4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/activator
molecule keywords BMAL1b
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
4H6JA 3NOUC 1S1ZA 1T1CA 4EESA 5TBMB 3RTYA 3H82B 4H10A 4R3AA 3FC7A 3CWFA 1S66L 3K3DA 1MZUA 2PHYA 4I39A 4HY8A 4E04A 1ODVA 3IBRA 3GDIA 2QKPA 4R70A 2KX6A 4ATKA 3KX0X 1OT6A 3F1NA 3VE3A 1GSWA 3UB8A 4L9FA 4WUJA 4GS9B 4EXOA 1AN2A 4HJ3A 3LI8A 4EEPA 3H7WB 4EQ1A 1JNUA 5HDDA 2VV6A 2OWHA 2YKHA 4XT2B 2INWA 5AVFA 2YPAB 2PYRA 4AYAA 1T1AA 4DJ2A 1V9ZA 5DJUA 1TS6A 4WN5A 4MN6A 4HOIA 4JGRA 4GHIA 4F3LB 4HI4A 2I9VA 4GCZA 2V9AA 2YPAA 3FG8A 1S67L 4I3AA 5IS1A 5G4ZA 4HNBA 1DRMA 1S4RA 2YPBB 5AVEA 3NJAA 4BBVA 3VOLA 3CAXA 2V1AA 4I3IA 1DP8A 2JHEA 3C8CA 2ZOHA 4L9EA 3U5VA 5DKKA 2PD8A 1G28A 2D01A 1DP9A 3UE6A 1UGUA 1NLWA 2QHKA 3EWKA 4M4XA 2V1BA 3ICYA 4HHDA 2JN7A 3LIAA 1A0AA 2VV8A 4BBTA 3BY9A 2A24A 4HJ6A 1BYWA 2L1MA 3F1NB 3UB7A 3RH8B 5HWWA 5J7EA 1GSVA 1V9YA 2K7SA 2PD7A 4GW9A 1HLOA 5HD3A 3MQOA 2PDRA 4I5SA 4R38A 1LSWA 4KUOA 4I38A 1MDYA 3H82A 2LFHA 4H6JB 1D06A 4I3JA 3BWLA 4LRZE 1OTBA 5F69A 1UWPX 2WKRA 2D02A 5I5LA 1LT0A 4HH2A 1NLWB 4LRXC 1OJGA 4KUKA 2L4RA 4ATIA 3HJIA 4PKYG 3C2WA 5DJTA 2Z6CA 3F1OB 5EYOA 3F1OA 2QWSA 1OT9A 2MH3A 1P97A 1T1BA 2QJ7A 2WKQA 3SW1A 3IS2B 2QL2A 3LUQA 4HP9A 2BASA 1OJ5A 4EETB 3LIBA 2R78A 1NKPA 3IS2A 1D7EA 3A0RA 4JGPA 3NOTC 1P0ZA 4GHIB 1TS7A 4NXBA 1XJ6A 3MR0A 1S4SA 1GSXA 2L0WA 3UMEA 3LI9A 4B9OA 3E4QA 3PYPA 5I50A 4HH3A 4EERA 3LYXA 2YKFA 5HZHA 3LIFA 5HSQA 4H10B 2V0WA 5HWVA 4HJ4A 5HD5A 3G6OA 1OTDA 3D72A 5G4YA 1MDYB 5IU1A 2YPBA 2PR5A 4LRYC 3NHQA 1LSVA 3B33A 1Y28A 2OWJA 5DKLA 3F1PB 3LIDA 1T19A 2WKPA 1XJ3A 3ULFA 3E4OA 4LLOB 1N9LA 5F6AA 1LSXA 2PR6A 2M1CA 4WL9A 1KOUA 1TS0A 2W0NA 2VV7A 2W27A 2ZBBA 1OTEA 1T18A 2QJ5A 2PYPA 3GECA 3LICA 1AN4A 5EFWA 3ZQ5A 4PKYA 4JGOA 4R6LA 3VE4A 1UKLC 3MUJA 4YWZA 2B02A 1EW0A 3PHYA 1XJ2A 3H9WA 4F3LA 1F9IA 4NXGA 1LL8A 1S1YA 5F68A 4WF0A 2EA9A 3MJQA 4BBUA 5HDCA 3NOPC 5TBMA 4XT2A 1X0OA 2A24B 3UB6A 3H7WA 1AM9A 4NXFA 1N9OA 3BY8A 2Z6DA 1TS8A 4DJ3A 5HWTA 3E4PA 5J3WA 1NWZA 1N9NA 4ATHA 3MFXA 1XFQA 3K3CA 4WLAA 4KQDA 2CMNA 3MQQA 3OLOA 2KDKA 1XJ4A 5J4EA 1R05A 2V0UA 2VLGA 3F1PA 1DP6A 1NKPB 2HV1A 4HQAA 2H28A 3LIEA 4K08A 5HDSA 1OTAA 3A0SA 4GS9A 2ZOIA 2QL2B 3EEHA 1VB6A 3UB9A 5A8BA 1F98A 4L9GA 4RQ9A 4LPZA 2J80A 4MN5A 3CLOA 1WA9A 1UWNX 3T50A 3A0VA 5F5YA 2GJ3A 3MXQA 4JGQA 4HIAA 1XFNA 2OOLA 3HJKA 1OTIA 4EEUA 4HP4A 4EW7A 3UMDA 5I4ZA 2VEAA 5KIZA 3P7NA 4NXEA 2P7JA
chains in the Genus database with same CATH superfamily
