4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMAL1b
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/activator
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
4WN5A 3E4OA 3FC7A 2QHKA 4KUKA 1LT0A 4PKYG 3MJQA 3NOUC 4HY8A 3GDIA 5HWVA 1DRMA 4I3AA 1XFNA 3BY9A 4KUOA 3ICYA 1NWZA 1LSWA 1OTEA 1XFQA 2ZBBA 3ULFA 3E4QA 3LIFA 5HWTA 2VLGA 5F68A 3A0RA 4LRYC 3BWLA 3NHQA 1S66L 1DP6A 1UGUA 4HIAA 5I5LA 4H6JA 3UE6A 2JHEA 2ZOHA 2VV6A 4NXFA 2VEAA 5HD3A 2CMNA 4BBUA 3RTYA 1N9LA 3EEHA 3LIDA 4EEUA 3NOTC 2PD8A 2PDRA 2VV7A 2MH3A 5HD5A 4I39A 4GS9B 3F1PB 5I4ZA 3MXQA 3MQOA 3LIBA 1Y28A 3D72A 4NXGA 1N9NA 4K08A 1A0AA 1TS7A 4JGQA 1P97A 2PR6A 1S4RA 5EYOA 3VE4A 4RQ9A 3F1NB 4JGPA 1OJ5A 2V9AA 5DKLA 4EW7A 3MFXA 3H82B 3RH8B 2Z6CA 3IBRA 4PKYA 2W27A 3HJKA 1T1CA 5G4ZA 1UKLC 5DKKA 3UB8A 5TBMB 5A8BA 2B02A 2V0WA 4HH2A 4LPZA 3FG8A 2R78A 2M1CA 4HP4A 1MDYB 4H10B 2KX6A 4HOIA 1V9YA 4HJ4A 4GS9A 3F1PA 3T50A 4KQDA 3E4PA 5DJUA 3LYXA 1GSVA 2Z6DA 3GECA 2W0NA 4EESA 4R6LA 4HP9A 4NXBA 4R70A 5DJTA 4XT2B 1HLOA 4HH3A 4HJ3A 4B9OA 4HHDA 3F1NA 3H7WB 3VE3A 3H82A 2BASA 1OTDA 3LI8A 3MQQA 5KIZA 4L9EA 4YWZA 4E04A 4BBVA 2I9VA 3UB6A 1UWNX 3LUQA 5TBMA 2LFHA 1AN2A 1AN4A 3KX0X 1MDYA 4H10A 2VV8A 1NLWB 1TS6A 3CWFA 1X0OA 3BY8A 2INWA 1G28A 3LIAA 2YPBB 2L1MA 3HJIA 1GSWA 4I38A 1AM9A 4EXOA 1V9ZA 4DJ2A 4L9FA 3LICA 5EFWA 4GHIB 4WF0A 4EEPA 4EERA 2V1BA 2PR5A 2J80A 4ATIA 4XT2A 1R05A 1EW0A 3P7NA 3VOLA 5J3WA 3EWKA 1T1AA 3H7WA 5HWWA 2A24B 1JNUA 1TS0A 2EA9A 2QKPA 2D01A 3F1OA 1ODVA 1XJ6A 3A0VA 5HSQA 4MN5A 3K3CA 4NXEA 4HNBA 2V1AA 5IU1A 1F98A 3PYPA 1NLWA 2OWJA 2P7JA 2L4RA 4WUJA 3U5VA 2YPBA 1GSXA 4LRZE 4M4XA 2PYPA 1MZUA 2WKPA 1D06A 1S67L 3OLOA 4GHIA 3IS2B 3MUJA 4JGOA 3NOPC 3SW1A 1UWPX 4ATHA 4JGRA 3CAXA 5HZHA 3LI9A 4R38A 2YPAB 1P0ZA 5AVFA 5IS1A 3C2WA 4DJ3A 2A24A 4EQ1A 3F1OB 1OJGA 2ZOIA 3K3DA 3CLOA 2QWSA 2D02A 2L0WA 3NJAA 1KOUA 4F3LB 4MN6A 3ZQ5A 4AYAA 4L9GA 1F9IA 4LLOB 2QL2B 4GCZA 4HI4A 3UMDA 1TS8A 3LIEA 3PHYA 1NKPB 1LL8A 2OWHA 1T18A 5HDSA 5F5YA 2QJ5A 5HDCA 4GW9A 3UMEA 4I3JA 4ATKA 1OTBA 5AVEA 1S1YA 2YKHA 5I50A 3UB7A 3IS2A 5HDDA 3A0SA 2HV1A 4WLAA 1LSXA 4I5SA 1XJ4A 4HJ6A 3H9WA 3C8CA 3B33A 5F6AA 1OTAA 1D7EA 1N9OA 1XJ2A 1OT9A 4BBTA 4HQAA 2YPAA 1OT6A 2V0UA 4WL9A 2KDKA 2WKQA 2OOLA 2QJ7A 3MR0A 2PHYA 1DP9A 1DP8A 4F3LA 4H6JB 1T19A 1XJ3A 1S1ZA 1S4SA 2PYRA 2QL2A 2JN7A 4R3AA 1NKPA 5J7EA 2K7SA 1BYWA 1T1BA 5J4EA 1OTIA 2H28A 2PD7A 4EETB 3UB9A 5G4YA 3G6OA 1VB6A 1WA9A 5F69A 2WKRA 2GJ3A 4I3IA 4LRXC 1LSVA 2YKFA
chains in the Genus database with same CATH superfamily
5EVIA 3E4OA 4QB8A 5CRFA 3HBRA 2QHKA 2V20A 1CEFA 1YLJA 3NIAA 4KUKA 3W4PA 2O0YA 3MJQA 2G2UA 3NDEA 4PHTA 5HWVA 1YAXA 3KSFA 4CLCA 3VSLA 1XFNA 5L09A 4RVAA 4C6YA 5EUAA 1H8MA 1S66L 1NZOA 1MWSA 1SKOB 3BFFA 3FPWA 4EBNA 4H6JA 1PWDA 3PBTA 5M18A 2ZOHA 2VV6A 5HD3A 1ZC2A 2CMNA 5G18A 5AQAA 1I2WA 3EEHA 3N6IA 4EEUA 3NOTC 3M6HA 2XDMA 2MJ6A 1VQQA 2WZXA 3QP2A 3F1PB 5F1GA 4Z9QA 3MQOA 5FI7A 5KSCA 3ZG8B 2OV5A 4UA7A 3D72A 4NXGA 3BECA 3IXHA 4GNUA 2ZM2A 1MY8A 3RXWA 5FQMA 4WEKA 3VP3A 2W3FA 3M6BA 4KQOA 3A3JA 4ZDXA 3MKFA 3IT9A 3LGOA 2OAP1 4U0TA 4P6BA 3RH8B 1PWCA 3DTMA 4CLCD 5EM1A 4II7A 3T4KA 1IFQA 3GMWA 4EBLA 4GN2A 1T1CA 5G4ZA 5GHZA 2OLVA 2PT7A 1XGJA 5DKKA 2EWVA 2B02A 2V0WA 1G6OA 2R78A 1W8YA 3E98A 1V9YA 1MC0A 2IWDA 5EVLA 5CECA 4O01A 3ZHHA 3BFCA 4B93A 4EESA 4R6LA 4DE0A 3V50A 3QP1A 4G3KA 4F94A 5FQKA 4NXBA 3G35A 4X68A 4BJPA 2CC1A 2VGKA 4HH3A 1FR6A 1PZPA 3CUEA 3F1NA 3VE3A 1BLHA 1JTGA 3FKVA 2Z2MB 2IA2A 2Y2JA 4BL3A 3AGFA 1OTDA 1I2SA 2ZQ9A 3UB5P 1VETB 4L9EA 2ZQAA 2WGIA 4YWZA 3UPOA 4UHUA 3N8LA 5DTKA 1W8QA 5TBMA 2LFHA 4Y13A 5HL1A 3BLSA 1AXBA 1KDSA 3NY4A 3DBAA 4H10A 3SS5A 4O8GA 2VV8A 2OAQ1 4CJNA 2V2FF 5TFQA 3LIAA 2LB9A 2V8CA 3PBRA 4GZBA 4IBRA 3HLGA 2ZL1B 4EXOA 4LV0A 5CGSA 4L9FA 4RX2A 5EOEA 5EFWA 4EEPA 4EERA 4PM9A 2XQZA 2Y2LA 2PR5A 3ZYTA 3Q82A 3P7NA 3Q1FA 3TE8A 1DJCA 3T4OA 2BG1A 3L7HA 2HDQA 3H7WA 3LEQA 4KZ8A 1JNUA 1K57C 5GL9A 4WEJA 2Q0OA 4KQQA 3F1OA 4UEYA 4DE3A 4NETA 4R3BA 1YM1A 5HSQA 4NXEA 3Q07A 5L2FA 5IU1A 1F98A 1ZKJA 4A5RA 3IBJA 3B47A 1KVLA 1L0DA 4PM6A 1JWVA 1N4OA 2A49A 4IUKA 1XGIA 3OPHA 3VP2A 4S2OA 2PYPA 2JKFA 1ERMA 4HESA 5CHMA 1ALQA 3GV9A 4UA9A 3RJUA 3MUJA 4JGOA 3NOPC 3DTKA 1MKMA 2ZC3B 5U47A 3EGDC 1PI5A 5HPFA 5C5KA 4EQIA 5L10A 2H10A 5M1AA 3VFFA 3T1XA 3F1OB 5L8MA 5EE8A 3AGEA 1H5XA 5CHUA 3G32A 3E2KA 3E0YA 3KYZA 3LY4A 3V5MA 4E3IA 1YLYA 1Z09A 2XR0A 1CQAA 3MXSA 3IF6A 4WMCD 3IH9A 3IH8A 2QMIA 3LIEA 1NKPB 4PM5A 4UA6A 2Y79A 2PU2A 1HVBA 3FWLA 1T18A 1LHYA 3T1QB 5HDCA 2FFFB 1J3WA 1K4FA 2P9VA 3V3SA 3WRTA 1S1YA 4QY6A 5I50A 3IS2A 5IT5A 5FEGA 3BEBA 2HV1A 4WLAA 4ME4A 1NRJA 5HFOA 1XJ4A 3O3VA 1WE4A 3B33A 1D7EA 3HCYA 4G3WA 4XUXA 4Q8IA 3C7VA 4ZJ2A 1XJ2A 2EX9A 3ZNTA 4DMZA 1OT9A 1M6KA 1OT6A 2V0UA 3DTEA 3Q7ZA 4E3OA 1L3LA 3CI6A 3GTCA 5CEDA 1T19A 5FSRA 2ZQ7A 1S1ZA 5HAPA 3R7WA 2QL2A 2JN7A 3EQUA 3R4KA 2WGWB 5J7EA 2PU4A 4BD1A 2K7SA 1BYWA 4IBXA 5DF8A 3UO9A 4EETB 2W3HA 1TDGA 4IUHA 3ITBA 4E3MA 4ZAMA 3V39A 2EWWA 4UQIM 1K55A 3EEAA 2IWCA 1LSVA 3TG9A 1E4DA 4BQMA 4KZ5A 5E2HA 4E3NA 1YLWA 3BM6A 4E3JA 4KZBA 2LB5A 4FH4A 3NECA 4HY8A 1LL9A 1KVMA 3GDIA 4R4RA 4P0MA 4QY5A 4I3AA 3UDFA 1LSWA 1LL5A 2ZBBA 1ERQA 3LR4A 4LRYC 3BWLA 1FOFA 1DP6A 5I5LA 2XFSA 1GA9A 2HJEA 2ACGA 4GJ4A 