;  3B33 A;  4H10 B;  4RQ9 A;  3UB7 A;  3MQQ A;  4JGP A;  2GJ3 A;  2L1M A;  1JNU A;  4PKY A;  2KDK A;  3GDI A;  2B02 A;  4GS9 A;  3F1O A;  5F69 A;  3VE4 A;  2PR5 A;  5A8B A;  3UB9 A; 
#chains in the Genus database with same CATH topology
 3TSG A;  1BUL A;  3IWO A;  1BTL A;  3UME A;  1T18 A;  2PU4 A;  4E6X A;  1P97 A;  5A90 A;  3LIC A;  1K57 A;  4X25 A;  4MLL A;  2INW A;  3DTM A;  1KE3 A;  5GLC A;  3VSK A;  1UWP X;  4WF0 A;  3P7N A;  3VOY A;  1O7E A;  3HUN A;  1ERO A;  1U60 A;  3UDI A;  2YPB A;  1S66 L;  4ATH A;  1OTE A;  3AGD A;  3W4O A;  1GSV A;  5L10 A;  5E2G A;  4IBX A;  4PPR A;  1RGZ A;  2YKF A;  1NLW A;  3N8L A;  1VEU A;  1N9L A;  4LPZ A;  3BY9 A;  4GW9 A;  3D72 A;  3MS6 A;  3KSG A;  4P6Z M;  1IYO A;  2FZ0 A;  2HGV A;  3NJA A;  1N9N A;  2ZQC A;  4FH2 A;  2L4R A;  2ZMA A;  3IXH A;  4NXG A;  3Q7V A;  5F5Y A;  1RCJ A;  3IH8 A;  3N6I A;  3RH8 B;  3U5V A;  3MJQ A;  2J8Y A;  5I4Z A;  3IF5 A;  1OPX A;  3IX3 A;  4N9L A;  1LSV A;  1ZG6 A;  4R0Q A;  5CTN A;  1LL8 A;  2PU2 A;  2P7J A;  2HJE A;  4MNR A;  2OLU A;  1GA9 A;  4HP4 A;  3HLW A;  1HD8 A;  3PYP A;  3K2N A;  1KOU A;  3K3D A;  4C3Q A;  3G34 A;  2V2F F;  4LV0 A;  5I50 A;  2BLS A;  1KGE A;  2K2N A;  4HBU A;  5CTM A;  3BWL A;  2C5W B;  4FOF A;  5GLA A;  1XX2 A;  3DBA A;  5E2E A;  3SOI A;  3BW6 A;  1D06 A;  1Y28 A;  3SS4 A;  4JXW A;  2Y2K A;  3HLB A;  5DTS A;  3VP4 A;  3NCK A;  3CHW P;  3H9W A;  1XFN A;  3C2W A;  3N8S A;  4LRX C;  1TS6 A;  3U2A A;  4WBG A;  4L9G A;  4QY6 A;  1PZO A;  2W0N A;  5EVE A;  1K56 A;  2UWX A;  3V3R A;  1PNE A;  4OP8 A;  1GHM A;  2VKS A;  1FCO A;  4OPQ A;  4KZA A;  4KQR A;  1J3W A;  4OOY A;  4BMW A;  2V1A A;  4DKI A;  1MWT A;  5HZH A;  3GR2 A;  1YLP A;  2P9V B;  3HJI A;  2BG1 A;  5CRF A;  5CHJ A;  5KZH A;  5EVI D;  5FEG A;  1H8Y A;  4G3V A;  1ZZA A;  4JXS A;  2HP9 A;  3KSF A;  3GMW A;  4WZ4 A;  2X01 A;  3S22 A;  3OPH A;  1HTZ A;  2Y79 A;  2BAS A;  3K3C A;  4JXG A;  5HAI A;  4I3A A;  2WAF A;  3LFV A;  1I2S A;  3IXB A;  2HPB A;  2EFU A;  3OC2 A;  4YOF A;  1YT4 A;  3CPT A;  4QY5 A;  4HEF A;  3IXD A;  1L0F A;  2OSU A;  1NZO A;  2DMW A;  2C6W B;  1ESI A;  4PMA A;  4E3J A;  2X02 A;  2WGW A;  1GHI A;  4GJ4 A;  1OT6 A;  2KOI A;  3H7W A;  2WUQ A;  1ZTU A;  5DTK A;  4DDS A;  3T1X A;  2XA7 S;  1YLT A;  2A49 A;  5FAP A;  3D4F A;  1LI0 A;  4CLC B;  4KG2 A;  3ZG7 B;  1STZ A;  3UB5 P;  2ZLY A;  3BY8 A;  5HAR A;  3OCN A;  3MBZ A;  3LIE A;  2EX2 A;  2R78 A;  4F3L B;  1ALQ A;  3Q1F A;  3CWF A;  3GV9 A;  4Z9Q A;  1LI9 A;  1ZHH B;  2I9V A;  5HDD A;  3VE3 A;  3DTK A;  4DJ3 A;  4LV2 A;  3W4P A;  1YMX A;  3D9Y A;  5TBM B;  5A91 A;  4XT2 B;  4OOL A;  4IED A;  5FAT A;  2B5R A;  