4E3OA 4G3KA 3NOUC 5CGXA 2IWDA 3CPTB 3RTYA 5M19A 1SKOA 1S66L 2Y2IA 4KZBA 1YPRA 3BECA 4Y3IA 1K4FA 5L10A 1BUEA 3CMZA 1NY0A 4OKPA 4KENB 2JCHA 3VP0A 2R9WA 4O0PA 2WKEA 2P08A 4BENA 1L0FA 3VE3A 4FTXA 4GS9B 3RXWA 5KZHA 3PBSA 3LI8A 4IVIA 4Z9QA 2OWHA 1KDSA 2YKHA 3G2ZA 4WZ5C 4XT2B 1ERMA 2R9XA 1VM1A 4GZBA 3IF6B 4MBHA 4AYAA 4IVKA 4MBKA 4DJ2A 5DJUA 1TS6A 4MN6A 4RX3A 1ZZAA 3ZHHA 4Y0TA 2JKTM 1XGIA 2VGKA 4HI4A 3QHYA 2I9VA 3IF5A 3A3IA 4RA7A 3UNWA 1ZG6A 5FQQA 2NUPC 5CECA 1SKOB 4OQHA 3V3SA 1O7EA 3UE3A 3EQUA 1QMEA 1BULA 2YPBB 1M6KA 2J3TD 3ZDJA 2W3EA 1PW8A 3TSGA 5DF8A 1PWCA 4R1GA 3VP4A 2WAEA 3SS5A 5HAPA 1JTGA 2WYXA 2Y2LA 3C8CA 2V2FF 3KSIA 3U5VA 4KZAA 3M6BA 2XD5A 1UGUA 1NLWA 1D1JA 3GSGA 3LEQA 1OPXA 1PFLA 1TF1A 2OAQ1 3Q07A 3LY3A 4KZ5A 4GJ4A 5CXWA 2W1RA 3Q7VA 1YQSA 4HJ6A 3VP1A 3S7QA 1BYWA 4E3LA 3F1NB 3UB7A 1K54C 4ETXA 3G32A 1V9YA 2Q9NA 4A5RA 4E3MA 1KVMA 4E6WA 3IF6A 5KSHA 1CJFA 3MQOA 2WUQA 3IF6C 3WS1A 4X25A 2C6WB 2V20A 3H82A 3G30A 1KE4A 4I3JA 2JKTI 5HARA 3JVUA 4HH2A 4HESA 5FDSA 1ES4A 1NXYA 3PBTA 1NYMA 4DN0A 3UDIA 5HAQA 2VX8A 4EQIA 3N8RA 4LENA 5DJTA 1W8YA 2WKHA 5E2FA 1RGZA 1F2KA 4XXRA 1T1BA 2V1ZA 4JLFA 4WYYA 4U0TA 4B88A 1PZOA 3CHWP 4UA7A 3SW1A 1BLPA 2QL2A 3LUQA 1L0EA 2J3TC 1OJ5A 2Y2GA 2UWXA 4EETB 5FEFA 3ITBA 4N1XA 3NULA 4B4XA 3OZHA 3OPRA 3WRZA 3MZFA 3A0RA 2HDQA 1ZHHB 5FI2A 3IH9A 3ZG8B 4ARZB 3LO7A 3UMEA 3LI9A 5I50A 5EUAA 3UE1A 1MKMA 3ZG0A 4FD8A 2YKFA 5HZHA 4F94A 3HLCA 4S2JA 3HLWA 2FFFB 4HJ4A 5HD5A 2QMIA 3FKVA 3GQZA 4BMWA 3ZG5A 3BM6A 4R23A 2J9PA 2YPBA 1IEMA 2EX6A 1U60A 4MNRA 4QB8A 5EVIB 1XXMA 1IOUA 2E8JA 1AWIA 2OWJA 2XGNA 2J3WA 3F1PB 4KZ7A 1GHPA 4MN7A 4ESPA 2BTFP 2P9VA 3E4OA 2W3FA 1KGGA 1IYOA 1FSYA 1A0KA 4CLCA 4QHCA 2XH9A 3M2KA 2HP5A 1TS0A 2W27A 4DE2A 3N4IA 5JYOA 2ZBBA 4P6ZS 4LV0A 3ZNYA 3PXPA 3DBAA 1XA1A 3GR2A 4XUZA 4PKYA 4OQ0A 4Y5FA 4R6LA 4DXBA 1UKLC 4YWZA 4E3IA 4P87A 3HLFA 3FPVA 4NXGA 5F68A 3LFVA 3MJQA 4G3VA 2VK3A 4BBUA 5HDCA 1IYQA 4UHUA 3T1XA 2XROA 1Z6FA 4P6BA 4BQMA 3OPHA 4EBPA 3H7WA 4NXFA 1LL9A 3WS5A 3P09A 3C7UA 3E4PA 1NWZA 1ERQA 2HDRA 3K3CA 3IXBA 3SH7A 3VFFA 3D4FA 4WLAA 5FL3A 3MQQA 3HLBA 1AXBA 1L0DA 5J4EA 1R05A 2I72A 1Y4OA 3CG5A 1K54A 3T4SA 2GDNA 4N1HA 1YMXA 2X01A 3PBQA 1KGEA 3WS2A 4OLDA 3LIEA 1YLWA 2V8FA 3A0SA 3T4TA 1PIOA 1RGYA 3IXGA 3BEBA 1ES5A 5CERA 1PYYA 2QL2B 5TFQA 1CI9A 5A8BA 1F98A 2OSUA 4EUVA 1NZOA 5GHYA 4X55A 4RQ9A 1FIKA 1I2SA 1K55A 2J80A 3DW0A 4MN5A 2W1TB 4IHQA 2CC1A 1UWNX 4ZBEA 3A0VA 5F5YA 4JGQA 4QWOA 1MWTA 2OOLA 2WKIA 2JKRM 5TGFA 3UMDA 2DCFA 4EBNA 5A91A 1SDEA 3P7NA 3K2NA 1CI8A 5CHJA 4WBGA 2JKFA 4H6JA 3BFDA 5TBMB 4EESA 4CPKA 3SZTA 4R3AA 3CWFA 3UO9A 3AGDA 2PHYA 4I39A 3AGFA 3PAGA 4E04A 1STZA 4WM9A 4S2OA 3NCKA 5EECA 3E2KA 3IBRA 3C7VA 4ATKA 2A3UA 3BQAA 3WS0A 3JVVA 3UDXA 1NJ4A 2PRFA 3R4KA 4IBXA 1TDGA 1YM1A 4JPMA 3TRCA 4PM6A 1VEUB 4JF5A 1IYSA 3MFDA 3ZYTA 3IBJA 4C75A 3SH8A 5K5BA 2VA0A 4DRTA 5EVID 1I2WA 3LY4A 4GB7A 2Q0OA 4WN5A 3A3FA 4HOIA 4JGRA 5CHMA 5CEDA 4KZ9A 1KVLA 2YPAA 5D3OA 4WEJA 3PAEA 1YAXA 4I3AA 1TD5A 4BLMA 1VQQA 1DRMA 2G2WA 1CK3A 4JXGA 2DMWA 3NJAA 4BBVA 1K38A 3VOLA 3CI6A 5FA7A 3UN7A 2HF6A 5FATA 2JHEA 1LLBA 3MF0A 4OP8A 1MBLA 2HJEA 2PBDP 5MC7A 5L07A 3DWZA 4KZ8A 4Z1WA 1MXOA 1W7FA 