1EROA 3UE6A 1YMXA 3WRZA 1VHMA 3G2YA 3W8KA 3VP1A 1K38A 1N9LA 2WGVA 4MBKA 3LIDA 1Y54A 2PD8A 1NZUA 4ARZB 3HLCA 1ZG6A 4GS9B 4WBGA 3PBNA 4R0QA 3ZG9B 1PNEA 5I4ZA 1PW8A 1HLUP 4EUVA 5EVIC 1ESUA 5E2FA 1HZOA 2X01A 1Y28A 1P9RA 2Y4AA 1TVFA 1N9NA 2VK3A 4OP8A 1NY0A 2Y2HA 3LO7A 1ES4A 2XROA 2Y2NA 4IEDA 4CLCC 2E8IA 1CF0A 4BMWA 2BTFP 5DTSA 2RCXA 4FUWA 1A0AA 1P97A 3WS4A 3PTEA 2VGLM 5EYOA 4JXVA 2PBYA 5CTNA 1GCEA 4JGPA 1OJ5A 2V9AA 4FH2A 1SKOA 1L0FA 4YOFA 5FQIA 4R3JA 5AQ9A 3A3DA 1YPRA 4PKYA 4LCLA 3GVBA 4NK3A 4Y3IA 2DRWA 2W27A 5HPIA 3UN7A 3HJKA 3G4PA 1K6RA 5A8BA 3ITAA 4LPZA 1Z6FA 2J9OA 3S4XA 4HOIA 1OMEA 5HAQA 4HJ4A 4KG5A 1O7EA 3F1PA 3T50A 1KGEA 3LYXA 4X69A 1GSVA 2WYXA 5AJGA 1VEUB 1RP5A 2HDUA 2GZAA 2WADA 4MLLA 4LGWA 4ZJ1A 4R70A 4FTXA 2JE5A 4Q0HA 5DJTA 3JPUA 3U2AA 3N7WA 1JVJA 1TF1A 4B9OA 4N1XA 2H0YA 1KE3A 3IWOA 4HHDA 2UWXA 4HEFA 1IKIA 3ZNYA 4BENA 3LI8A 3GSGA 5A93A 4QWOA 3O5YA 4E04A 4Y0UA 4JKTA 4JBFA 4QU3A 4OLDA 3O87A 3KX0X 3UPPA 3FKWA 1RGYA 3VOYA 1K0KA 3UPNA 2VA0A 5FEFA 1NLWB 1TS6A 2HDSA 5FL3A 4BL2A 5CGWA 1X0OA 1G28A 3HJIA 2EXAA 4MBHA 5EOOA 4IJGA 2Y59A 3PBSA 4DXBA 4DDSA 3OCLA 4WF0A 2V1BA 4OOMA 5CXWA 5E2GA 2VGLS 4HBUA 1EW0A 3CUEC 4KZ7A 4B4XA 1TEMA 3KSIA 1SZVA 4PM8A 4XXRA 1QMFA 4QD4A 1K56D 1XX2A 3QP6A 3MQ0A 3C4OA 1PFLA 2R9XA 1Q2PA 2O99A 1TS0A 2EA9A 1N9BA 2QKPA 3IHBA 1VETA 3A3FA 3KSGA 4OOYA 4DXCA 1ODVA 4XUZA 3NDGA 2VJWA 2XA7S 2Y91A 5DF9A 4MN5A 4JXGA 4BD0A 4E6XA 1H8ZA 3PYPA 1YT4A 1SCWA 1EI5A 4WUJA 1CK3A 3Q81A 4Y7PA 4UAAA 5I94A 4LV1A 2ZM0A 2HPBA 2XK1A 2XD5A 3HUMA 4OPZA 4P85A 1W79A 2ZL1A 2VKSA 1JTDA 4NG2A 5TGFA 1UWPX 3QHYA 4ATHA 4JGRA 1FQGA 4S2NA 5HZHA 3SOIA 2HZ5A 3LI9A 1G68A 3SH9A 4X1MA 4KQRA 4R38A 2YPAB 4PAUA 1OJGA 3K3DA 2EX6A 2O9AA 3WWXA 2QWSA 2L0WA 3NJAA 2Y2MA 1KOUA 3CMZA 4KZ4A 3ZCZA 4MN6A 5FDSA 5LBRA 5EECA 4OH0A 2C5WB 3CJMA 3UMDA 1TS8A 3PHYA 1W7FA 4Z1WA 5CX7A 3CPTB 4DE2A 2ZQ8A 3KYQA 2ZMVA 5F5YA 3DTIA 2IWBA 3UMEA 5TJJA 4OPQA 5AVEA 5FATA 3LCEA 1IYQA 3OPRA 4S2LA 3EOIA 3BFGA 3UB7A 2DMWA 3EQVA 4GDBA 4JXSA 2WUQA 3HLBA 1LSXA 4OLGA 3TW8A 4I5SA 3HLEA 1G6AA 5F6AA 1OTAA 3MFDA 4KZ3A 2P74A 5GHYA 1VM1A 4OKPA 2J8YA 4WL9A 4WMCA 1NXYA 3LFVA 4IVKA 4Y5FA 4U0XA 5J8XA 2PHYA 1DP8A 3C7UA 3MS6A 4LENA 3WS5A 4EWFA 1TD5A 2HP5A 1Y4OA 3PXPA 2XD1A 4OOLA 1XJ3A 1S4SA 3LR3A 3HLWA 3IF6C 2XF3A 3UNWA 3VP4A 4N9LA 3S7NA 2I72A 5CGXA 4MDZA 4GD8A 1NKPA 5BOHA 1RGZA 4GKUA 5DF7A 1T1BA 5J4EA 2H28A 1K1FA 5MC7A 1MWTA 3FZCA 1KGFA 1VB6A 1WA9A 2W1TB 2ZLYA 4BWIA 4X53A 3S7PA 5F69A 2WKRA 2GJ3A 3D4FA 2ZMFA 1STZA 3DAVA 4YFMA 4RA7A 5FAPA 3FC7A 2WAEA 5FA7A 2JCHA 1W63Q 2O9BA 4PKYG 1GA0A 3NOUC 3SH7A 1KE4A 1W63M 3O86A 3DW0A 3KYEA 1DRMA 4DF6A 3LEZA 1FSWA 3N8SA 3BY9A 4KUOA 2HJ9C 3OBFA 3ICYA 1NWZA 1OTEA 3ULFA 1I5QA 2VLGA 1IYSA 3BW6A 3N8RA 3NHQA 3T1RA 4HIAA 3IWIA 1K54A 1K25A 3IXGA 4GD6A 1BUEA 4NXFA 4M3KA 5F83A 1ACFA 4BBUA 2WGWA 2ZC4B 3RTYA 1LI9A 2EFXA 2PDRA 3NI9A 2VV7A 2MH3A 5HD5A 1K55C 4I39A 2V8FA 3KSHA 2JC7A 2XH9A 3TSGA 3RFBA 3MXQA 4GB7A 3LIBA 3NULA 1PIOA 3MSHA 4WZ5A 4HBTA 4WYYA 3W2ZA 5HL6A 1NYYA 3U4LP 4X6TA 4D2OA 5FASA 1TS7A 2ZC6B 3T4LA 1DY6A 2PR6A 1S4RA 3ZVTA 3W4OA 2HP6A 4EW7A 2XFTA 3H82B 1H8YA 4GDNA 1BZAA 1MPLA 2PAVP 2G2WA 2Z2LB 3JYIA 2WK0A 1ZG4A 2JBFA 3UB8A 5KMWA 5GLDA 4Q0JA 2J7VA 3IX3A 4HH2A 5KSHA 1E25A 2M1CA 4HP4A 1MDYB 4ARZA 4OQGA 1BLCA 4GS9A 4KQDA 2WZZA 3UDIA 2A2LA 2Z6DA 4CPKA 5HX9A 3OC2A 3G31A 1BTLA 1SHVA 4NEED 2K2NA 1LLBA 4OPYA 3TOIA 1U60A 3Q7VB 4EUZA 4GOGA 4XT2B 1HLOA 2Q9NA 3HLDA 3HL9A 4HJ3A 1ONGA 3MZFA 2Y2KA 2ZC5B 1E3UA 1KE0A 2Y2OA 3S7OA 3VFHA 2BASA 3MQQA 5KIZA 4ZRRA 3VP0A 4YINA 3BQAA 2JKRI 3UB6A 3MBZA 1UWNX 4B88A 3LUQA 1AN2A 5FQJA 3OCNA 4ETXA 3M2KA 4LV3A 2HP9A 4MMNA 2G7UA 1NJ4A 1IKGA 4H8RA 3I7JA 3V67A 2INWA 4E3LA 4AFIA 3PAGA 1D1JA 4DN0A 2YPBB 2L1MA 3BQ8A 4E6WA 1VEUA 2C6WB 1AM9A 2KOIA 1IYOA 2ZQDA 3PBOA 2VGJA 3BLMA 4GHIB 4ZTKA 4C75A 4RYEA 2JKTI 1R05A 2JKGA 5J3WA 1IYPA 2WKIA 5EM0A 1ES5A 5IHVA 2PRFA 1T1AA 2WKHA 4IVIA 3C5AA 2A24B 2VX8A 1H3QA 1Q2QA 3UE3A 1DJBA 4KZ6A 3S7QA 1XJ6A 5EPHA 4Y0TA 1EWZA 1MBLA 3QNBA 1ZHHB 1E3UD 3K3CA 1BLPA 2XLNA 1YLPA 4UQIS 1NLWA 2OWJA 2L4RA 3JVUA 4QJGA 3U5VA 4C3QA 3IWQA 1L2SA 4KZAA 4CQHA 1GSXA 2NUPC 2J9PA 4S2JA 1KDWA 2WKPA 1D06A 1K56A 3K2NA 3UY6A 3SW1A 1YSPA 2B95A 5E43A 1MWUA 2Y2IA 1P0ZA 5AVFA 4DJ3A 2E8JA 1P9WA 1CI8A 1YSQA 2ZOIA 3CLOA 3C30A 4JF5A 4OVDA 4F3LB 1CI9A 2DNSA 2FH5A 4L9GA 4KG2A 1ZTUA 1F9IA 4GCZA 4WELA 4KG6A 3HUOA 3UE1A 1L0EA 5GHXA 5HDSA 1PYYA 2ZC7A 3OOVA 2J3TD 4FCFA 2W3DA 3W4QA 2X02A 4ATKA 4LCMA 1OTBA 4OQ0A 5FI6A 2QPNA 2XEPA 2YKHA 5DFYA 3DWZA 5EV0A 2RL3A 4S2KA 5HDDA 5EVIB 3IHAA 2VZWA 4K0XA 4RX3A 3ZGAB 4S2NC 5CHJA 4PPRA 3C8CA 3NBLA 1BULA 1N9OA 4WM9A 4CLCB 4BBTA 4P6ZM 4HQAA 2YPAA 2KDKA 4Y0OA 2WKQA 3T4SA 2QJ7A 5EVID 1A0KA 3P09A 3QP8A 3AGDA 4H6JB 1LI0A 5FI2A 4DDYA 2JKRM 1QMEA 2PYRA 5DTTA 1FIKA 3MZEA 3L9KA 2EXBA 3S22A 3CPTA 1OTIA 5E2EA 2HGVA 4S2IA 2PD7A 3OPLA 1NRFA 3TRCA 4R1GA 4U3TA 1J9MA 5G4YA 2XRNA 4LRXC 5JYOA 3PR6A 2X71A 4WN5A 5AQ7A 1PWGA 3T4QA 1LT0A 2ZM8A 1BLSA 4X25A 2JKTM 2PBDP 3TJZC 3O88A 5HARA 1XFQA 1ZZAA 3CHWP 3QP4A 3E4QA 3LIFA 5HWTA 5F68A 1GHIA 3A0RA 2GDNA 3FPVA 1CJFA 1UGUA 1IOUA 5M19A 3BRMA 1OPXA 2JHEA 4NKPA 2VEAA 3ZDJA 4OQHA 3E2LA 3BFDA 3IF5A 2DCFA 4X56A 1XP4A 3S1YA 1RCJA 5K5BA 1TDLA 1ONHA 1ES3A 