5GHZ A;  1F5M A;  1T19 A;  2ZMF A;  4BL3 A;  3R7W A;  1ZKJ A;  1S1Z A;  5FL3 A;  4E04 A;  3PXP A;  4E3O A;  1JWZ A;  3UE6 A;  4DF6 A;  1FCN A;  3IH9 A;  4MMN A;  3UMD A;  4E3M A;  3Q07 A;  3HLG A;  4KZ8 A;  1NRJ A;  4P85 A;  4OPZ A;  4WM9 A;  1G6O A;  5DKL A;  2XRN A;  1PW1 A;  2Q9N A;  3U4L P;  4HBT A;  3OPL A;  2WKR A;  3RJU A;  2LB5 A;  3UE0 A;  3PBS A;  3ZYT A;  3GRJ A;  5EOE A;  4JGQ A;  3E2K A;  4WEK A;  5E2F A;  3IBR A;  2QYB A;  3PBO A;  1YAX A;  1CF0 A;  3C8C A;  1HLO A;  1BSG A;  3EQU A;  3UDF A;  1MBL A;  1GSW A;  1PFL A;  1FIK A;  5HD3 A;  2YPB B;  2V8F A;  1KE0 A;  2YPA B;  3T1Q B;  4KEN B;  3G6O A;  2W1R A;  2ZQ7 A;  1F9I A;  2IWC A;  3VFH A;  2OAP 1;  1VEU B;  4X6T A;  4NXE A;  4BD1 A;  2ZC3 B;  5FQJ A;  4JGO A;  3BM6 A;  3MR0 A;  4YFM A;  1OTA A;  4RA7 A;  3V39 A;  2WGI A;  4RVA A;  5M18 A;  2D02 A;  3Q81 A;  1PW8 A;  2K7S A;  4OVD A;  5AQA A;  3PBT A;  4PM5 A;  1BLC A;  5CXW A;  3E4Q A;  1XXM A;  4U0X A;  4DE3 A;  3CUE C;  1W7F A;  3SH8 A;  4QJG A;  5EOO A;  4S2N A;  4GLQ A;  2Z2M B;  4D2O A;  4HP9 A;  3IF6 B;  4JF4 A;  4H10 B;  4IHQ A;  1IEL A;  4NK3 A;  1VM1 A;  1JTG A;  3PR6 A;  4Z1W A;  2GJ3 A;  4IBR A;  1JNU A;  1FCM A;  4PKY A;  1MPL A;  2BTF P;  4GD8 A;  2HZ5 A;  2KDK A;  3OBF A;  3P01 A;  5F69 A;  1O07 A;  3NDE A;  3CJM A;  1XKZ A;  2XK1 A;  2ZC6 B;  1PWD A;  1W63 M;  5A8B A;  2WKI A;  1CI9 A;  3HUM A;  3T4T A;  4PHT A;  1HZO A;  1JTD A;  1TDG A;  1TEM A;  1XJ3 A;  3S7Q A;  2QL2 B;  5KMW A;  3WS2 A;  1E3U A;  3IT9 A;  4B4Z A;  3KYQ A;  3HBR A;  4Y2F A;  3TOI A;  1ACF A;  2P08 A;  2V0W A;  3LR4 A;  4MBK A;  3W2Z A;  5J8X A;  5TJJ A;  4CLC D;  3F1P A;  3TRC A;  4WL9 A;  3ZNT A;  1C3B A;  2B18 A;  5HWV A;  2Z6D A;  4IVI A;  3L9K A;  4EBN A;  4MN7 A;  2W3G A;  1TS0 A;  3VOL A;  4WZ5 A;  5FSR A;  3A3I A;  3QNB A;  5HSQ A;  4S2L A;  5DF8 A;  2R9X A;  1W5D A;  4RX3 A;  1PWG A;  2W3H A;  1UGU A;  3ZDJ A;  1AWI A;  3BQ8 A;  4K0W A;  1YLJ A;  4JGR A;  1P0Z A;  5FAO A;  2CMN A;  4OQI A;  2Y2N A;  1Z6F A;  2XA7 M;  3HCY A;  4IUK A;  3T4K A;  2JCH A;  1PYY A;  3E2L A;  4AFI A;  4C6Y A;  4PM9 A;  1MXO A;  4L0L A;  3G35 A;  2WZZ A;  3FG8 A;  1AN2 A;  4WEJ A;  5DKK A;  2ZC4 B;  1NJ4 A;  4CPK A;  5FDH A;  4HJ6 A;  5CER A;  3UY6 A;  3BFC A;  4JXV A;  1TS7 A;  2VLG A;  1IYS A;  4OP5 A;  4HOI A;  1FOF A;  3M2K A;  2WGW B;  4FUW A;  1K4F A;  1JVJ A;  2H28 A;  3C4O A;  1R05 A;  3H7W B;  4N9K A;  1M40 A;  4KG6 A;  5TBM A;  2DCF A;  4XT2 A;  4HH2 A;  2XF3 A;  3FPV A;  3LEQ A;  3T4S A;  5HPI A;  3LY3 A;  1K54 A;  4S2J A;  4Q0I A;  3OPP A;  3NEC A;  1KVL A;  4EET B;  4BWI A;  3I7J A;  4WUJ A;  4UQI M;  3A3D A;  1L0D A;  