3EWKA 4P6ZM 5FQ9A 2IA2A 4M4XA 3S7NA 4HHDA 2JN7A 3LIAA 1A0AA 2VV8A 1XGJA 3CZDA 2L1MA 4CLCB 4JXWA 3RH8B 1DJBA 3EEAA 3UE0A 1GSVA 1PI4A 3NC8A 2K7SA 1PW1A 4R4SA 2PD7A 4GW9A 4PAUA 3EGDC 1K25A 1Q2QA 4ID4A 2H0YA 5HPFA 4P85A 4I38A 5FAPA 2Y2KA 1EWZA 2LFHA 1D06A 5EVIC 4LRZE 5F82A 1UWPX 4BL2A 2D02A 3PBOA 4MMNA 5I5LA 5GHZA 1LT0A 5E43A 1IKGA 4LRXC 4UAAA 2XRNA 2B5RA 3RXXA 2XD1A 2QZ6A 2H10A 4R4RA 4IBRA 4BWIA 4NETA 3F1OA 2Y79A 2XSSA 3S7PA 1E3UA 1O07A 1P97A 5J8XA 1HZOA 4PHTA 1PRQA 1M40A 1E4DA 4ME4A 4X1MA 4GDNA 4HP9A 1PI5A 3OOVA 3NDGA 3T4OA 3ZGAB 5IT5A 2AVXA 1D7EA 4EUZA 2G7UA 3N7WA 4OQGA 4JGPA 2QYBA 4OLGA 1TS7A 4NXBA 1FSWA 1S4SA 1NRJA 3C38A 1G68A 2WGWA 4NK3A 2W1TA 4JXSA 2M7UA 2VGJA 3LYXA 3HLDA 4BD1A 3LIFA 3LGOA 1CEGA 5HWVA 2O9BA 2JKRI 3D72A 2VJWA 5E2EA 3IX3A 2Y91A 2PR5A 4LRYC 1FR1A 3OPLA 3G34A 5DKLA 3O88A 1ALQA 1K0KA 2G2UA 2P9VB 1OMEA 4EBLA 5FQKA 1LSXA 2PR6A 2JE5A 4S2NC 4WL9A 3S22A 1KOUA 1Z09A 2VV7A 5CGSA 1GCEA 3EGXC 3GRJA 4IUHA 2QJ5A 2PYPA 1AN4A 3VE4A 3Q82A 3B47A 3PR6A 3MUJA 4Q0IA 2ZC5B 3NI9A 1XJ2A 4FCFA 4KQRA 4F3LA 1F9IA 5EOEA 5L8MA 1SDNA 3MS6A 3QP2A 1ONHA 1S1YA 4AFIA 3VOYA 1H8YA 3C4PA 3QP1A 1YSPA 4EU0A 2VGLS 1KGFA 4XT2A 5FASA 3WRTA 1NLYA 2GX5A 3UB6A 3WS4A 3MBZA 5IHVA 2Z6DA 1TS8A 4GKUA 2HJ9C 3FV7A 4DJ3A 1J9MA 5J3WA 3SS3A 2WGWB 1N9NA 3V50A 4GD8A 1XFQA 1K57A 1S0WA 3D3OA 4OP5A 3KSFA 5GLCA 3OLOA 2KDKA 4Y0UA 4II7A 1K57C 3VOZA 2V0UA 4O7DA 1NKPB 1FOFA 5A90A 1BTLA 4HQAA 1W79A 1XX2A 4OONA 5TJJA 1BT5A 5FSRA 4U3TA 2EWWA 2KOIA 4U0XA 3QP8A 2NUTC 3CITA 3UPPA 1TEMA 2Y2OA 3MMHA 1IELA 4K08A 4DKIA 4ZJ1A 2ZQDA 3OBFA 3C30A 1ZC2A 5DFXA 3LR3A 1DJAA 1PZPA 1E3UD 2O9AA 4K91A 1N4OA 3S7OA 2Y2PA 1VETA 2KLIA 4ZAMA 3CUEA 2PAVP 3DTMA 3CLOA 3ZCZA 1WA9A 1XP4A 3R7WB 2HP9A 3ZNTA 4UA6A 4N9KA 4OVDA 4JBFA 1ESIA 3L7HA 5FEGA 4O01A 4HP4A 3IX4A 2Y2QA 4EW7A 5I4ZA 2VEAA 1S6RA 5KIZA 4WZ5A 2P7JA 2HGVA 1CQAA 2XA7M 3DWKA 3N8SA 4Y13A 1PNEA 5KMWA 3FC7A 1G6OA 1KDWA 3CUEC 1SKFA 3K3DA 3OCNA 3NY4A 4L0LA 1MZUA 5EM1A 2QPNA 4HY8A 4UQIS 1ES2A 1ODVA 1K56A 4S2NA 3CJMA 4R70A 3KYEA 1MC0A 2KX6A 1L3LA 2B18A 4UEYA 3C5AA 3KX0X 1OT6A 3GMWA 4E3NA 1GSWA 5HW3A 5HL1A 4FOFA 3UB8A 3W4OA 4NEED 4L9FA 3E98A 4EXOA 2Y2HA 4HJ3A 4PM8A 3VSKA 1JNUA 5HDDA 3B3XA 3VP2A 4JXVA 2ZQ8A 5I94A 5FAOA 5AQAA 3G2YA 4N9LA 2YPAB 2P74A 1V9ZA 2LB9A 5FQJA 3BQ8A 4PM5A 2XK1A 4JKTA 1H5XA 4GHIA 4IJGA 4F3LB 1Y54A 3V3RA 4C3QA 4EV4A 4DF6A 5M18A 3P01A 1YKDA 1KE0A 5CHUA 3SH9A 1S67L 3DTIA 1NLZA 2GNXA 4OOMA 5M1AA 1S4RA 1EROA 3UB5P 1DJCA 4LCLA 4JF4A 5AVEA 3TG9A 2UV0E 3JYIA 1GA0A 1JWPA 3T1SA 5EOOA 2EXAA 1YMSA 4I3IA 1DP8A 3FWLA 2ZM2A 2JBFA 5FQIA 5CEBA 2ZOHA 4XUXA 3V5MA 5DKKA 2PD8A 5HAIA 2W3HA 1G28A 4KZ6A 1VHMA 2QHKA 4G3WA 3MXRA 4X6TA 2Y2MA 1VEUA 1WYBA 2HPBA 2VGLM 5L2FA 4RVAA 5F1FA 4GN2A 2ZC6B 1TVFA 1PWGA 2XDMA 2ZC4B 2A24A 3VFHA 3I7JA 4KG6A 3ITAA 3U4LP 2Y2JA 3QNCA 3TW8A 3MZDA 3HCYA 