1JWPA 2W1TA 3C38A 5FQ9A 2M7UA 1XXMA 1C3BA 3HUNA 3D3OA 4MNRA 4FOFA 4KZ9A 2B18A 3BYDA 4QPRA 3JVVA 1FCNA 4P6ZS 4K08A 1IELA 2XSSA 4JGQA 2HDRA 3T4TA 1L0GA 2M7VA 4Y2FA 2OSUA 3A3EA 3MMHA 3VE4A 4RQ9A 3F1NB 1K54C 3HLFA 5DKLA 3MFXA 5GLAA 3BFEA 1NYMA 3LR5A 2Z6CA 1BT5A 4ID4A 3IBRA 4MCWA 3GQZA 4O0PA 3VOZA 4G3VA 2Y2QA 2Y2PA 1UKLC 1K6SA 2GNXA 3IQAA 5TBMB 1MXOA 1S6RA 2ZJ9A 3PAEA 4ETZA 4Y17A 4Y15A 2H0TA 3N4IA 3M2JA 1MWRA 3FG8A 3SH8A 2FFYA 4EBPA 4H10B 1FSYA 2KX6A 5TR7A 4MEZA 4OONA 4JF4A 1H0MA 2WKEA 5DVAA 3E4PA 5DJUA 1PW1A 2QZ6A 1W5DA 5GLBA 5EVEA 4WZ5C 1PI4A 4EU0A 2W3GA 3GECA 2W0NA 1FR1A 4OQIA 4OPRA 4HP9A 4LV2A 3WS1A 5CEBA 2NUTC 4JF6A 1BSGA 4ZBEA 1F5MA 1F2KA 1K4EA 4N1HA 2EX2A 2V1ZA 3P98A 5FDHA 3H7WB 3HREA 3GRJA 4YNRA 3H82A 3IX8A 3ISGA 1K57A 3G30A 1DJAA 4BBVA 2Y2GA 2I9VA 2R9WA 4GLQA 2GX5A 1AN4A 5CERA 3SS3A 4FD8A 1MDYA 1GHMA 5AQBA 3QP5A 4X55A 1XKZA 3CWFA 4BLMA 3BY8A 3NC8A 3IXDA 3RXXA 3HVFA 3G2ZA 1GSWA 4DKIA 4I38A 2XGNA 2K31A 5FAOA 3G34A 1V9ZA 5FQQA 5HW3A 2ZQCA 4DJ2A 3LICA 2HF6A 1G5UA 2ZMAA 3P01A 4MN7A 1ESIA 2J80A 3GR2A 5DFXA 3Q7VA 5HAIA 4XT2A 4ATIA 5JYPA 1JWZA 3VOLA 3EWKA 1XA1A 3VMAA 3T4JA 5HWWA 4EV4A 3IX4A 3B3XA 5GLCA 4JPMA 2D01A 3FV7A 2J3WA 3LY3A 5FAQA 3WS0A 3EGXC 4QHCA 3A0VA 1WYCA 1SKFA 4R4SA 1NLYA 4HNBA 2V1AA 3IF6B 2B5RA 3SS4A 4N92A 2P7JA 4JXWA 5F1FA 1XA7A 3A3IA 4WZ4A 4K91A 4X1LA 2P04A 3KO6A 2YPBA 4LRZE 1YMSA 4DE1A 4M4XA 2P9VB 1MZUA 1S67L 2W3EA 4O7DA 2UV0E 1YLTA 3OLOA 4GHIA 3IS2B 3CITA 1WYBA 4D60A 2AVXA 3DWKA 3NCKA 4JLFA 3VV4A 1FCOA 3IXBA 2W1RA 3CAXA 2FZ0A 1YKDA 4P87A 3LR0A 4ESPA 5A92A 4OP5A 3CG5A 4L0LA 5IS1A 3C2WA 2A24A 5A91A 3UE0A 4EQ1A 1ES2A 4LFUA 3MF0A 3T12B 2ZD8A 1S0WA 2D02A 2J3TC 1FILA 3PBQA 3ZQ5A 4AYAA 3R7WB 4S2PA 4LLOB 2QL2B 4HI4A 5L07A 4K0WA 3MXRA 3B42A 1LL8A 2OWHA 4PM7A 1IEMA 1XPBA 2EFUA 4Q0IA 1KGGA 2P08A 3T1SA 2KLIA 3UDXA 2QJ5A 3ZVWA 1O07A 4GW9A 2Y55A 1M40A 4I3JA 4S2MA 3WS2A 1CEGA 4B4ZA 1NLZA 2QYBA 5F82A 4FSFA 3A0SA 4R23A 3ZG5A 4DRTA 3ZFZA 5A90A 4HJ6A 3H9WA 3C4PA 1PZOA 3ZG0A 1SDNA 2H5SA 3OZHA 4ZJ3A 3D9YA 1YQSA 3FYZA 3QNCA 4KENB 2A3UA 2OOLA 2OLUA 1GHPA 4E3KA 3MR0A 1DP9A 4CLCE 3CZDA 1YLZA 1MKIA 4F3LA 1FCMA 3VSKA 2Q9MA 3ZG7B 1AWIA 2WAFA 4MBFA 2EX8A 2Y8HA 4R3AA 3OPPA 1HD8A 5D3OA 4PMAA 4IHQA 5KZHA 2O9CA 2XA7M 3V3RA 3UB9A 1SDEA 1HTZA 5CTMA 3SZTA 3G6OA 3MZDA 1PRQA 4I3IA 4N9KA 2BLSA 3BJNA 3MKEA 2YKFA
chains in the Genus database with same CATH topology
4WN5A 3E4OA 3FC7A 2QHKA 2LB5A 3T4QA 1W63Q 2O9BA 4KUKA 1LT0A 4PKYG 2O0YA 3MJQA 3NOUC 4HY8A 3GDIA 4PHTA 2JKTM 1W63M 5HWVA 1YAXA 3TJZC 3KSFA 1DRMA 4CLCA 4I3AA 1XFNA 3BY9A 4KUOA 2HJ9C 3OBFA 3ICYA 1NWZA 1LSWA 1OTEA 1XFQA 2ZBBA 3LR4A 3ULFA 3E4QA 3LIFA 5HWTA 2VLGA 5F68A 3A0RA 4LRYC 3BW6A 3BWLA 1H8MA 3NHQA 1S66L 3FPVA 1DP6A 1UGUA 1IOUA 4HIAA 5I5LA 3FPWA 4H6JA 2HJEA 4GJ4A 3PBTA 3UE6A 1OPXA 1VHMA 2JHEA 2ZOHA 2VV6A 4NXFA 4NKPA 2VEAA 5HD3A 2CMNA 4BBUA 3RTYA 1N9LA 3EEHA 3LIDA 4EEUA 3NOTC 2PD8A 2PDRA 2VV7A 2MH3A 5HD5A 4ARZB 5K5BA 2MJ6A 4I39A 4GS9B 3KSHA 3PBNA 2W1TA 3F1PB 5I4ZA 3RFBA 3C38A 3MXQA 4EUVA 3MQOA 2M7UA 3LIBA 1Y28A 1P9RA 3D72A 4NXGA 1N9NA 3D3OA 3W2ZA 2XROA 5HL6A 4FOFA 4CLCC 2B18A 4QPRA 3JVVA 4BMWA 4P6ZS 4K08A 1A0AA 1TS7A 2XSSA 4JGQA 3T4LA 1P97A 3T4TA 2PR6A 2M7VA 2VGLM 1S4RA 4WEKA 5EYOA 4Y2FA 2W3FA 3MMHA 4KQOA 3VE4A 4RQ9A 3F1NB 4JGPA 1OJ5A 2V9AA 5DKLA 4EW7A 3MFXA 3H82B 4YOFA 2OAP1 3RH8B 3LR5A 2Z6CA 3IBRA 4CLCD 4MCWA 4O0PA 4II7A 3T4KA 1IFQA 4PKYA 4G3VA 4Y3IA 2W27A 5HPIA 3HJKA 1T1CA 5G4ZA 1UKLC 2PT7A 5DKKA 3UB8A 2GNXA 5TBMB 4Q0JA 2EWVA 4ETZA 5A8BA 2B02A 2V0WA 4HH2A 5KSHA 1G6OA 4LPZA 3FG8A 2R78A 2M1CA 3E98A 4HP4A 1MDYB 4ARZA 4H10B 2KX6A 4HOIA 1V9YA 4HJ4A 1MC0A 4GS9A 3F1PA 3T50A 4KQDA 3E4PA 5DJUA 4O01A 3LYXA 1GSVA 2A2LA 2Z6DA 4EU0A 2W3GA 3GECA 2W0NA 5AJGA 4B93A 4EESA 3OC2A 4R6LA 2GZAA 4NEED 2K2NA 4HP9A 4G3KA 2NUTC 4NXBA 4R70A 1F5MA 4Q0HA 5DJTA 4XT2B 1HLOA 3U2AA 4BJPA 4HH3A 1TF1A 4HJ3A 4B9OA 4HHDA 3CUEA 3F1NA 3H7WB 3VE3A 2IA2A 4YNRA 3H82A 3S7OA 2BASA 1OTDA 3LI8A 3MQQA 5KIZA 4ZRRA 4L9EA 3O5YA 4YWZA 4E04A 3BQAA 2JKRI 4BBVA 2I9VA 3UB6A 4GLQA 2GX5A 1UWNX 3LUQA 5TBMA 2LFHA 1AN2A 1AN4A 3OCNA 3KX0X 4ETXA 1MDYA 3DBAA 4H10A 4MMNA 4O8GA 2VA0A 2VV8A 2G7UA 1TS6A 1NLWB 2OAQ1 5FL3A 3CWFA 1X0OA 3BY8A 3V67A 2INWA 1G28A 4AFIA 3LIAA 4DN0A 2YPBB 2LB9A 3PBRA 2L1MA 3BQ8A 3HJIA 1GSWA 4I38A 4IJGA 1AM9A 2KOIA 4EXOA 3PBSA 2K31A 3PBOA 1V9ZA 3OCLA 4L9FA 4DJ2A 3LICA 5EFWA 4GHIB 4WF0A 2HF6A 4EEPA 2V1BA 4EERA 4OOMA 2PR5A 3ZYTA 3P01A 4MN7A 2J80A 2JKTI 5DFXA 2VGLS 4ATIA 4XT2A 1R05A 1EW0A 3P7NA 3TE8A 3VOLA 5J3WA 3CUEC 3T4OA 3KSIA 3EWKA 3T4JA 1T1AA 3H7WA 5HWWA 2A24B 3MQ0A 1JNUA 2O99A 1TS0A 2VX8A 2EA9A 1H3QA 4WEJA 3UE3A 2QKPA 2D01A 3F1OA 3KSGA 4UEYA 1ODVA 3S7QA 1XJ6A 2J3WA 1ZHHB 2VJWA 3EGXC 3A0VA 2XA7S 5DF9A 5HSQA 4MN5A 3K3CA 4NXEA 1NLYA 4HNBA 2V1AA 5IU1A 4UQIS 1F98A 3PYPA 1NLWA 3IBJA 2OWJA 2P7JA 2L4RA 3JVUA 4WUJA 3U5VA 3B47A 4CQHA 2P04A 3KO6A 2YPBA 1GSXA 4IUKA 4LRZE 2NUPC 4M4XA 2PYPA 1MZUA 2WKPA 1D06A 1S67L 2W3EA 3OLOA 4GHIA 3IS2B 3CITA 3K2NA 3MUJA 4JGOA 2VKSA 3NOPC 3SW1A 3VV4A 1MKMA 1UWPX 4ATHA 1YSPA 4JGRA 3EGDC 2W1RA 3CAXA 5HPFA 5C5KA 2FZ0A 1YKDA 5HZHA 3LI9A 3LR0A 4R38A 2YPAB 1P0ZA 4L0LA 5AVFA 5IS1A 3C2WA 4DJ3A 2A24A 4PAUA 4EQ1A 1P9WA 3F1OB 1OJGA 5L8MA 3MF0A 1YSQA 