3MKF A;  2ZL1 A;  1OT9 A;  2WZX A;  4OQG A;  3G2Z A;  4EQI A;  5AQ7 A;  4UAA A;  1FIL A;  2VEA A;  4IVK A;  4A5R A;  3KYZ A;  4LRZ E;  2JKF A;  2J3T C;  1N9B A;  4P0M A;  3EEA A;  2E8I A;  4UEY A;  3GSG A;  1FQG A;  4GHI A;  2GX5 A;  5A92 A;  4LGW A;  2Y2L A;  4B9O A;  3QP4 A;  2DRW A;  2ZQA A;  2Q9M A;  1UKL C;  3R7W B;  4I3J A;  2EX8 A;  3GTC A;  5EYO A;  1WYC A;  1KGG A;  3HLE A;  2YPA A;  3QP6 A;  2M7V A;  4KUK A;  4BEN A;  4ZAM A;  1IYQ A;  4DDY A;  3T4Q A;  2VZW A;  5HDS A;  1CJF A;  4U0T A;  5AQ9 A;  5FI7 A;  3LR3 A;  4KZ7 A;  3NIA A;  1MDY B;  2QJ5 A;  4BBV A;  2HDR A;  4HQA A;  3FWL A;  3FYZ A;  1L0G A;  4DMZ A;  4PM7 A;  1PI5 A;  3IBJ A;  2PYR A;  1D1J A;  2EWW A;  3LR0 A;  2GNX A;  5J4E A;  1D7E A;  1ES4 A;  4L9F A;  4PAU A;  1LL9 A;  2KX6 A;  5FAQ A;  3ZQ5 A;  1F2K A;  4OPR A;  1MY8 A;  2VV7 A;  5DJU A;  1DY6 A;  3IF6 A;  4NEE D;  3HLD A;  2RL3 A;  3LYX A;  1K56 D;  4H10 A;  4NG2 A;  3B42 A;  2QKP A;  4OQ0 A;  1NYM A;  4R3A A;  4IUH A;  3TJZ C;  2PD8 A;  1KDW A;  4II7 A;  2PBY A;  5FQM A;  5FQI A;  1ERM A;  1K6S A;  4KQO A;  3PBR A;  5GLD A;  3ZGA B;  3C7V A;  2HV1 A;  2XQZ A;  4LCM A;  1DJA A;  3VP0 A;  3SS3 A;  3ZCZ A;  2QZ6 A;  2M1C A;  1FR6 A;  4BL2 A;  4NXB A;  2QL2 A;  2QWS A;  4GKU A;  2VGJ A;  3PBN A;  1K25 A;  1GA0 A;  1KE4 A;  2OOL A;  2XSS A;  3VFF A;  3MFD A;  4AYA A;  4BBU A;  2IWB A;  4WLA A;  3MXR A;  3VOZ A;  1A0A A;  2XDM A;  3A0R A;  1MKI A;  1TDL A;  3VV4 A;  3G4P A;  5HD5 A;  1E4D A;  2ZOH A;  3NOP C;  4ESP A;  2ZQ8 A;  5JYO A;  4E6W A;  1LSX A;  4R23 A;  2V9A A;  4FTX A;  5AQB A;  3BLS A;  2VGL S;  3ZG8 B;  3S7P A;  3UNW A;  2LFH A;  3CMZ A;  3N7W A;  5CEC A;  4Y0O A;  4EUV A;  2Y2Q A;  2PRF A;  3F1P B;  2H10 A;  3KX0 X;  1L3L A;  4C75 A;  5DFY A;  3O87 A;  5EVI C;  4Y15 A;  5FI2 A;  3BFG A;  3SW1 A;  4XUX A;  2O9B A;  1ES2 A;  3OLO A;  2EWV A;  3P09 A;  5F6A A;  2PDR A;  3JVV A;  5DF9 A;  4I5S A;  3NC8 A;  3AGE A;  2IA2 A;  2WAE A;  3FKW A;  5IHV A;  3UPP A;  1IYP A;  4N1X A;  3EOI A;  2GDN A;  4O7D A;  3IS2 A;  1H3Q A;  2O9C A;  3EEH A;  4PM8 A;  1A0K A;  2XH9 A;  2HJ9 C;  3TW8 A;  4HI4 A;  4WEL A;  4M4X A;  4S2P A;  2Y2J A;  2IWD A;  3IX4 A;  2G2U A;  3JYI A;  2WGV A;  2ZJ9 A;  1S6R A;  3LR5 A;  4MDZ A;  4IJG A;  4BD0 A;  5EPH A;  4OH0 A;  3QP5 A;  2HDU A;  3GDI A;  4GZB A;  2VGK A;  4BQM A;  1YLZ A;  1HVB A;  3VE4 A;  4CQH A;  3N4I A;  3T4J A;  3RFB A;  3S1Y A;  3G30 A;  1K55 C;  1GCE A;  3HRE A;  5CHU A;  3AGF A;  3BLM A;  2ZL1 B;  4E3L A;  1W79 A;  4S2M A;  4DJ2 A;  5HAQ A;  5I5L A;  3FZC A;  1SKO A;  2H0Y A;  3LI8 A;  4Y7P A;  3NUL A;  4G3K A;  2HP5 A;  1M6K A;  4JKT A;  1WYB A;  3N8R