5HWWA 5CGWA 5JYPA 5J7EA 1XA7A 3E0YA 5AQBA 1YLYA 1YLTA 2IWCA 5GL9A 3WWXA 5A93A 1HLOA 5HD3A 2Y2NA 4FH4A 3VP3A 1IFQA 2PDRA 4OPRA 4R38A 1LSWA 4KUOA 4MBFA 2EFXA 4H6JB 4PM7A 4YINA 3BWLA 3BLSA 4NG2A 3DTKA 5F1GA 3V39A 3FYZA 2GZAA 4K0XA 1MY8A 1OJGA 3ISGA 4X56A 4OOLA 3IHBA 2L4RA 4IEDA 2ZD8A 4ATIA 1HD8A 2ZL1A 3VMAA 2Y55A 3AGEA 5FI7A 3C2WA 1SHVA 2Z6CA 3F1OB 1W8QA 2QWSA 1OT9A 2X02A 2MH3A 3NBLA 4DDSA 2WAFA 5TR7A 2WKQA 3IXHA 2EX2A 3IH8A 2Z2LB 1QMFA 2XLNA 3G31A 1F5MA 2R78A 5EM0A 4B4ZA 3ZFZA 2ZJ9A 4B93A 3QP4A 3IS2A 4S2PA 4E3KA 3M2JA 3A3EA 3BYDA 1H3QA 3MKEA 4DE0A 5KSCA 4ARZA 3MR0A 4MEZA 2ZC7A 1GSXA 4KG5A 2L0WA 4YFMA 4B9OA 3W8KA 4CLCE 3IT9A 4HH3A 3NDEA 4EERA 1FCOA 3KSGA 4E6XA 1VETB 2HP6A 4H10B 5HSQA 2V0WA 3QNBA 4WMCA 3KO6A 2DRWA 2FFYA 1OTDA 1HLUP 3Q7ZA 5G4YA 1MDYB 5IU1A 1NZUA 2ZM8A 1ZKJA 3T4LA 5FI6A 5HPIA 3HREA 5DTSA 1W63Q 1Y28A 4Q0JA 1W5DA 4Y15A 4QU3A 1SCWA 2A49A 2WKPA 2X71A 3SOIA 1LHYA 2ZL1B 4P0MA 5DVAA 1MPLA 1K55C 4Q0HA 2M1CA 3P98A 5GHXA 3TOIA 1YT4A 5HL6A 3HVFA 4KG2A 2W0NA 2Y8HA 2Q9MA 4FSFA 1OTEA 1T18A 4MCWA 3S4XA 5FAQA 3LICA 3ZQ5A 3T12B 4MLLA 4KZ4A 1I5QA 1FILA 3W2ZA 2B02A 3PHYA 4QY5A 4S2MA 3H9WA 4R3JA 1Q2PA 1LL5A 2C5WB 2ZQ7A 3GVBA 1K6SA 4K0WA 4WF0A 2EA9A 5CTMA 2ZMVA 3BFCA 3NOPC 3CPTA 4EWFA 1X0OA 2A24B 1AM9A 1JVJA 1N9OA 3BY8A 4S2KA 3NIAA 3SS4A 5DTTA 3O3VA 3TJZC 2PBYA 4ATHA 3MFXA 2JKGA 4KQDA 2CMNA 1H8MA 4D2OA 2O9CA 1LI0A 2HV1A 3A3JA 4OPQA 2H28A 1K4EA 5CX7A 4ZJ2A 5AQ7A 1OTAA 4X53A 4GS9A 5HX9A 2Y59A 3EEHA 4LFUA 3BFEA 1VB6A 4L9GA 2Z2MB 1GA9A 3BFGA 4LPZA 4H8RA 3HBRA 3JPUA 3U2AA 1YSQA 4WZ4A 5EVLA 2DNSA 2ZMAA 1H0MA 3LEZA 4EEUA 4ZRRA 1FCMA 3QP6A 1EI5A 2OV5A 3M6HA 3O86A 1YLPA 4HIAA 1RP5A 3FZCA 1S1ZA 4OQIA 1T1CA 3H82B 4QPRA 4H10A 3O5YA 4DE1A 4HEFA 5FDHA 2ACGA 4LCMA 5G18A 2HDUA 5DF9A 5DF7A 4GDBA 4Y17A 5DFYA 3PBRA 3GDIA 2VKSA 2QKPA 4KQOA 3IXDA 2A2LA 3N6IA 1K1FA 3F1NA 1NRFA 2J9OA 4QY6A 4WUJA 3Q7VB 4S2IA 2PU2A 1P9RA 1L2SA 4ZDXA 1AN2A 4EEPA 3H7WB 3LR5A 3RJUA 1H8ZA 4LV2A 4EQ1A 2VV6A 3BRMA 2WADA 4DXCA 4WELA 1HVBA 2B95A 3HUOA 4UQIM 2INWA 5AVFA 2P04A 2PYRA 2WK0A 4LV1A 5E2GA 3DTEA 3LCEA 1T1AA 3O87A 1FR6A 4MDZA 3Q1FA 2O99A 1BSGA 4CLCC 1MKIA 3TE8A 3BFFA 1WYCA 4GCZA 2V9AA 5GLBA 1WE4A 3FG8A 1JWZA 3VV4A 5IS1A 3N8LA 5G4ZA 4HBTA 4HNBA 4C6YA 3IWQA 3T1QB 5FQMA 4N92A 1XKZA 1P9WA 4BD0A 2XQZA 2ZM0A 3Q81A 3FKWA 2XA7S 2ZQCA 3CAXA 4RX2A 2V1AA 4KQQA 4OPYA 4HBUA 1W63M 4IUKA 4L9EA 4Y7PA 2H0TA 5CRFA 3LR0A 2W3GA 2D01A 5EVIA 1DP9A 3UE6A 3D9YA 3BLMA 2M7VA 2J8YA 2V1BA 3G4PA 3MKFA 3ICYA 5AQ9A 2MJ6A 3IX8A 4BBTA 1BZAA 1DY6A 3BY9A 4QJGA 4OOYA 1JWVA 2V8CA 3LR4A 4ZJ3A 4ZTKA 4PPRA 5A92A 3VSLA 2JC7A 1YLJA 5LBRA 1TDLA 1XPBA 3IHAA 4CQHA 4I5SA 3GV9A 1CF0A 1LI9A 3EOIA 1MDYA 3HLGA 2XEPA 4CJNA 1OTBA 5F69A 3W4QA 4D60A 4S2LA 2WKRA 4KZ3A 2PU4A 2WGIA 1NLWB 2E8IA 4CLCD 3HUNA 4KUKA 2WZZA 3HJIA 4PKYG 3ZVWA 4Y0OA 5EE8A 5EYOA 