3K3DA 2ZOIA 3CLOA 2O9AA 3C30A 3KYZA 3E0YA 2QWSA 2D02A 2L0WA 3NJAA 1KOUA 2J3TC 4F3LB 2FH5A 3PBQA 4MN6A 3ZQ5A 4AYAA 4L9GA 5LBRA 3R7WB 1ZTUA 1F9IA 4LLOB 2QL2B 4GCZA 4HI4A 3UMDA 1TS8A 3LIEA 4WELA 3PHYA 4Z1WA 1NKPB 3B42A 1LL8A 2Y79A 5CX7A 2OWHA 4Q0IA 1T18A 2P08A 5HDSA 3KYQA 2KLIA 2ZMVA 5F5YA 3OOVA 2QJ5A 2J3TD 5HDCA 2W3DA 4GW9A 3UMEA 5TJJA 4I3JA 4ATKA 1OTBA 5AVEA 1S1YA 1NLZA 2YKHA 5DFYA 2QYBA 3EOIA 5I50A 3UB7A 4FSFA 2DMWA 3IS2A 5HDDA 5IT5A 3EQVA 3A0SA 2VZWA 2HV1A 4WLAA 1LSXA 4ME4A 1NRJA 3TW8A 4I5SA 1XJ4A 4HJ6A 3H9WA 3C8CA 3B33A 5F6AA 1OTAA 1D7EA 1N9OA 3HCYA 4G3WA 1XJ2A 4CLCB 4DMZA 1OT9A 4P6ZM 4HQAA 4BBTA 1OT6A 2YPAA 2V0UA 4WL9A 2KDKA 3T4SA 2WKQA 2OOLA 2QJ7A 3LFVA 4Y5FA 3MR0A 2PHYA 1DP9A 4CLCE 1DP8A 3CI6A 1TD5A 3PXPA 4F3LA 4H6JB 1T19A 4OOLA 1XJ3A 1S1ZA 1S4SA 3LR3A 2JKRM 3R7WA 2PYRA 2QL2A 2JN7A 3EQUA 2Y8HA 4R3AA 3S7NA 3R4KA 4MDZA 1NKPA 5J7EA 2K7SA 1BYWA 1T1BA 5J4EA 1OTIA 2H28A 2HGVA 4IHQA 2PD7A 4EETB 2O9CA 2W3HA 4IUHA 2XA7M 3TRCA 3UB9A 5MC7A 5G4YA 3G6OA 1VB6A 1WA9A 2W1TB 2EWWA 4BWIA 3S7PA 5F69A 4UQIM 2WKRA 2XRNA 2GJ3A 4I3IA 3EEAA 3BJNA 2ZMFA 4LRXC 1LSVA 3PR6A 2YKFA 1STZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WN5 A;  3E4O A;  3FC7 A;  2QHK A;  4KUK A;  1LT0 A;  4PKY G;  3MJQ A;  3NOU C;  4HY8 A;  3GDI A;  5HWV A;  1DRM A;  4I3A A;  1XFN A;  3BY9 A;  4KUO A;  3ICY A;  1NWZ A;  1LSW A;  1OTE A;  1XFQ A;  2ZBB A;  3ULF A;  3E4Q A;  3LIF A;  5HWT A;  2VLG A;  5F68 A;  3A0R A;  4LRY C;  3BWL A;  3NHQ A;  1S66 L;  1DP6 A;  1UGU A;  4HIA A;  5I5L A;  4H6J A;  3UE6 A;  2JHE A;  2ZOH A;  2VV6 A;  4NXF A;  2VEA A;  5HD3 A;  2CMN A;  4BBU A;  3RTY A;  1N9L A;  3EEH A;  3LID A;  4EEU A;  3NOT C;  2PD8 A;  2PDR A;  2VV7 A;  2MH3 A;  5HD5 A;  4I39 A;  4GS9 B;  3F1P B;  5I4Z A;  3MXQ A;  3MQO A;  3LIB A;  1Y28 A;  3D72 A;  4NXG A;  1N9N A;  4K08 A;  1A0A A;  1TS7 A;  4JGQ A;  1P97 A;  2PR6 A;  1S4R A;  5EYO A;  3VE4 A;  4RQ9 A;  3F1N B;  4JGP A;  1OJ5 A;  2V9A A;  5DKL A;  4EW7 A;  3MFX A;  3H82 B;  3RH8 B;  2Z6C A;  3IBR A;  4PKY A;  2W27 A;  3HJK A;  1T1C A;  5G4Z A;  1UKL C;  5DKK A;  3UB8 A;  5TBM B;  5A8B A;  2B02 A;  2V0W A;  4HH2 A;  4LPZ A;  3FG8 A;  2R78 A;  2M1C A;  4HP4 A;  1MDY B;  4H10 B;  2KX6 A;  4HOI A;  1V9Y A;  4HJ4 A;  4GS9 A;  3F1P A;  3T50 A;  4KQD A;  3E4P A;  5DJU A;  3LYX A;  1GSV A;  2Z6D A;  3GEC A;  2W0N A;  4EES A;  4R6L A;  4HP9 A;  4NXB A;  4R70 A;  5DJT A;  4XT2 B;  1HLO A;  4HH3 A;  4HJ3 A;  4B9O A;  4HHD A;  3F1N A;  3H7W B;  3VE3 A;  3H82 A;  2BAS A;  1OTD A;  3LI8 A;  3MQQ A;  5KIZ A;  4L9E A;  4YWZ A;  4E04 A;  4BBV A;  2I9V A;  3UB6 A;  1UWN X;  3LUQ A;  5TBM A;  2LFH A;  1AN2 A;  1AN4 A;  3KX0 X;  1MDY A;  4H10 A;  2VV8 A;  1NLW B;  1TS6 A;  3CWF A;  1X0O A;  3BY8 A;  2INW A;  1G28 A;  3LIA A;  2YPB B;  2L1M A;  3HJI A;  1GSW A;  4I38 A;  1AM9 A;  4EXO A;  1V9Z A;  4DJ2 A;  4L9F A;  3LIC A;  5EFW A;  4GHI B;  4WF0 A;  4EEP A;  4EER A;  2V1B A;  2PR5 A;  2J80 A;  4ATI A;  4XT2 A;  1R05 A;  1EW0 A;  3P7N A;  3VOL A;  5J3W A;  3EWK A;  1T1A A;  3H7W A;  5HWW A;  2A24 B;  1JNU A;  1TS0 A;  2EA9 A;  2QKP A;  2D01 A;  3F1O A;  1ODV A;  1XJ6 A;  3A0V A;  5HSQ A;  4MN5 A;  3K3C A;  4NXE A;  4HNB A;  2V1A A;  5IU1 A;  1F98 A;  3PYP A;  1NLW A;  2OWJ A;  2P7J A;  2L4R A;  4WUJ A;  3U5V A;  2YPB A;  1GSX A;  4LRZ E;  4M4X A;  2PYP A;  1MZU A;  2WKP A;  1D06 A;  1S67 L;  3OLO A;  4GHI A;  3IS2 B;  3MUJ A;  4JGO A;  3NOP C;  3SW1 A;  1UWP X;  4ATH A;  4JGR A;  3CAX A;  5HZH A;  3LI9 A;  4R38 A;  2YPA B;  1P0Z A;  5AVF A;  5IS1 A;  3C2W A;  4DJ3 A;  2A24 A;  4EQ1 A;  3F1O B;  1OJG A;  2ZOI A;  3K3D A;  3CLO A;  2QWS A;  2D02 A;  2L0W A;  3NJA A;  1KOU A;  4F3L B;  4MN6 A;  3ZQ5 A;  4AYA A;  4L9G A;  1F9I A;  4LLO B;  2QL2 B;  4GCZ A;  4HI4 A;  3UMD A;  1TS8 A;  3LIE A;  3PHY A;  1NKP B;  1LL8 A;  2OWH A;  1T18 A;  5HDS A;  5F5Y A;  2QJ5 A;  5HDC A;  4GW9 A;  3UME A;  4I3J A;  4ATK A;  1OTB A;  5AVE A;  1S1Y A;  2YKH A;  5I50 A;  3UB7 A;  3IS2 A;  5HDD A;  3A0S A;  2HV1 A;  4WLA A;  1LSX A;  4I5S A;  1XJ4 A;  4HJ6 A;  3H9W A;  3C8C A;  3B33 A;  5F6A A;  1OTA A;  1D7E A;  1N9O A;  1XJ2 A;  1OT9 A;  4BBT A;  4HQA A;  2YPA A;  1OT6 A;  2V0U A;  4WL9 A;  2KDK A;  2WKQ A;  2OOL A;  2QJ7 A;  3MR0 A;  2PHY A;  1DP9 A;  1DP8 A;  4F3L A;  4H6J B;  1T19 A;  1XJ3 A;  1S1Z A;  1S4S A;  2PYR A;  2QL2 A;  2JN7 A;  4R3A A;  1NKP A;  5J7E A;  2K7S A;  1BYW A;  1T1B A;  5J4E A;  1OTI A;  2H28 A;  2PD7 A;  4EET B;  3UB9 A;  5G4Y A;  3G6O A;  1VB6 A;  1WA9 A;  5F69 A;  2WKR A;  2GJ3 A;  4I3I A;  4LRX C;  1LSV A;  2YKF A; 
#chains in the Genus database with same CATH topology