A;  1MWS A;  2OLV A;  3UN7 A;  3NDG A;  1P9R A;  5K5B A;  5HWW A;  3CLO A;  1NZU A;  5L07 A;  4GHI B;  1MDY A;  4DRT A;  1QME A;  3JPU A;  4Q0J A;  2QPN A;  3O3V A;  2XR0 A;  2WKQ A;  3WS1 A;  4LCL A;  5CGW A;  2Y2O A;  4UA6 A;  4WYY A;  3KSH A;  3S4X A;  1TS8 A;  5TGF A;  1T1B A;  1JWV A;  5IU1 A;  3ZVT A;  1ZC2 A;  3V5M A;  1XJ6 A;  3DAV A;  1DP6 A;  3MKE A;  2XGN A;  1Z09 A;  1K6R A;  3Q82 A;  1BT5 A;  3SH7 A;  3ITB A;  5TR7 A;  2VA0 A;  1UWN X;  2G7U A;  3C7U A;  4UA9 A;  4DE2 A;  3MSH A;  3GEC A;  1QMF A;  5J7E A;  4NKP A;  3D3O A;  4XXR A;  4S2I A;  3ZFZ A;  4WMC D;  3WS5 A;  2PBD P;  4HJ4 A;  1NWZ A;  2ZM2 A;  2VJW A;  4EBL A;  2ZMV A;  1YLW A;  3QP1 A;  2PYP A;  1E3U D;  1KDS A;  1S67 L;  3E98 A;  4OLD A;  1ES5 A;  4JLF A;  2JKR M;  5CX7 A;  4I3I A;  4KZ5 A;  4WN5 A;  3UE1 A;  2VV6 A;  5GL9 A;  3ISG A;  4KZ4 A;  1LL5 A;  4EWF A;  3O5Y A;  2FH5 A;  3LIF A;  5G18 A;  3MZE A;  4F94 A;  5DFX A;  2ZQ9 A;  4WMC A;  1K38 A;  4NET A;  4JPM A;  3G31 A;  5HL1 A;  3DTE A;  3TE8 A;  3WWX A;  1W8Y A;  4ZTK A;  3BQA A;  2VGL M;  3MQ0 A;  4O01 A;  2WK0 A;  5KIZ A;  3CUE A;  3HLC A;  1H8M A;  2W3D A;  1DP8 A;  1CI8 A;  1OTB A;  1DJC A;  4ARZ B;  1RGY A;  1HLU P;  1PIO A;  1BLH A;  4GS9 B;  3F1O B;  3VSL A;  4L9E A;  3UPO A;  5D3O A;  1V9Z A;  1AM9 A;  4K0X A;  2P04 A;  2JC7 A;  5HAP A;  5FEF A;  5U47 A;  4U3T A;  2XFT A;  5HPF A;  3ZG9 B;  4D60 A;  4B93 A;  1H8Z A;  1Y54 A;  5F1G A;  2FFF B;  4CLC C;  3GVB A;  4KZ3 A;  1TVF A;  1EI5 A;  3NOT C;  1N9O A;  4HJ3 A;  4MN6 A;  4QWO A;  1ES3 A;  2XD5 A;  1YLY A;  2QMI A;  3BFF A;  3JVU A;  2M7U A;  2EX6 A;  2J3W A;  4E3K A;  3DWZ A;  2PHY A;  2AVX A;  2OAQ 1;  2XFS A;  2JKR I;  2X71 A;  2GZA A;  5DTT A;  1BLP A;  3BFD A;  2Y91 A;  3ZG0 A;  1BLS A;  4EEP A;  4X68 A;  4ZRR A;  2JKG A;  3HJK A;  4HES A;  4O0P A;  5CGX A;  4QB8 A;  4BJP A;  1ERQ A;  4M3K A;  1WE4 A;  4B88 A;  4R4R A;  2Y4A A;  3V67 A;  1NLY A;  4GCZ A;  4OQH A;  3WRT A;  5CGS A;  4B4X A;  3E4O A;  4X56 A;  3IS2 B;  2H5S A;  3R4K A;  4ETX A;  3HL9 A;  5FQ9 A;  4UA7 A;  4K91 A;  1FSW A;  3SS5 A;  1EW0 A;  1K57 C;  2EXA A;  3S7O A;  3VP1 A;  3B47 A;  3NHQ A;  3BRM A;  2VV8 A;  2H0T A;  5IT5 A;  1T1C A;  5HW3 A;  1NLZ A;  2HF6 A;  1G5U A;  2XLN A;  2ZD8 A;  2ZBB A;  3V50 A;  2O99 A;  3UB6 A;  2P74 A;  3RTY A;  1XJ4 A;  1G6A A;  2JKT M;  3FV7 A;  4OOM A;  4EXO A;  1NKP A;  5FDS A;  4MBH A;  4QHC A;  4ETZ A;  1W63 Q;  2W1T A;  1SKO B;  1S0W A;  3S7N A;  1TF1 A;  3MF0 A;  3G32 A;  3MXS A;  5TFQ A;  4ME4 A;  3IHB A;  1I2W A;  3OZH A;  2J7V A;  5M1A A;  3IF6 C;  3TG9 A;  3T50 A;  3M6H A;  4R70 A;  3A3F A;  2EA9 A;  4R3B A;  5DVA