3T1RA 2ZQ9A 4R0QA 2QJ7A 3HL9A 2EX9A 3IS2B 4E3JA 1GHIA 3V67A 2HDSA 2BASA 3T4JA 3LIBA 3MSHA 2H5SA 1CEFA 5U47A 2WGVA 3HLEA 2FH5A 3DAVA 1NKPA 3KYZA 5EVEA 5F83A 3NOTC 5HFOA 4PMAA 1P0ZA 4GHIB 1XJ6A 2BLSA 1C3BA 3OC2A 3NECA 1BLSA 3E2LA 1K6RA 3E4QA 2OAP1 3PYPA 4GNUA 4BJPA 1SZVA 4YOFA 3KSHA 1MWUA 3MZEA 3UPNA 2RCXA 4YNRA 2ZQAA 5GLDA 2RL3A 3G6OA 1ACFA 3OPPA 2EX8A 1ESUA 1GHMA 3IWIA 3S1YA 4BL3A 5C5KA 1ZG4A 4DMZA 5EV0A 1G5UA 5E2HA 3NHQA 1LSVA 3B33A 3IQAA 3LIDA 1T19A 1XJ3A 3ULFA 2WZXA 1J3WA 3MQ0A 4LLOB 1FQGA 4X1LA 2ZC3B 2VZWA 1RCJA 4M3KA 3BW6A 1N9LA 5F6AA 1PWDA 4O8GA 5CTNA 3A3DA 1L0GA 4OPZA 3GTCA 3BJNA 1JTDA 1MWSA 2LB5A 5EPHA 1BLHA 4WEKA 4PM9A 3G35A 4Q8IA 2O0YA 4X69A 3UDFA 1IYPA 1IKIA 3GECA 3PTEA 5EFWA 4WMCD 2XFTA 1E25A 4JGOA 2XF3A 2BG1A 1HTZA 1EW0A 5BOHA 5DTKA 3FPWA 2EWVA 3OCLA 1LL8A 4ETZA 3R7WA 4JF6A 2Y4AA 3ZG9B 1ZTUA 3ZVTA 2J7VA 3UPOA 1MWRA 3KYQA 3C4OA 3ZG7B 3HUMA 3T4KA 4LV3A 4GLQA 5TBMA 1KE3A 4R3BA 2K2NA 5HWTA 2IWBA 4FUWA 3IWOA 3B42A 1ES3A 2W3DA 5GLAA 1FCNA 1NYYA 1XJ4A 3T4QA 2ZLYA 4RYEA 2VLGA 3F1PA 2PT7A 2OLUA 1DP6A 3QP5A 3MXSA 3PBNA 4Y2FA 1K56D 2XR0A 4GOGA 3UY6A 2HZ5A 5L09A 1N9BA 5HDSA 5AJGA 4DE3A 3EQVA 4DDYA 2ZOIA 3UB9A 4UA9A 1YLZA 1BLCA 2XFSA 3L9KA 4FH2A 2ZMFA 4GD6A 1ONGA 2EXBA 3T50A 2GJ3A 3MXQA 4QD4A 4X68A 1XFNA 3HJKA 1OTIA 4NKPA 4LGWA 1G6AA 2EFUA 3RFBA 2K31A 3W4PA 4OH0A 2OLVA 4NXEA 2FZ0A
chains in the Genus database with same CATH topology
3K2NA 2HGVA 4G3KA 2XA7M 4H6JA 3NOUC 1S1ZA 1T1CA 4EESA 5TBMB 3RTYA 3H82B 4QPRA 4H10A 3O5YA 4R3AA 3FC7A 3CWFA 1G6OA 3CUEC 1S66L 3K3DA 3OCNA 4L0LA 1MZUA 2PHYA 4I39A 4Y3IA 4HY8A 4E04A 4UQIS 1STZA 5DF9A 1ODVA 5DFYA 3IBRA 3PBRA 3GDIA 2VKSA 2QKPA 4KQOA 4R70A 2A2LA 1MC0A 2KX6A 4O0PA 4ATKA 2B18A 4UEYA 3BQAA 3KX0X 1OT6A 2P08A 3JVVA 3F1NA 3VE3A 1GSWA 3R4KA 4FOFA 3UB8A 4NEED 4L9FA 4WUJA 4GS9B 1P9RA 3E98A 4EXOA 1AN2A 3PBSA 4HJ3A 3LI8A 4EEPA 3H7WB 3LR5A 4EQ1A 3TRCA 1JNUA 5HDDA 2VV6A 4WELA 2OWHA 3ZYTA 3IBJA 4UQIM 2YKHA 4XT2B 2INWA 5K5BA 5AVFA 2VA0A 2YPAB 2P04A 2PYRA 4AYAA 1T1AA 4DJ2A 1V9ZA 2LB9A 3BQ8A 5DJUA 1TS6A 4WN5A 4MN6A 4MDZA 4HOIA 4JGRA 2JKTM 2O99A 4CLCC 4GHIA 4IJGA 4HI4A 4F3LB 3TE8A 2I9VA 4GCZA 2V9AA 1YKDA 3P01A 2YPAA 3FG8A 4WEJA 1S67L 2NUPC 1NLZA 1YAXA 3VV4A 4I3AA 1TD5A 5IS1A 5G4ZA 4HNBA 2GNXA 4OOMA 3UE3A 1DRMA 1S4RA 3EQUA 2YPBB 5AVEA 1P9WA 2DMWA 2J3TD 3NJAA 2W3EA 4BBVA 2XA7S 3VOLA 3CAXA 2FZ0A 2V1AA 3CI6A 4I3IA 1DP8A 1W63M 2HF6A 2JHEA 3MF0A 3C8CA 4IUKA 2ZOHA 3KSIA 4L9EA 3U5VA 2HJEA 5DKKA 2PD8A 2W3GA 3LR0A 5MC7A 2W3HA 1G28A 2D01A 1DP9A 4Z1WA 3UE6A 1UGUA 1NLWA 1VHMA 2QHKA 4G3WA 3EWKA 4P6ZM 1OPXA 2M7VA 1TF1A 2IA2A 4M4XA 2OAQ1 2V1BA 3S7NA 3ICYA 2VGLM 4HHDA 2JN7A 2MJ6A 3LIAA 2VV8A 1A0AA 4BBTA 4GJ4A 3BY9A 2A24A 2W1RA 4HJ6A 3S7QA 1BYWA 3TW8A 2L1MA 3F1NB 3UB7A 4CLCB 3HCYA 3RH8B 5HWWA 3EEAA 5J7EA 3E0YA 3LR4A 1GSVA 4ETXA 1V9YA 2K7SA 2PD7A 