 5EVI A;  3E4O A;  4QB8 A;  5CRF A;  3HBR A;  2QHK A;  2V20 A;  1CEF A;  1YLJ A;  3NIA A;  4KUK A;  3W4P A;  2O0Y A;  3MJQ A;  2G2U A;  3NDE A;  4PHT A;  5HWV A;  1YAX A;  3KSF A;  4CLC A;  3VSL A;  1XFN A;  5L09 A;  4RVA A;  4C6Y A;  5EUA A;  1H8M A;  1S66 L;  1NZO A;  1MWS A;  1SKO B;  3BFF A;  3FPW A;  4EBN A;  4H6J A;  1PWD A;  3PBT A;  5M18 A;  2ZOH A;  2VV6 A;  5HD3 A;  1ZC2 A;  2CMN A;  5G18 A;  5AQA A;  1I2W A;  3EEH A;  3N6I A;  4EEU A;  3NOT C;  3M6H A;  2XDM A;  2MJ6 A;  1VQQ A;  2WZX A;  3QP2 A;  3F1P B;  5F1G A;  4Z9Q A;  3MQO A;  5FI7 A;  5KSC A;  3ZG8 B;  2OV5 A;  4UA7 A;  3D72 A;  4NXG A;  3BEC A;  3IXH A;  4GNU A;  2ZM2 A;  1MY8 A;  3RXW A;  5FQM A;  4WEK A;  3VP3 A;  2W3F A;  3M6B A;  4KQO A;  3A3J A;  4ZDX A;  3MKF A;  3IT9 A;  3LGO A;  2OAP 1;  4U0T A;  4P6B A;  3RH8 B;  1PWC A;  3DTM A;  4CLC D;  5EM1 A;  4II7 A;  3T4K A;  1IFQ A;  3GMW A;  4EBL A;  4GN2 A;  1T1C A;  5G4Z A;  5GHZ A;  2OLV A;  2PT7 A;  1XGJ A;  5DKK A;  2EWV A;  2B02 A;  2V0W A;  1G6O A;  2R78 A;  1W8Y A;  3E98 A;  1V9Y A;  1MC0 A;  2IWD A;  5EVL A;  5CEC A;  4O01 A;  3ZHH A;  3BFC A;  4B93 A;  4EES A;  4R6L A;  4DE0 A;  3V50 A;  3QP1 A;  4G3K A;  4F94 A;  5FQK A;  4NXB A;  3G35 A;  4X68 A;  4BJP A;  2CC1 A;  2VGK A;  4HH3 A;  1FR6 A;  1PZP A;  3CUE A;  3F1N A;  3VE3 A;  1BLH A;  1JTG A;  3FKV A;  2Z2M B;  2IA2 A;  2Y2J A;  4BL3 A;  3AGF A;  1OTD A;  1I2S A;  2ZQ9 A;  3UB5 P;  1VET B;  4L9E A;  2ZQA A;  2WGI A;  4YWZ A;  3UPO A;  4UHU A;  3N8L A;  5DTK A;  1W8Q A;  5TBM A;  2LFH A;  4Y13 A;  5HL1 A;  3BLS A;  1AXB A;  1KDS A;  3NY4 A;  3DBA A;  4H10 A;  3SS5 A;  4O8G A;  2VV8 A;  2OAQ 1;  4CJN A;  2V2F F;  5TFQ A;  3LIA A;  2LB9 A;  2V8C A;  3PBR A;  4GZB A;  4IBR A;  3HLG A;  2ZL1 B;  4EXO A;  4LV0 A;  5CGS A;  4L9F A;  4RX2 A;  5EOE A;  5EFW A;  4EEP A;  4EER A;  4PM9 A;  2XQZ A;  2Y2L A;  2PR5 A;  3ZYT A;  3Q82 A;  3P7N A;  3Q1F A;  3TE8 A;  1DJC A;  3T4O A;  2BG1 A;  3L7H A;  2HDQ A;  3H7W A;  3LEQ A;  4KZ8 A;  1JNU A;  1K57 C;  5GL9 A;  4WEJ A;  2Q0O A;  4KQQ A;  3F1O A;  4UEY A;  4DE3 A;  4NET A;  4R3B A;  1YM1 A;  5HSQ A;  4NXE A;  3Q07 A;  5L2F A;  5IU1 A;  1F98 A;  1ZKJ A;  4A5R A;  3IBJ A;  3B47 A;  1KVL A;  1L0D A;  4PM6 A;  1JWV A;  1N4O A;  2A49 A;  4IUK A;  1XGI A;  3OPH A;  3VP2 A;  4S2O A;  2PYP A;  2JKF A;  1ERM A;  4HES A;  5CHM A;  1ALQ A;  3GV9 A;  4UA9 A;  3RJU A;  3MUJ A;  4JGO A;  3NOP C;  3DTK A;  1MKM A;  2ZC3 B;  5U47 A;  3EGD C;  1PI5 A;  5HPF A;  5C5K A;  4EQI A;  5L10 A;  2H10 A;  5M1A A;  3VFF A;  3T1X A;  3F1O B;  5L8M A;  5EE8 A;  3AGE A;  1H5X A;  5CHU A;  3G32 A;  3E2K A;  3E0Y A;  3KYZ A;  3LY4 A;  3V5M A;  4E3I A;  1YLY A;  1Z09 A;  2XR0 A;  1CQA A;  3MXS A;  3IF6 A;  4WMC D;  3IH9 A;  3IH8 A;  2QMI A;  3LIE A;  1NKP B;  4PM5 A;  4UA6 A;  2Y79 A;  2PU2 A;  1HVB A;  3FWL A;  1T18 A;  1LHY A;  3T1Q B;  5HDC A;  2FFF B;  1J3W A;  1K4F A;  2P9V A;  3V3S A;  3WRT A;  1S1Y A;  4QY6 A;  5I50 A;  3IS2 A;  5IT5 A;  5FEG A;  3BEB A;  2HV1 A;  4WLA A;  4ME4 A;  1NRJ A;  5HFO A;  1XJ4 A;  3O3V A;  1WE4 A;  3B33 A;  1D7E A;  3HCY A;  4G3W A;  4XUX A;  4Q8I A;  3C7V A;  4ZJ2 A;  1XJ2 A;  2EX9 A;  3ZNT A;  4DMZ A;  1OT9 A;  1M6K A;  1OT6 A;  2V0U A;  3DTE A;  3Q7Z A;  4E3O A;  1L3L A;  3CI6 A;  3GTC A;  5CED A;  1T19 A;  5FSR A;  2ZQ7 A;  1S1Z A;  5HAP A;  3R7W A;  2QL2 A;  2JN7 A;  3EQU A;  3R4K A;  2WGW B;  5J7E A;  2PU4 A;  4BD1 A;  2K7S A;  1BYW A;  4IBX A;  5DF8 A;  3UO9 A;  4EET B;  2W3H A;  1TDG A;  4IUH A;  3ITB A;  4E3M A;  4ZAM A;  3V39 A;  2EWW A;  4UQI M;  1K55 A;  3EEA A;  2IWC A;  1LSV A;  3TG9 A;  1E4D A;  4BQM A;  4KZ5 A;  5E2H A;  4E3N A;  1YLW A;  3BM6 A;  4E3J A;  4KZB A;  2LB5 A;  4FH4 A;  3NEC A;  4HY8 A;  1LL9 A;  1KVM A;  3GDI A;  4R4R A;  4P0M A;  4QY5 A;  4I3A A;  3UDF A;  1LSW A;  1LL5 A;  2ZBB A;  1ERQ A;  3LR4 A;  4LRY C;  3BWL A;  1FOF A;  1DP6 A;  5I5L A;  2XFS A;  1GA9 A;  2HJE A;  2ACG A;  4GJ4 A;  1ERO A;  3UE6 A;  1YMX A;  3WRZ A;  1VHM A;  3G2Y A;  3W8K A;  3VP1 A;  1K38 A;  1N9L A;  2WGV A;  4MBK A;  3LID A;  1Y54 A;  2PD8 A;  1NZU A;  4ARZ B;  3HLC A;  1ZG6 A;  4GS9 B;  4WBG A;  3PBN A;  4R0Q A;  3ZG9 B;  1PNE A;  5I4Z A;  1PW8 A;  1HLU P;  4EUV A;  5EVI C;  1ESU A;  5E2F A;  1HZO A;  2X01 A;  1Y28 A;  1P9R A;  2Y4A A;  1TVF A;  1N9N A;  2VK3 A;  4OP8 A;  1NY0 A;  2Y2H A;  3LO7 A;  1ES4 A;  2XRO A;  2Y2N A;  4IED A;  4CLC C;  2E8I A;  1CF0 A;  4BMW A;  2BTF P;  5DTS A;  2RCX A;  4FUW A;  1A0A A;  1P97 A;  3WS4 A;  3PTE A;  2VGL M;  5EYO A;  4JXV A;  2PBY A;  5CTN A;  1GCE A;  4JGP A;  1OJ5 A;  2V9A A;  4FH2 A;  1SKO A;  1L0F A;  4YOF A;  5FQI A;  4R3J A;  5AQ9 A;  3A3D A;  1YPR A;  4PKY A;  4LCL A;  3GVB A;  4NK3 A;  4Y3I A;  2DRW A;  2W27 A;  5HPI A;  3UN7 A;  3HJK A;  3G4P A;  1K6R A;  5A8B A;  3ITA A;  4LPZ A;  1Z6F A;  2J9O A;  3S4X A;  4HOI A;  1OME A;  5HAQ A;  4HJ4 A;  4KG5 A;  1O7E A;  3F1P A;  3T50 A;  1KGE A;  3LYX A;  4X69 A;  1GSV A;  2WYX A;  5AJG A;  1VEU B;  1RP5 A;  2HDU A;  2GZA A;  2WAD A;  4MLL A;  4LGW A;  4ZJ1 A;  4R70 A;  4FTX A;  2JE5 A;  4Q0H A;  5DJT A;  3JPU A;  3U2A A;  3N7W A;  1JVJ A;  1TF1 A;  4B9O A;  4N1X A;  2H0Y A;  1KE3 A;  3IWO A;  4HHD A;  2UWX A;  4HEF A;  1IKI A;  3ZNY A;  4BEN A;  3LI8 A;  3GSG A;  5A93 A;  4QWO A;  3O5Y A;  4E04 A;  4Y0U A;  4JKT A;  4JBF A;  4QU3 A;  4OLD A;  3O87 A;  3KX0 X;  3UPP A;  3FKW A;  1RGY A;  3VOY A;  1K0K A;  3UPN A;  2VA0 A;  5FEF A;  1NLW B;  1TS6 A;  2HDS A;  5FL3 A;  4BL2 A;  5CGW A;  1X0O A;  1G28 A;  3HJI A;  2EXA A;  4MBH A;  5EOO A;  4IJG A;  2Y59 A;  3PBS A;  4DXB A;  4DDS A;  3OCL A;  4WF0 A;  2V1B A;  4OOM A;  5CXW A;  5E2G