A;  1NRF A;  5EEC A;  1SCW A;  4R6L A;  5HFO A;  3LCE A;  1PI4 A;  4XUZ A;  2Y2I A;  3FC7 A;  3HUO A;  1K4E A;  3IXG A;  1XGJ A;  4G3W A;  2A24 B;  5EUA A;  2ZM8 A;  1MKM A;  3Q7Z A;  4BLM A;  3CG5 A;  3OPR A;  4EES A;  3SZT A;  3BEC A;  4KZ9 A;  3LEZ A;  5G4Z A;  1N4O A;  1S4R A;  4GNU A;  1XA1 A;  1OME A;  2O0Y A;  3DW0 A;  3H82 A;  3DWK A;  1SZV A;  4I38 A;  4ATI A;  1AXB A;  3A0S A;  2OV5 A;  3SH9 A;  1DP9 A;  1ESU A;  3B33 A;  4ZBE A;  2JKT I;  4Y13 A;  4FSF A;  2A2L A;  1YPR A;  3KO6 A;  4EU0 A;  2V8C A;  2B02 A;  2EXB A;  2Y2H A;  4GD6 A;  4ARZ A;  1PRQ A;  1VET B;  4GS9 A;  3F1O A;  3T1R A;  1VQQ A;  4R1G A;  2PR5 A;  5L8M A;  1ONH A;  3VMA A;  2Y2G A;  1CQA A;  3UB9 A;  1OTI A;  3EGD C;  1PZP A;  5HX9 A;  5E43 A;  1ZG4 A;  2D01 A;  4DE0 A;  4LV1 A;  1G68 A;  1IOU A;  4H6J A;  1P9W A;  1Q2P A;  3LUQ A;  5C5K A;  4X55 A;  3LY4 A;  4Y0T A;  4LLO B;  2V0U A;  1L0E A;  3IWI A;  5FQK A;  4EEU A;  1V9Y A;  4N1H A;  1TD5 A;  5EV0 A;  3BJN A;  5FQQ A;  1YM1 A;  4Y0U A;  3KSI A;  2Y55 A;  3A0V A;  4HNB A;  1X0O A;  2QHK A;  5CED A;  1CK3 A;  2PAV P;  5KSH A;  2V20 A;  4HH3 A;  1ONG A;  5JYP A;  1IKG A;  1F98 A;  2MJ6 A;  1LHY A;  3EWK A;  1PWC A;  2XEP A;  3T4L A;  5DJT A;  1VB6 A;  4EV4 A;  5CHM A;  1EWZ A;  1W8Q A;  2R9W A;  5F82 A;  2O9A A;  4CLC E;  4S2K A;  1K0K A;  3IX8 A;  2J9O A;  3LIA A;  3MFX A;  2ZOI A;  3IQA A;  4OON A;  1OJG A;  1S4S A;  1YSP A;  1SDN A;  2CC1 A;  5EVI A;  5J3W A;  4I39 A;  2B95 A;  3PAG A;  3C4P A;  3LO7 A;  4LEN A;  3UE3 A;  3ZVW A;  5GHX A;  3MXQ A;  3LI9 A;  4JBF A;  5DF7 A;  3ZG5 A;  2WKE A;  4FCF A;  4DN0 A;  3QP8 A;  2I72 A;  4KZB A;  3WS0 A;  1T1A A;  4R38 A;  2A3U A;  5G4Y A;  1DJB A;  1SKF A;  3VP3 A;  5FA7 A;  4YIN A;  4HHD A;  5AVF A;  5HDC A;  2JN7 A;  4Y17 A;  4Y5F A;  1MWU A;  3ICY A;  1H0M A;  1XA7 A;  3BEB A;  3F1N B;  4X69 A;  4UHU A;  4YWZ A;  2XD1 A;  2Z6C A;  3T4O A;  2NUP C;  4CJN A;  2HP6 A;  3M6B A;  4LRY C;  4UQI S;  5AJG A;  3MQO A;  1LSW A;  3KYE A;  1IKI A;  4ZDX A;  1KGF A;  3E0Y A;  5EM1 A;  4OKP A;  1OJ5 A;  1NKP B;  3BYD A;  1L2S A;  3RXW A;  4MEZ A;  3ZHH A;  1Q2Q A;  1CEF A;  1NXY A;  4FD8 A;  4R4S A;  4KZ6 A;  2QJ7 A;  1K55 A;  2A24 A;  1I5Q A;  2OWJ A;  3UB8 A;  3T12 B;  3UO9 A;  2W1T B;  3OOV A;  3NY4 A;  3LIB A;  3T1S A;  5F68 A;  1G28 A;  4KUO A;  5EE8 A;  5IS1 A;  2ACG A;  2ZC5 B;  4H8R A;  4Q0H A;  4S2N C;  4JF5 A;  5L2F A;  4RX2 A;  3OCL A;  3QNC A;  1JWP A;  4FH4 A;  1NY0 A;  5AVE A;  1YMS A;  1H5X A;  1KVM A;  5EVL A;  5L09 A;  1RP5 A;  2G2W A;  1FSY A;  3IHA A;  2WYX A;  3FPW A;  1NLW B;  3O88 A;  4EW7 A;  2V1B A;  4OPY A;  4MN5 A;  4P6Z S;  2Y8H A;  