4GW9A 1HLOA 4PAUA 5HD3A 3EGDC 5KSHA 5LBRA 3MQOA 1IFQA 2PDRA 4CQHA 4I5SA 4R38A 1LSWA 4KUOA 5HPFA 4I38A 3EOIA 1MDYA 3H82A 2LFHA 4H6JB 1D06A 4I3JA 3BWLA 4LRZE 1OTBA 5F69A 1UWPX 2JKTI 2WKRA 2D02A 3PBOA 4MMNA 3JVUA 5I5LA 1LT0A 4HH2A 1NLWB 4LRXC 2GZAA 3PBTA 1OJGA 2XRNA 4DN0A 4CLCD 4KUKA 4OOLA 2L4RA 2VX8A 4ATIA 3HJIA 4PKYG 3C2WA 5DJTA 2Z6CA 3F1OB 5EYOA 4BWIA 3F1OA 2Y79A 2QWSA 1OT9A 2XSSA 3S7PA 2MH3A 1P97A 1T1BA 2QJ7A 2WKQA 3SW1A 4PHTA 3IS2B 2QL2A 3V67A 4ME4A 3LUQA 2J3TC 4HP9A 2BASA 1OJ5A 3OOVA 4EETB 1F5MA 3T4JA 3LIBA 3T4OA 2R78A 2FH5A 5IT5A 4B93A 1NKPA 3IS2A 3KYZA 1D7EA 2G7UA 3A0RA 4JGPA 1ZHHB 3NOTC 1H3QA 2QYBA 1P0ZA 4GHIB 1TS7A 4ARZA 4NXBA 1XJ6A 3MR0A 3OC2A 4ARZB 1S4SA 1GSXA 1NRJA 2L0WA 3UMEA 3C38A 3LI9A 4B9OA 4CLCE 3E4QA 3PYPA 2OAP1 5I50A 4HH3A 4BJPA 2W1TA 4EERA 4YOFA 3KSHA 3KSGA 1MKMA 2M7UA 3LYXA 2YKFA 5HZHA 3LIFA 5HSQA 4H10B 4YNRA 2V0WA 5HWVA 2O9BA 3KO6A 4HJ4A 2JKRI 5HD5A 3G6OA 1OTDA 3D72A 4BMWA 2VJWA 5G4YA 1MDYB 5IU1A 2YPBA 5C5KA 2PR5A 3T4LA 4DMZA 5HPIA 4LRYC 3NHQA 1W63Q 1LSVA 3B33A 1Y28A 4Q0JA 1IOUA 2OWJA 5DKLA 2J3WA 3F1PB 3LIDA 1T19A 2WKPA 4MN7A 1XJ3A 3ULFA 3E4OA 3MQ0A 2W3FA 4LLOB 2VZWA 3BW6A 1N9LA 5F6AA 1LSXA 4CLCA 4O8GA 2PR6A 4Q0HA 2M1CA 4WL9A 3BJNA 5HL6A 1KOUA 2LB5A 1TS0A 2W0NA 2VV7A 2W27A 2Y8HA 2ZBBA 4P6ZS 4WEKA 4FSFA 3EGXC 2O0YA 1OTEA 1T18A 4IUHA 4MCWA 2QJ5A 3PXPA 3DBAA 2PYPA 3GECA 3LICA 1AN4A 5EFWA 3ZQ5A 4PKYA 4JGOA 4Y5FA 4R6LA 3VE4A 4NXEA 3B47A 3W2ZA 3PR6A 1UKLC 3MUJA 4Q0IA 4YWZA 2B02A 1EW0A 3FPVA 3PHYA 1XJ2A 3H9WA 4F3LA 1F9IA 5L8MA 3FPWA 2EWVA 3OCLA 4NXGA 1LL8A 4ETZA 3R7WA 1ZTUA 1S1YA 5F68A 4AFIA 4WF0A 2EA9A 2ZMVA 3KYQA 1YSPA 3LFVA 3MJQA 4G3VA 4EU0A 4BBUA 5HDCA 2VGLS 3T4KA 3NOPC 4GLQA 5TBMA 4XT2A 1X0OA 2A24B 2XROA 1NLYA 2GX5A 3UB6A 3H7WA 1AM9A 4NXFA 1N9OA 3BY8A 2Z6DA 1TS8A 2K2NA 2HJ9C 4DJ3A 5HWTA 3E4PA 3TJZC 5J3WA 1NWZA 1N9NA 4ATHA 3MFXA 1XFQA 3B42A 3K3CA 3D3OA 2W3DA 4WLAA 4KQDA 5FL3A 2CMNA 3KSFA 3MQQA 3OLOA 2KDKA 1XJ4A 4II7A 5J4EA 1R05A 3T4QA 1H8MA 2V0UA 2VLGA 3F1PA 2PT7A 2O9CA 3T4SA 1DP6A 1NKPB 2HV1A 3PBNA 4HQAA 2H28A 3PBQA 4Y2FA 5TJJA 5CX7A 2EWWA 2KOIA 3LIEA 2NUTC 3CITA 3MMHA 4K08A 5HDSA 1OTAA 3A0SA 5AJGA 3T4TA 3OBFA 3C30A 4GS9A 3EQVA 5DFXA 2ZOIA 3LR3A 2QL2B 3EEHA 1VB6A 2O9AA 3UB9A 5A8BA 1F98A 3S7OA 4L9GA 4EUVA 2KLIA 3CUEA 4RQ9A 4LPZA 2J80A 4MN5A 3CLOA 2W1TB 2ZMFA 1WA9A 4IHQA 1UWNX 3R7WB 3T50A 3A0VA 5F5YA 3U2AA 1YSQA 3MXQA 2GJ3A 4JGQA 1XFNA 2OOLA 3HJKA 1OTIA 4NKPA 2JKRM 4O01A 4EEUA 4ZRRA 4HP4A 4EW7A 3UMDA 5I4ZA 2VEAA 3RFBA 2K31A 5KIZA 3P7NA 4HIAA 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J A;  3NOU C;  1S1Z A;  1T1C A;  4EES A;  5TBM B;  3RTY A;  3H82 B;  4H10 A;  4R3A A;  3FC7 A;  3CWF A;  1S66 L;  3K3D A;  1MZU A;  2PHY A;  4I39 A;  4HY8 A;  4E04 A;  1ODV A;  3IBR A;  3GDI A;  2QKP A;  4R70 A;  2KX6 A;  4ATK A;  3KX0 X;  1OT6 A;  