A;  2VGL S;  4HBU A;  1EW0 A;  3CUE C;  4KZ7 A;  4B4X A;  1TEM A;  3KSI A;  1SZV A;  4PM8 A;  4XXR A;  1QMF A;  4QD4 A;  1K56 D;  1XX2 A;  3QP6 A;  3MQ0 A;  3C4O A;  1PFL A;  2R9X A;  1Q2P A;  2O99 A;  1TS0 A;  2EA9 A;  1N9B A;  2QKP A;  3IHB A;  1VET A;  3A3F A;  3KSG A;  4OOY A;  4DXC A;  1ODV A;  4XUZ A;  3NDG A;  2VJW A;  2XA7 S;  2Y91 A;  5DF9 A;  4MN5 A;  4JXG A;  4BD0 A;  4E6X A;  1H8Z A;  3PYP A;  1YT4 A;  1SCW A;  1EI5 A;  4WUJ A;  1CK3 A;  3Q81 A;  4Y7P A;  4UAA A;  5I94 A;  4LV1 A;  2ZM0 A;  2HPB A;  2XK1 A;  2XD5 A;  3HUM A;  4OPZ A;  4P85 A;  1W79 A;  2ZL1 A;  2VKS A;  1JTD A;  4NG2 A;  5TGF A;  1UWP X;  3QHY A;  4ATH A;  4JGR A;  1FQG A;  4S2N A;  5HZH A;  3SOI A;  2HZ5 A;  3LI9 A;  1G68 A;  3SH9 A;  4X1M A;  4KQR A;  4R38 A;  2YPA B;  4PAU A;  1OJG A;  3K3D A;  2EX6 A;  2O9A A;  3WWX A;  2QWS A;  2L0W A;  3NJA A;  2Y2M A;  1KOU A;  3CMZ A;  4KZ4 A;  3ZCZ A;  4MN6 A;  5FDS A;  5LBR A;  5EEC A;  4OH0 A;  2C5W B;  3CJM A;  3UMD A;  1TS8 A;  3PHY A;  1W7F A;  4Z1W A;  5CX7 A;  3CPT B;  4DE2 A;  2ZQ8 A;  3KYQ A;  2ZMV A;  5F5Y A;  3DTI A;  2IWB A;  3UME A;  5TJJ A;  4OPQ A;  5AVE A;  5FAT A;  3LCE A;  1IYQ A;  3OPR A;  4S2L A;  3EOI A;  3BFG A;  3UB7 A;  2DMW A;  3EQV A;  4GDB A;  4JXS A;  2WUQ A;  3HLB A;  1LSX A;  4OLG A;  3TW8 A;  4I5S A;  3HLE A;  1G6A A;  5F6A A;  1OTA A;  3MFD A;  4KZ3 A;  2P74 A;  5GHY A;  1VM1 A;  4OKP A;  2J8Y A;  4WL9 A;  4WMC A;  1NXY A;  3LFV A;  4IVK A;  4Y5F A;  4U0X A;  5J8X A;  2PHY A;  1DP8 A;  3C7U A;  3MS6 A;  4LEN A;  3WS5 A;  4EWF A;  1TD5 A;  2HP5 A;  1Y4O A;  3PXP A;  2XD1 A;  4OOL A;  1XJ3 A;  1S4S A;  3LR3 A;  3HLW A;  3IF6 C;  2XF3 A;  3UNW A;  3VP4 A;  4N9L A;  3S7N A;  2I72 A;  5CGX A;  4MDZ A;  4GD8 A;  1NKP A;  5BOH A;  1RGZ A;  4GKU A;  5DF7 A;  1T1B A;  5J4E A;  2H28 A;  1K1F A;  5MC7 A;  1MWT A;  3FZC A;  1KGF A;  1VB6 A;  1WA9 A;  2W1T B;  2ZLY A;  4BWI A;  4X53 A;  3S7P A;  5F69 A;  2WKR A;  2GJ3 A;  3D4F A;  2ZMF A;  1STZ A;  3DAV A;  4YFM A;  4RA7 A;  5FAP A;  3FC7 A;  2WAE A;  5FA7 A;  2JCH A;  1W63 Q;  2O9B A;  4PKY G;  1GA0 A;  3NOU C;  3SH7 A;  1KE4 A;  1W63 M;  3O86 A;  3DW0 A;  3KYE A;  1DRM A;  4DF6 A;  3LEZ A;  1FSW A;  3N8S A;  3BY9 A;  4KUO A;  2HJ9 C;  3OBF A;  3ICY A;  1NWZ A;  1OTE A;  3ULF A;  1I5Q A;  2VLG A;  1IYS A;  3BW6 A;  3N8R A;  3NHQ A;  3T1R A;  4HIA A;  3IWI A;  1K54 A;  1K25 A;  3IXG A;  4GD6 A;  1BUE A;  4NXF A;  4M3K A;  5F83 A;  1ACF A;  4BBU A;  2WGW A;  2ZC4 B;  3RTY A;  1LI9 A;  2EFX A;  2PDR A;  3NI9 A;  2VV7 A;  2MH3 A;  5HD5 A;  1K55 C;  4I39 A;  2V8F A;  3KSH A;  2JC7 A;  2XH9 A;  3TSG A;  3RFB A;  3MXQ A;  4GB7 A;  3LIB A;  3NUL A;  1PIO A;  3MSH A;  4WZ5 A;  4HBT A;  4WYY A;  3W2Z A;  5HL6 A;  1NYY A;  3U4L P;  4X6T A;  4D2O A;  5FAS A;  1TS7 A;  2ZC6 B;  3T4L A;  1DY6 A;  2PR6 A;  1S4R A;  3ZVT A;  3W4O A;  2HP6 A;  4EW7 A;  2XFT A;  3H82 B;  1H8Y A;  4GDN A;  1BZA A;  1MPL A;  2PAV P;  2G2W A;  2Z2L B;  3JYI A;  2WK0 A;  1ZG4 A;  2JBF A;  3UB8 A;  5KMW A;  5GLD A;  4Q0J A;  2J7V A;  3IX3 A;  4HH2 A;  5KSH A;  1E25 A;  2M1C A;  4HP4 A;  1MDY B;  4ARZ A;  4OQG A;  1BLC A;  4GS9 A;  4KQD A;  2WZZ A;  3UDI A;  2A2L A;  2Z6D A;  4CPK A;  5HX9 A;  3OC2 A;  3G31 A;  1BTL A;  1SHV A;  4NEE D;  2K2N A;  1LLB A;  4OPY A;  3TOI A;  1U60 A;  3Q7V B;  4EUZ A;  4GOG A;  4XT2 B;  1HLO A;  2Q9N A;  3HLD A;  3HL9 A;  4HJ3 A;  1ONG A;  3MZF A;  2Y2K A;  2ZC5 B;  1E3U A;  1KE0 A;  2Y2O A;  3S7O A;  3VFH A;  2BAS A;  3MQQ A;  5KIZ A;  4ZRR A;  3VP0 A;  4YIN A;  3BQA A;  2JKR I;  3UB6 A;  3MBZ A;  1UWN X;  4B88 A;  3LUQ A;  1AN2 A;  5FQJ A;  3OCN A;  4ETX A;  3M2K A;  4LV3 A;  2HP9 A;  4MMN A;  2G7U A;  1NJ4 A;  1IKG A;  4H8R A;  3I7J A;  3V67 A;  2INW A;  4E3L A;  4AFI A;  3PAG A;  1D1J A;  4DN0 A;  2YPB B;  2L1M A;  3BQ8 A;  4E6W A;  1VEU A;  2C6W B;  1AM9 A;  2KOI A;  1IYO A;  2ZQD A;  3PBO A;  2VGJ A;  3BLM A;  4GHI B;  4ZTK A;  4C75 A;  4RYE A;  2JKT I;  1R05 A;  2JKG A;  5J3W A;  1IYP A;  2WKI A;  5EM0 A;  1ES5 A;  5IHV A;  2PRF A;  1T1A A;  2WKH A;  4IVI A;  3C5A A;  2A24 B;  2VX8 A;  1H3Q A;  1Q2Q A;  3UE3 A;  1DJB A;  4KZ6 A;  3S7Q A;  1XJ6 A;  5EPH A;  4Y0T A;  1EWZ A;  1MBL A;  3QNB A;  1ZHH B;  1E3U D;  3K3C A;  1BLP A;  2XLN A;  1YLP A;  4UQI S;  1NLW A;  2OWJ A;  2L4R A;  3JVU A;  4QJG A;  3U5V A;  4C3Q A;  3IWQ A;  1L2S A;  4KZA A;  4CQH A;  1GSX A;  2NUP C;  2J9P A;  4S2J A;  1KDW A;  2WKP A;  1D06 A;  1K56 A;  3K2N A;  3UY6 A;  3SW1 A;  1YSP A;  2B95 A;  5E43 A;  1MWU A;  2Y2I A;  1P0Z A;  5AVF A;  4DJ3 A;  2E8J A;  1P9W A;  1CI8 A;  1YSQ A;  2ZOI A;  3CLO A;  3C30 A;  4JF5 A;  4OVD A;  4F3L B;  1CI9 A;  2DNS A;  2FH5 A;  4L9G A;  4KG2 A;  1ZTU A;  1F9I A;  4GCZ A;  4WEL A;  4KG6 A;  3HUO A;  3UE1 A;  1L0E A;  5GHX A;  5HDS A;  1PYY A;  2ZC7 A;  3OOV A;  2J3T D;  4FCF A;  2W3D A;  3W4Q A;  2X02 A;  4ATK A;  4LCM A;  1OTB A;  4OQ0 A;  5FI6 A;  2QPN A;  2XEP A;  2YKH A;  5DFY A;  3DWZ A;  5EV0 A;  2RL3 A;  4S2K A;  5HDD A;  5EVI B;  3IHA A;  2VZW A;  4K0X A;  4RX3 A;  3ZGA B;  4S2N C;  5CHJ A;  4PPR A;  3C8C A;  3NBL A;  1BUL A;  1N9O A;  4WM9 A;  4CLC B;  4BBT