4X1M A;  3CIT A;  2Q0O A;  3CZD A;  3A3J A;  1LLB A;  3LID A;  2OWH A;  3C38 A;  3NOU C;  4N92 A;  1XJ2 A;  1VET A;  5FAS A;  4K08 A;  3Q7V B;  2W3F A;  2VX8 A;  4EUZ A;  1XFQ A;  1MZU A;  4EER A;  1S1Y A;  5A93 A;  1YKD A;  1YSQ A;  3E4P A;  4Y3I A;  1OTD A;  4PKY G;  4P87 A;  3PTE A;  5KSC A;  3B3X A;  3MZF A;  1BUE A;  5BOH A;  4E3N A;  4S2O A;  3H82 B;  4X53 A;  3ULF A;  2MH3 A;  2WKP A;  4ZJ1 A;  4ZJ3 A;  2XRO A;  2PD7 A;  4E3I A;  4WZ5 C;  1MC0 A;  1YQS A;  4GN2 A;  3RXX A;  5I94 A;  2K31 A;  3C30 A;  1BZA A;  4EBP A;  2L0W A;  3G2Y A;  2J9P A;  1XPB A;  3PHY A;  1J9M A;  2PT7 A;  3MMH A;  3WS4 A;  3P98 A;  5CEB A;  4KQQ A;  2JBF A;  3LGO A;  4DXC A;  4LV3 A;  2V1Z A;  4O8G A;  4OLG A;  2RCX A;  3L7H A;  2P9V A;  2KLI A;  5E2H A;  1SDE A;  3NI9 A;  1E25 A;  1AN4 A;  2JHE A;  4P6B A;  2W3E A;  4NXF A;  2VK3 A;  3MUJ A;  4KQD A;  2YKH A;  2NUT C;  4KG5 A;  4H6J B;  1GSX A;  4GOG A;  2ZQD A;  1VHM A;  4QD4 A;  1BYW A;  1DRM A;  3UDX A;  5FI6 A;  5EFW A;  3HVF A;  5HWT A;  4QU3 A;  3NBL A;  3IWQ A;  3EGX C;  3HLF A;  5GHY A;  4ZJ2 A;  3O86 A;  3WRZ A;  3PBQ A;  3W8K A;  5M19 A;  3CI6 A;  3DTI A;  3M2J A;  4YNR A;  1WA9 A;  3CAX A;  1GHP A;  2J80 A;  1K54 C;  4ID4 A;  4Q8I A;  2LB9 A;  1Y4O A;  3BFE A;  4GB7 A;  2Y2M A;  4HY8 A;  2Y2P A;  5EM0 A;  2UV0 E;  4MBF A;  3UPN A;  3GQZ A;  4CLC A;  5HL6 A;  2PR6 A;  2E8J A;  4HIA A;  4EQ1 A;  4LFU A;  2WAD A;  1CEG A;  1XGI A;  2W27 A;  3C5A A;  2HDS A;  5GLB A;  4JF6 A;  2ZM0 A;  2EFX A;  4GDB A;  1XP4 A;  4DXB A;  4ATK A;  3CPT B;  4RYE A;  1LT0 A;  1FR1 A;  1IEM A;  4F3L A;  3QP2 A;  2JE5 A;  2Z2L B;  4BBT A;  1K1F A;  1IFQ A;  1ODV A;  2FFY A;  3PAE A;  4MCW A;  4GDN A;  2EX9 A;  2WKH A;  3F1N A;  5EVI B;  2DNS A;  5F1F A;  1MWR A;  4DE1 A;  4RQ9 A;  3UB7 A;  3MQQ A;  4JGP A;  2L1M A;  3ITA A;  3W4Q A;  2HDQ A;  3VP2 A;  3MZD A;  3A3E A;  4R3J A;  2J3T D;  3QHY A;  2Y59 A;  1SHV A;  5MC7 A;  1NYY A;  2ZC7 A;  3V3S A;  3ZNY A;  5F83 A;  3EQV A;  5LBR A;  3FKV A;  4PM6 A;  4X1L A;  4QPR A; 
#chains in the Genus database with same CATH homology
 1OTI A;  3EGD C;  4DJ2 A;  1XJ3 A;  3S7Q A;  5I5L A;  2QL2 B;  3UME A;  1T18 A;  3KYQ A;  3LI8 A;  4Y2F A;  2D01 A;  4G3K A;  2P08 A;  2V0W A;  3LR4 A;  3W2Z A;  1P97 A;  5TJJ A;  4CLC D;  3LIC A;  1IOU A;  3F1P A;  2INW A;  4H6J A;  3TRC A;  4WL9 A;  1P9W A;  3LUQ A;  2B18 A;  5HWV A;  5C5K A;  2Z6D A;  1P9R A;  5K5B A;  4MN7 A;  2W3G A;  5HWW A;  3CLO A;  4LLO B;  1UWP X;  1TS0 A;  2V0U A;  3VOL A;  4GHI B;  1MDY A;  4WF0 A;  3P7N A;  4EEU A;  4Q0J A;  1V9Y A;  5HSQ A;  2WKQ A;  1TD5 A;  3BJN A;  2YPB A;  1S66 L;  4ATH A;  3KSI A;  