3F1N A;  3VE3 A;  1GSW A;  3UB8 A;  4L9F A;  4WUJ A;  4GS9 B;  4EXO A;  1AN2 A;  4HJ3 A;  3LI8 A;  4EEP A;  3H7W B;  4EQ1 A;  1JNU A;  5HDD A;  2VV6 A;  2OWH A;  2YKH A;  4XT2 B;  2INW A;  5AVF A;  2YPA B;  2PYR A;  4AYA A;  1T1A A;  4DJ2 A;  1V9Z A;  5DJU A;  1TS6 A;  4WN5 A;  4MN6 A;  4HOI A;  4JGR A;  4GHI A;  4F3L B;  4HI4 A;  2I9V A;  4GCZ A;  2V9A A;  2YPA A;  3FG8 A;  1S67 L;  4I3A A;  5IS1 A;  5G4Z A;  4HNB A;  1DRM A;  1S4R A;  2YPB B;  5AVE A;  3NJA A;  4BBV A;  3VOL A;  3CAX A;  2V1A A;  4I3I A;  1DP8 A;  2JHE A;  3C8C A;  2ZOH A;  4L9E A;  3U5V A;  5DKK A;  2PD8 A;  1G28 A;  2D01 A;  1DP9 A;  3UE6 A;  1UGU A;  1NLW A;  2QHK A;  3EWK A;  4M4X A;  2V1B A;  3ICY A;  4HHD A;  2JN7 A;  3LIA A;  1A0A A;  2VV8 A;  4BBT A;  3BY9 A;  2A24 A;  4HJ6 A;  1BYW A;  2L1M A;  3F1N B;  3UB7 A;  3RH8 B;  5HWW A;  5J7E A;  1GSV A;  1V9Y A;  2K7S A;  2PD7 A;  4GW9 A;  1HLO A;  5HD3 A;  3MQO A;  2PDR A;  4I5S A;  4R38 A;  1LSW A;  4KUO A;  4I38 A;  1MDY A;  3H82 A;  2LFH A;  4H6J B;  1D06 A;  4I3J A;  3BWL A;  4LRZ E;  1OTB A;  5F69 A;  1UWP X;  2WKR A;  2D02 A;  5I5L A;  1LT0 A;  4HH2 A;  1NLW B;  4LRX C;  1OJG A;  4KUK A;  2L4R A;  4ATI A;  3HJI A;  4PKY G;  3C2W A;  5DJT A;  2Z6C A;  3F1O B;  5EYO A;  3F1O A;  2QWS A;  1OT9 A;  2MH3 A;  1P97 A;  1T1B A;  2QJ7 A;  2WKQ A;  3SW1 A;  3IS2 B;  2QL2 A;  3LUQ A;  4HP9 A;  2BAS A;  1OJ5 A;  4EET B;  3LIB A;  2R78 A;  1NKP A;  3IS2 A;  1D7E A;  3A0R A;  4JGP A;  3NOT C;  1P0Z A;  4GHI B;  1TS7 A;  4NXB A;  1XJ6 A;  3MR0 A;  1S4S A;  1GSX A;  2L0W A;  3UME A;  3LI9 A;  4B9O A;  3E4Q A;  3PYP A;  5I50 A;  4HH3 A;  4EER A;  3LYX A;  2YKF A;  5HZH A;  3LIF A;  5HSQ A;  4H10 B;  2V0W A;  5HWV A;  4HJ4 A;  5HD5 A;  3G6O A;  1OTD A;  3D72 A;  5G4Y A;  1MDY B;  5IU1 A;  2YPB A;  2PR5 A;  4LRY C;  3NHQ A;  1LSV A;  3B33 A;  1Y28 A;  2OWJ A;  5DKL A;  3F1P B;  3LID A;  1T19 A;  2WKP A;  1XJ3 A;  3ULF A;  3E4O A;  4LLO B;  1N9L A;  5F6A A;  1LSX A;  2PR6 A;  2M1C A;  4WL9 A;  1KOU A;  1TS0 A;  2W0N A;  2VV7 A;  2W27 A;  2ZBB A;  1OTE A;  1T18 A;  2QJ5 A;  2PYP A;  3GEC A;  3LIC A;  1AN4 A;  5EFW A;  3ZQ5 A;  4PKY A;  4JGO A;  4R6L A;  3VE4 A;  1UKL C;  3MUJ A;  4YWZ A;  2B02 A;  1EW0 A;  3PHY A;  1XJ2 A;  3H9W A;  4F3L A;  1F9I A;  4NXG A;  1LL8 A;  1S1Y A;  5F68 A;  4WF0 A;  2EA9 A;  3MJQ A;  4BBU A;  5HDC A;  3NOP C;  5TBM A;  4XT2 A;  1X0O A;  2A24 B;  3UB6 A;  3H7W A;  1AM9 A;  4NXF A;  1N9O A;  3BY8 A;  2Z6D A;  1TS8 A;  4DJ3 A;  5HWT A;  3E4P A;  5J3W A;  1NWZ A;  1N9N A;  4ATH A;  3MFX A;  1XFQ A;  3K3C A;  4WLA A;  4KQD A;  2CMN A;  3MQQ A;  3OLO A;  2KDK A;  1XJ4 A;  5J4E A;  1R05 A;  2V0U A;  2VLG A;  3F1P A;  1DP6 A;  1NKP B;  2HV1 A;  4HQA A;  2H28 A;  3LIE A;  4K08 A;  5HDS A;  1OTA A;  3A0S A;  4GS9 A;  2ZOI A;  2QL2 B;  3EEH A;  1VB6 A;  3UB9 A;  5A8B A;  1F98 A;  4L9G A;  4RQ9 A;  4LPZ A;  2J80 A;  4MN5 A;  3CLO A;  1WA9 A;  1UWN X;  3T50 A;  3A0V A;  5F5Y A;  2GJ3 A;  3MXQ A;  4JGQ A;  4HIA A;  1XFN A;  2OOL A;  3HJK A;  1OTI A;  4EEU A;  4HP4 A;  4EW7 A;  3UMD A;  5I4Z A;  2VEA A;  5KIZ A;  3P7N A;  4NXE A;  2P7J A; 