A;  4P6Z M;  4HQA A;  2YPA A;  2KDK A;  4Y0O A;  2WKQ A;  3T4S A;  2QJ7 A;  5EVI D;  1A0K A;  3P09 A;  3QP8 A;  3AGD A;  4H6J B;  1LI0 A;  5FI2 A;  4DDY A;  2JKR M;  1QME A;  2PYR A;  5DTT A;  1FIK A;  3MZE A;  3L9K A;  2EXB A;  3S22 A;  3CPT A;  1OTI A;  5E2E A;  2HGV A;  4S2I A;  2PD7 A;  3OPL A;  1NRF A;  3TRC A;  4R1G A;  4U3T A;  1J9M A;  5G4Y A;  2XRN A;  4LRX C;  5JYO A;  3PR6 A;  2X71 A;  4WN5 A;  5AQ7 A;  1PWG A;  3T4Q A;  1LT0 A;  2ZM8 A;  1BLS A;  4X25 A;  2JKT M;  2PBD P;  3TJZ C;  3O88 A;  5HAR A;  1XFQ A;  1ZZA A;  3CHW P;  3QP4 A;  3E4Q A;  3LIF A;  5HWT A;  5F68 A;  1GHI A;  3A0R A;  2GDN A;  3FPV A;  1CJF A;  1UGU A;  1IOU A;  5M19 A;  3BRM A;  1OPX A;  2JHE A;  4NKP A;  2VEA A;  3ZDJ A;  4OQH A;  3E2L A;  3BFD A;  3IF5 A;  2DCF A;  4X56 A;  1XP4 A;  3S1Y A;  1RCJ A;  5K5B A;  1TDL A;  1ONH A;  1ES3 A;  1JWP A;  2W1T A;  3C38 A;  5FQ9 A;  2M7U A;  1XXM A;  1C3B A;  3HUN A;  3D3O A;  4MNR A;  4FOF A;  4KZ9 A;  2B18 A;  3BYD A;  4QPR A;  3JVV A;  1FCN A;  4P6Z S;  4K08 A;  1IEL A;  2XSS A;  4JGQ A;  2HDR A;  3T4T A;  1L0G A;  2M7V A;  4Y2F A;  2OSU A;  3A3E A;  3MMH A;  3VE4 A;  4RQ9 A;  3F1N B;  1K54 C;  3HLF A;  5DKL A;  3MFX A;  5GLA A;  3BFE A;  1NYM A;  3LR5 A;  2Z6C A;  1BT5 A;  4ID4 A;  3IBR A;  4MCW A;  3GQZ A;  4O0P A;  3VOZ A;  4G3V A;  2Y2Q A;  2Y2P A;  1UKL C;  1K6S A;  2GNX A;  3IQA A;  5TBM B;  1MXO A;  1S6R A;  2ZJ9 A;  3PAE A;  4ETZ A;  4Y17 A;  4Y15 A;  2H0T A;  3N4I A;  3M2J A;  1MWR A;  3FG8 A;  3SH8 A;  2FFY A;  4EBP A;  4H10 B;  1FSY A;  2KX6 A;  5TR7 A;  4MEZ A;  4OON A;  4JF4 A;  1H0M A;  2WKE A;  5DVA A;  3E4P A;  5DJU A;  1PW1 A;  2QZ6 A;  1W5D A;  5GLB A;  5EVE A;  4WZ5 C;  1PI4 A;  4EU0 A;  2W3G A;  3GEC A;  2W0N A;  1FR1 A;  4OQI A;  4OPR A;  4HP9 A;  4LV2 A;  3WS1 A;  5CEB A;  2NUT C;  4JF6 A;  1BSG A;  4ZBE A;  1F5M A;  1F2K A;  1K4E A;  4N1H A;  2EX2 A;  2V1Z A;  3P98 A;  5FDH A;  3H7W B;  3HRE A;  3GRJ A;  4YNR A;  3H82 A;  3IX8 A;  3ISG A;  1K57 A;  3G30 A;  1DJA A;  4BBV A;  2Y2G A;  2I9V A;  2R9W A;  4GLQ A;  2GX5 A;  1AN4 A;  5CER A;  3SS3 A;  4FD8 A;  1MDY A;  1GHM A;  5AQB A;  3QP5 A;  4X55 A;  1XKZ A;  3CWF A;  4BLM A;  3BY8 A;  3NC8 A;  3IXD A;  3RXX A;  3HVF A;  3G2Z A;  1GSW A;  4DKI A;  4I38 A;  2XGN A;  2K31 A;  5FAO A;  3G34 A;  1V9Z A;  5FQQ A;  5HW3 A;  2ZQC A;  4DJ2 A;  3LIC A;  2HF6 A;  1G5U A;  2ZMA A;  3P01 A;  4MN7 A;  1ESI A;  2J80 A;  3GR2 A;  5DFX A;  3Q7V A;  5HAI A;  4XT2 A;  4ATI A;  5JYP A;  1JWZ A;  3VOL A;  3EWK A;  1XA1 A;  3VMA A;  3T4J A;  5HWW A;  4EV4 A;  3IX4 A;  3B3X A;  5GLC A;  4JPM A;  2D01 A;  3FV7 A;  2J3W A;  3LY3 A;  5FAQ A;  3WS0 A;  3EGX C;  4QHC A;  3A0V A;  1WYC A;  1SKF A;  4R4S A;  1NLY A;  4HNB A;  2V1A A;  3IF6 B;  2B5R A;  3SS4 A;  4N92 A;  2P7J A;  4JXW A;  5F1F A;  1XA7 A;  3A3I A;  4WZ4 A;  4K91 A;  4X1L A;  2P04 A;  3KO6 A;  2YPB A;  4LRZ E;  1YMS A;  4DE1 A;  4M4X A;  2P9V B;  1MZU A;  1S67 L;  2W3E A;  4O7D A;  2UV0 E;  1YLT A;  3OLO A;  4GHI A;  3IS2 B;  3CIT A;  1WYB A;  4D60 A;  2AVX A;  3DWK A;  3NCK A;  4JLF A;  3VV4 A;  1FCO A;  3IXB A;  2W1R A;  3CAX A;  2FZ0 A;  1YKD A;  4P87 A;  3LR0 A;  4ESP A;  5A92 A;  4OP5 A;  3CG5 A;  4L0L A;  5IS1 A;  3C2W A;  2A24 A;  5A91 A;  3UE0 A;  4EQ1 A;  1ES2 A;  4LFU A;  3MF0 A;  3T12 B;  2ZD8 A;  1S0W A;  2D02 A;  2J3T C;  1FIL A;  3PBQ A;  3ZQ5 A;  4AYA A;  3R7W B;  4S2P A;  4LLO B;  2QL2 B;  4HI4 A;  5L07 A;  4K0W A;  3MXR A;  3B42 A;  1LL8 A;  2OWH A;  4PM7 A;  1IEM A;  1XPB A;  2EFU A;  4Q0I A;  1KGG A;  2P08 A;  3T1S A;  2KLI A;  3UDX A;  2QJ5 A;  3ZVW A;  1O07 A;  4GW9 A;  2Y55 A;  1M40 A;  4I3J A;  4S2M A;  3WS2 A;  1CEG A;  4B4Z A;  1NLZ A;  2QYB A;  5F82 A;  4FSF A;  3A0S A;  4R23 A;  3ZG5 A;  4DRT A;  3ZFZ A;  5A90 A;  4HJ6 A;  3H9W A;  3C4P A;  1PZO A;  3ZG0 A;  1SDN A;  2H5S A;  3OZH A;  4ZJ3 A;  3D9Y A;  1YQS A;  3FYZ A;  3QNC A;  4KEN B;  2A3U A;  2OOL A;  2OLU A;  1GHP A;  4E3K A;  3MR0 A;  1DP9 A;  4CLC E;  3CZD A;  1YLZ A;  1MKI A;  4F3L A;  1FCM A;  3VSK A;  2Q9M A;  3ZG7 B;  1AWI A;  2WAF A;  4MBF A;  2EX8 A;  2Y8H A;  4R3A A;  3OPP A;  1HD8 A;  5D3O A;  4PMA A;  4IHQ A;  5KZH A;  2O9C A;  2XA7 M;  3V3R A;  3UB9 A;  1SDE A;  1HTZ A;  5CTM A;  3SZT A;  3G6O A;  3MZD A;  1PRQ A;  4I3I A;  4N9K A;  2BLS A;  3BJN A;  3MKE A;  2YKF A; 
#chains in the Genus database with same CATH homology