3A0V A;  3KSH A;  1TS8 A;  4HNB A;  1OTE A;  1X0O A;  1T1B A;  2QHK A;  1GSV A;  2W3H A;  1UGU A;  2YKF A;  1NLW A;  5KSH A;  5IU1 A;  3BQ8 A;  1N9L A;  4LPZ A;  4HH3 A;  3BY9 A;  4JGR A;  4GW9 A;  3D72 A;  1P0Z A;  1XJ6 A;  1DP6 A;  2CMN A;  1F98 A;  2MJ6 A;  3KSG A;  2XA7 M;  3EWK A;  3HCY A;  4P6Z M;  4IUK A;  2FZ0 A;  2HGV A;  3T4K A;  3T4L A;  2VA0 A;  5DJT A;  3NJA A;  1VB6 A;  1UWN X;  1N9N A;  2G7U A;  2L4R A;  4AFI A;  4L0L A;  3GEC A;  5J7E A;  3FG8 A;  4NKP A;  1AN2 A;  3D3O A;  4NXG A;  4WEJ A;  5DKK A;  5F5Y A;  4HJ6 A;  2O9A A;  4HJ4 A;  4CLC E;  1NWZ A;  1TS7 A;  3RH8 B;  3U5V A;  3LIA A;  3MFX A;  2ZOI A;  3MJQ A;  2VJW A;  5I4Z A;  2ZMV A;  2VLG A;  1OPX A;  1OJG A;  1S4S A;  1YSP A;  2PYP A;  1LSV A;  5J3W A;  1S67 L;  4I39 A;  1LL8 A;  4HOI A;  3E98 A;  2P7J A;  2H28 A;  2JKR M;  3UE3 A;  1R05 A;  3H7W B;  2HJE A;  3MXQ A;  4HP4 A;  3LI9 A;  5TBM A;  5CX7 A;  4XT2 A;  4HH2 A;  3PYP A;  3FPV A;  3K2N A;  4I3I A;  1KOU A;  3K3D A;  4WN5 A;  3T4S A;  5HPI A;  2VV6 A;  4DN0 A;  5I50 A;  3O5Y A;  4Q0I A;  2FH5 A;  3LIF A;  4EET B;  4BWI A;  1T1A A;  2K2N A;  4R38 A;  3BWL A;  5G4Y A;  4FOF A;  4WUJ A;  5DFX A;  4UQI M;  3DBA A;  4HHD A;  5AVF A;  3BW6 A;  1OT9 A;  1D06 A;  5HDC A;  1Y28 A;  2JN7 A;  4Y5F A;  3H9W A;  1XFN A;  2VEA A;  3C2W A;  3ICY A;  4LRX C;  1TS6 A;  3U2A A;  3TE8 A;  4L9G A;  3F1N B;  3KYZ A;  4LRZ E;  4YWZ A;  2J3T C;  2Z6C A;  3BQA A;  2VGL M;  3MQ0 A;  2W0N A;  4O01 A;  3T4O A;  5KIZ A;  3CUE A;  2NUP C;  3EEA A;  1H8M A;  2W3D A;  4LRY C;  4UEY A;  4UQI S;  1DP8 A;  4GHI A;  5AJG A;  2GX5 A;  1OTB A;  1LSW A;  2VKS A;  3MQO A;  4ARZ B;  4B9O A;  4GS9 B;  3F1O B;  4L9E A;  1UKL C;  3R7W B;  1V9Z A;  4I3J A;  1AM9 A;  3E0Y A;  2P04 A;  4BMW A;  5EYO A;  1OJ5 A;  5HPF A;  2V1A A;  4B93 A;  5HZH A;  1NKP B;  3HJI A;  4CLC C;  2YPA A;  2M7V A;  4G3V A;  4KUK A;  3KSF A;  2QJ7 A;  3NOT C;  1N9O A;  4HJ3 A;  4MN6 A;  2A24 A;  2OWJ A;  2Y79 A;  2BAS A;  3K3C A;  3UB8 A;  2W1T B;  3T4Q A;  3OOV A;  4I3A A;  3LIB A;  3LFV A;  2VZW A;  5HDS A;  5F68 A;  1G28 A;  3OC2 A;  4KUO A;  3LR3 A;  4YOF A;  5IS1 A;  1MDY B;  2QJ5 A;  4BBV A;  4HQA A;  3JVU A;  2M7U A;  4Q0H A;  2J3W A;  4DMZ A;  2PHY A;  2OAQ 1;  2JKR I;  3OCL A;  3IBJ A;  2GZA A;  2PYR A;  2EWW A;  2DMW A;  5AVE A;  3LR0 A;  2GNX A;  5J4E A;  1D7E A;  4L9F A;  4EEP A;  4PAU A;  2KX6 A;  3ZQ5 A;  4ZRR A;  3FPW A;  3HJK A;  4GJ4 A;  1NLW B;  4EW7 A;  2VV7 A;  1OT6 A;  2KOI A;  2V1B A;  3H7W A;  5DJU A;  1ZTU A;  4MN5 A;  4O0P A;  2XA7 S;  2Y8H A;  4P6Z S;  4NEE D;  4BJP A;  3LYX A;  3CIT A;  4H10 A;  3B42 A;  2QKP A;  4R3A A;  3TJZ C;  4IUH