 4WN5 A;  3E4O A;  3FC7 A;  2QHK A;  2LB5 A;  3T4Q A;  1W63 Q;  2O9B A;  4KUK A;  1LT0 A;  4PKY G;  2O0Y A;  3MJQ A;  3NOU C;  4HY8 A;  3GDI A;  4PHT A;  2JKT M;  1W63 M;  5HWV A;  1YAX A;  3TJZ C;  3KSF A;  1DRM A;  4CLC A;  4I3A A;  1XFN A;  3BY9 A;  4KUO A;  2HJ9 C;  3OBF A;  3ICY A;  1NWZ A;  1LSW A;  1OTE A;  1XFQ A;  2ZBB A;  3LR4 A;  3ULF A;  3E4Q A;  3LIF A;  5HWT A;  2VLG A;  5F68 A;  3A0R A;  4LRY C;  3BW6 A;  3BWL A;  1H8M A;  3NHQ A;  1S66 L;  3FPV A;  1DP6 A;  1UGU A;  1IOU A;  4HIA A;  5I5L A;  3FPW A;  4H6J A;  2HJE A;  4GJ4 A;  3PBT A;  3UE6 A;  1OPX A;  1VHM A;  2JHE A;  2ZOH A;  2VV6 A;  4NXF A;  4NKP A;  2VEA A;  5HD3 A;  2CMN A;  4BBU A;  3RTY A;  1N9L A;  3EEH A;  3LID A;  4EEU A;  3NOT C;  2PD8 A;  2PDR A;  2VV7 A;  2MH3 A;  5HD5 A;  4ARZ B;  5K5B A;  2MJ6 A;  4I39 A;  4GS9 B;  3KSH A;  3PBN A;  2W1T A;  3F1P B;  5I4Z A;  3RFB A;  3C38 A;  3MXQ A;  4EUV A;  3MQO A;  2M7U A;  3LIB A;  1Y28 A;  1P9R A;  3D72 A;  4NXG A;  1N9N A;  3D3O A;  3W2Z A;  2XRO A;  5HL6 A;  4FOF A;  4CLC C;  2B18 A;  4QPR A;  3JVV A;  4BMW A;  4P6Z S;  4K08 A;  1A0A A;  1TS7 A;  2XSS A;  4JGQ A;  3T4L A;  1P97 A;  3T4T A;  2PR6 A;  2M7V A;  2VGL M;  1S4R A;  4WEK A;  5EYO A;  4Y2F A;  2W3F A;  3MMH A;  4KQO A;  3VE4 A;  4RQ9 A;  3F1N B;  4JGP A;  1OJ5 A;  2V9A A;  5DKL A;  4EW7 A;  3MFX A;  3H82 B;  4YOF A;  2OAP 1;  3RH8 B;  3LR5 A;  2Z6C A;  3IBR A;  4CLC D;  4MCW A;  4O0P A;  4II7 A;  3T4K A;  1IFQ A;  4PKY A;  4G3V A;  4Y3I A;  2W27 A;  5HPI A;  3HJK A;  1T1C A;  5G4Z A;  1UKL C;  2PT7 A;  5DKK A;  3UB8 A;  2GNX A;  5TBM B;  4Q0J A;  2EWV A;  4ETZ A;  5A8B A;  2B02 A;  2V0W A;  4HH2 A;  5KSH A;  1G6O A;  4LPZ A;  3FG8 A;  2R78 A;  2M1C A;  3E98 A;  4HP4 A;  1MDY B;  4ARZ A;  4H10 B;  2KX6 A;  4HOI A;  1V9Y A;  4HJ4 A;  1MC0 A;  4GS9 A;  3F1P A;  3T50 A;  4KQD A;  3E4P A;  5DJU A;  4O01 A;  3LYX A;  1GSV A;  2A2L A;  2Z6D A;  4EU0 A;  2W3G A;  3GEC A;  2W0N A;  5AJG A;  4B93 A;  4EES A;  3OC2 A;  4R6L A;  2GZA A;  4NEE D;  2K2N A;  4HP9 A;  4G3K A;  2NUT C;  4NXB A;  4R70 A;  1F5M A;  4Q0H A;  5DJT A;  4XT2 B;  1HLO A;  3U2A A;  4BJP A;  4HH3 A;  1TF1 A;  4HJ3 A;  4B9O A;  4HHD A;  3CUE A;  3F1N A;  3H7W B;  3VE3 A;  2IA2 A;  4YNR A;  3H82 A;  3S7O A;  2BAS A;  1OTD A;  3LI8 A;  3MQQ A;  5KIZ A;  4ZRR A;  4L9E A;  3O5Y A;  4YWZ A;  4E04 A;  3BQA A;  2JKR I;  4BBV A;  2I9V A;  3UB6 A;  4GLQ A;  2GX5 A;  1UWN X;  3LUQ A;  5TBM A;  2LFH A;  1AN2 A;  1AN4 A;  3OCN A;  3KX0 X;  4ETX A;  1MDY A;  3DBA A;  4H10 A;  4MMN A;  4O8G A;  2VA0 A;  2VV8 A;  2G7U A;  1TS6 A;  1NLW B;  2OAQ 1;  5FL3 A;  3CWF A;  1X0O A;  3BY8 A;  3V67 A;  2INW A;  1G28 A;  4AFI A;  3LIA A;  4DN0 A;  2YPB B;  2LB9 A;  3PBR A;  2L1M A;  3BQ8 A;  3HJI A;  1GSW A;  4I38 A;  4IJG A;  1AM9 A;  2KOI A;  4EXO A;  3PBS A;  2K31 A;  3PBO A;  1V9Z A;  3OCL A;  4L9F A;  4DJ2 A;  3LIC A;  5EFW A;  4GHI B;  4WF0 A;  2HF6 A;  4EEP A;  2V1B A;  4EER A;  4OOM A;  2PR5 A;  3ZYT A;  3P01 A;  4MN7 A;  2J80 A;  2JKT I;  5DFX A;  2VGL S;  4ATI A;  4XT2 A;  1R05 A;  1EW0 A;  3P7N A;  3TE8 A;  3VOL A;  5J3W A;  3CUE C;  3T4O A;  3KSI A;  3EWK A;  3T4J A;  1T1A A;  3H7W A;  5HWW A;  2A24 B;  3MQ0 A;  1JNU A;  2O99 A;  1TS0 A;  2VX8 A;  2EA9 A;  1H3Q A;  4WEJ A;  3UE3 A;  2QKP A;  2D01 A;  3F1O A;  3KSG A;  4UEY A;  1ODV A;  3S7Q A;  1XJ6 A;  2J3W A;  1ZHH B;  2VJW A;  3EGX C;  3A0V A;  2XA7 S;  5DF9 A;  5HSQ A;  4MN5 A;  3K3C A;  4NXE A;  1NLY A;  4HNB A;  2V1A A;  5IU1 A;  4UQI S;  1F98 A;  3PYP A;  1NLW A;  3IBJ A;  2OWJ A;  2P7J A;  2L4R A;  3JVU A;  4WUJ A;  3U5V A;  3B47 A;  4CQH A;  2P04 A;  3KO6 A;  2YPB A;  1GSX A;  4IUK A;  4LRZ E;  2NUP C;  4M4X A;  2PYP A;  1MZU A;  2WKP A;  1D06 A;  1S67 L;  2W3E A;  3OLO A;  4GHI A;  3IS2 B;  3CIT A;  3K2N A;  3MUJ A;  4JGO A;  2VKS A;  3NOP C;  3SW1 A;  3VV4 A;  1MKM A;  1UWP X;  4ATH A;  1YSP A;  4JGR A;  3EGD C;  2W1R A;  3CAX A;  5HPF A;  5C5K A;  2FZ0 A;  1YKD A;  5HZH A;  3LI9 A;  3LR0 A;  4R38 A;  2YPA B;  1P0Z A;  4L0L A;  5AVF A;  5IS1 A;  3C2W A;  4DJ3 A;  2A24 A;  4PAU A;  4EQ1 A;  1P9W A;  3F1O B;  1OJG A;  5L8M A;  3MF0 A;  1YSQ A;  3K3D A;  2ZOI A;  3CLO A;  2O9A A;  3C30 A;  3KYZ A;  3E0Y A;  2QWS A;  2D02 A;  2L0W A;  3NJA A;  1KOU A;  2J3T C;  4F3L B;  2FH5 A;  3PBQ A;  4MN6 A;  3ZQ5 A;  4AYA A;  4L9G A;  5LBR A;  3R7W B;  1ZTU A;  1F9I A;  4LLO B;  2QL2 B;  4GCZ A;  4HI4 A;  3UMD A;  1TS8 A;  3LIE A;  4WEL A;  3PHY A;  4Z1W A;  1NKP B;  3B42 A;  1LL8 A;  2Y79 A;  5CX7 A;  2OWH A;  4Q0I A;  1T18 A;  2P08 A;  5HDS A;  3KYQ A;  2KLI A;  2ZMV A;  5F5Y A;  3OOV A;  2QJ5 A;  2J3T D;  5HDC A;  2W3D A;  4GW9 A;  3UME A;  5TJJ A;  4I3J A;  4ATK A;  1OTB A;  5AVE A;  1S1Y A;  1NLZ A;  2YKH A;  5DFY A;  2QYB A;  3EOI A;  5I50 A;  3UB7 A;  4FSF A;  2DMW A;  3IS2 A;  5HDD A;  5IT5 A;  3EQV A;  3A0S A;  2VZW A;  2HV1 A;  4WLA A;  1LSX A;  4ME4 A;  1NRJ A;  3TW8 A;  4I5S A;  1XJ4 A;  4HJ6 A;  3H9W A;  3C8C A;  3B33 A;  5F6A A;  1OTA A;  1D7E A;  1N9O A;  3HCY A;  4G3W A;  1XJ2 A;  4CLC B;  4DMZ A;  1OT9 A;  4P6Z M;  4HQA A;  4BBT A;  1OT6 A;  2YPA A;  2V0U A;  4WL9 A;  2KDK A;  3T4S A;  2WKQ A;  2OOL A;  2QJ7 A;  3LFV A;  4Y5F A;  3MR0 A;  2PHY A;  1DP9 A;  4CLC E;  1DP8 A;  3CI6 A;  1TD5 A;  3PXP A;  4F3L A;  4H6J B;  1T19 A;  4OOL A;  1XJ3 A;  1S1Z A;  1S4S A;  3LR3 A;  2JKR M;  3R7W A;  2PYR A;  2QL2 A;  2JN7 A;  3EQU A;  2Y8H A;  4R3A A;  3S7N A;  3R4K A;  4MDZ A;  1NKP A;  5J7E A;  2K7S A;  1BYW A;  1T1B A;  5J4E A;  1OTI A;  2H28 A;  2HGV A;  4IHQ A;  2PD7 A;  4EET B;  2O9C A;  2W3H A;  4IUH A;  2XA7 M;  3TRC A;  3UB9 A;  5MC7 A;  5G4Y A;  3G6O A;  1VB6 A;  1WA9 A;  2W1T B;  2EWW A;  4BWI A;  3S7P A;  5F69 A;  4UQI M;  2WKR A;  2XRN A;  2GJ3 A;  4I3I A;  3EEA A;  3BJN A;  2ZMF A;  4LRX C;  1LSV A;  3PR6 A;  2YKF A;  1STZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...