A;  2PD8 A;  4II7 A;  3LID A;  3V67 A;  1NLY A;  4GCZ A;  2OWH A;  4CLC B;  3C38 A;  1STZ A;  3NOU C;  1XJ2 A;  3E4O A;  4KQO A;  3PBR A;  3IS2 B;  4K08 A;  3R4K A;  4ETX A;  3BY8 A;  3OCN A;  2W3F A;  2HV1 A;  2VX8 A;  3LIE A;  1XFQ A;  2R78 A;  1MZU A;  4EER A;  1S1Y A;  1YKD A;  1YSQ A;  4F3L B;  1EW0 A;  3E4P A;  4Y3I A;  1OTD A;  4PKY G;  3CWF A;  2M1C A;  3S7O A;  1ZHH B;  3B47 A;  3NHQ A;  2VV8 A;  4NXB A;  2I9V A;  2QL2 A;  3H82 B;  2QWS A;  5HDD A;  3VE3 A;  5IT5 A;  3PBN A;  3ULF A;  2MH3 A;  1T1C A;  4DJ3 A;  2OOL A;  2WKP A;  2XRO A;  2PD7 A;  1MC0 A;  1NLZ A;  2XSS A;  4AYA A;  5TBM B;  2K31 A;  3C30 A;  4BBU A;  4XT2 B;  2HF6 A;  4OOL A;  2L0W A;  4WLA A;  1A0A A;  2ZBB A;  1F5M A;  1T19 A;  2O99 A;  3A0R A;  3UB6 A;  3PHY A;  2ZMF A;  3VV4 A;  2PT7 A;  3R7W A;  3MMH A;  1S1Z A;  5FL3 A;  4E04 A;  3PXP A;  3RTY A;  5HD5 A;  1XJ4 A;  2JKT M;  4O8G A;  3UE6 A;  2ZOH A;  3NOP C;  4OOM A;  4EXO A;  1NKP A;  4MMN A;  3UMD A;  2KLI A;  1LSX A;  1NRJ A;  4ETZ A;  2V9A A;  1G6O A;  5DKL A;  2VGL S;  2XRN A;  1AN4 A;  2JHE A;  1W63 Q;  3S7P A;  2W1T A;  2W3E A;  4NXF A;  2LFH A;  2WKR A;  3MUJ A;  3S7N A;  4EUV A;  1TF1 A;  2LB5 A;  3MF0 A;  4KQD A;  2YKH A;  2NUT C;  3PBS A;  3ZYT A;  4ME4 A;  3F1P B;  4JGQ A;  4H6J B;  1GSX A;  4WEK A;  3IBR A;  1VHM A;  3KX0 X;  2QYB A;  1BYW A;  3PBO A;  5DFY A;  1DRM A;  3T50 A;  1YAX A;  5EFW A;  4R70 A;  3C8C A;  1HLO A;  5HWT A;  2EA9 A;  3EQU A;  3SW1 A;  1GSW A;  3EGX C;  4R6L A;  5HD3 A;  2YPB B;  2YPA B;  2O9B A;  3FC7 A;  3OLO A;  3PBQ A;  3G6O A;  2EWV A;  3CI6 A;  2W1R A;  4YNR A;  5F6A A;  1WA9 A;  2PDR A;  3CAX A;  2J80 A;  1F9I A;  4G3W A;  3JVV A;  2A24 B;  2LB9 A;  5DF9 A;  4I5S A;  2OAP 1;  1MKM A;  4HY8 A;  4NXE A;  4CLC A;  2IA2 A;  4JGO A;  5HL6 A;  3MR0 A;  2PR6 A;  4HIA A;  1OTA A;  4EES A;  4EQ1 A;  3EOI A;  2W27 A;  3IS2 A;  1H3Q A;  2O9C A;  2D02 A;  4QPR A;  3EEH A;  5G4Z A;  4ATK A;  2K7S A;  2HJ9 C;  1LT0 A;  4F3L A;  1S4R A;  3PBT A;  3TW8 A;  4HI4 A;  4WEL A;  3E4Q A;  4M4X A;  2O0Y A;  3CUE C;  4BBT A;  3H82 A;  1IFQ A;  1ODV A;  4GLQ A;  4MCW A;  4I38 A;  4ATI A;  3A0S A;  1DP9 A;  4HP9 A;  3F1N A;  3LR5 A;  3B33 A;  4H10 B;  4IHQ A;  2JKT I;  4MDZ A;  4FSF A;  4IJG A;  4RQ9 A;  3UB7 A;  3MQQ A;  3PR6 A;  4JGP A;  2GJ3 A;  2L1M A;  4Z1W A;  1JNU A;  4PKY A;  2A2L A;  3KO6 A;  4EU0 A;  2KDK A;  3GDI A;  2B02 A;  2J3T D;  4ARZ A;  4GS9 A;  3OBF A;  3P01 A;  3F1O A;  5F69 A;  5MC7 A;  3VE4 A;  4CQH A;  3T4J A;  3EQV A;  3RFB A;  2PR5 A;  5LBR A;  5L8M A;  1W63 M;  5A8B A;  3T4T A;  4PHT A;  3UB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...