#chains in the Genus database with same CATH topology
 4E3O A;  4G3K A;  3NOU C;  5CGX A;  2IWD A;  3CPT B;  3RTY A;  5M19 A;  1SKO A;  1S66 L;  2Y2I A;  4KZB A;  1YPR A;  3BEC A;  4Y3I A;  1K4F A;  5L10 A;  1BUE A;  3CMZ A;  1NY0 A;  4OKP A;  4KEN B;  2JCH A;  3VP0 A;  2R9W A;  4O0P A;  2WKE A;  2P08 A;  4BEN A;  1L0F A;  3VE3 A;  4FTX A;  4GS9 B;  3RXW A;  5KZH A;  3PBS A;  3LI8 A;  4IVI A;  4Z9Q A;  2OWH A;  1KDS A;  2YKH A;  3G2Z A;  4WZ5 C;  4XT2 B;  1ERM A;  2R9X A;  1VM1 A;  4GZB A;  3IF6 B;  4MBH A;  4AYA A;  4IVK A;  4MBK A;  4DJ2 A;  5DJU A;  1TS6 A;  4MN6 A;  4RX3 A;  1ZZA A;  3ZHH A;  4Y0T A;  2JKT M;  1XGI A;  2VGK A;  4HI4 A;  3QHY A;  2I9V A;  3IF5 A;  3A3I A;  4RA7 A;  3UNW A;  1ZG6 A;  5FQQ A;  2NUP C;  5CEC A;  1SKO B;  4OQH A;  3V3S A;  1O7E A;  3UE3 A;  3EQU A;  1QME A;  1BUL A;  2YPB B;  1M6K A;  2J3T D;  3ZDJ A;  2W3E A;  1PW8 A;  3TSG A;  5DF8 A;  1PWC A;  4R1G A;  3VP4 A;  2WAE A;  3SS5 A;  5HAP A;  1JTG A;  2WYX A;  2Y2L A;  3C8C A;  2V2F F;  3KSI A;  3U5V A;  4KZA A;  3M6B A;  2XD5 A;  1UGU A;  1NLW A;  1D1J A;  3GSG A;  3LEQ A;  1OPX A;  1PFL A;  1TF1 A;  2OAQ 1;  3Q07 A;  3LY3 A;  4KZ5 A;  4GJ4 A;  5CXW A;  2W1R A;  3Q7V A;  1YQS A;  4HJ6 A;  3VP1 A;  3S7Q A;  1BYW A;  4E3L A;  3F1N B;  3UB7 A;  1K54 C;  4ETX A;  3G32 A;  1V9Y A;  2Q9N A;  4A5R A;  4E3M A;  1KVM A;  4E6W A;  3IF6 A;  5KSH A;  1CJF A;  3MQO A;  2WUQ A;  3IF6 C;  3WS1 A;  4X25 A;  2C6W B;  2V20 A;  3H82 A;  3G30 A;  1KE4 A;  4I3J A;  2JKT I;  5HAR A;  3JVU A;  4HH2 A;  4HES A;  5FDS A;  1ES4 A;  1NXY A;  3PBT A;  1NYM A;  4DN0 A;  3UDI A;  5HAQ A;  2VX8 A;  4EQI A;  3N8R A;  4LEN A;  5DJT A;  1W8Y A;  2WKH A;  5E2F A;  1RGZ A;  1F2K A;  4XXR A;  1T1B A;  2V1Z A;  4JLF A;  4WYY A;  4U0T A;  4B88 A;  1PZO A;  3CHW P;  4UA7 A;  3SW1 A;  1BLP A;  2QL2 A;  3LUQ A;  1L0E A;  2J3T C;  1OJ5 A;  2Y2G A;  2UWX A;  4EET B;  5FEF A;  3ITB A;  4N1X A;  3NUL A;  4B4X A;  3OZH A;  3OPR A;  3WRZ A;  3MZF A;  3A0R A;  2HDQ A;  1ZHH B;  5FI2 A;  3IH9 A;  3ZG8 B;  4ARZ B;  3LO7 A;  3UME A;  3LI9 A;  5I50 A;  5EUA A;  3UE1 A;  1MKM A;  3ZG0 A;  4FD8 A;  2YKF A;  5HZH A;  4F94 A;  3HLC A;  4S2J A;  3HLW A;  2FFF B;  4HJ4 A;  5HD5 A;  2QMI A;  3FKV A;  3GQZ A;  4BMW A;  3ZG5 A;  3BM6 A;  4R23 A;  2J9P A;  2YPB A;  1IEM A;  2EX6 A;  1U60 A;  4MNR A;  4QB8 A;  5EVI B;  1XXM A;  1IOU A;  2E8J A;  1AWI A;  2OWJ A;  2XGN A;  2J3W A;  3F1P B;  4KZ7 A;  1GHP A;  4MN7 A;  4ESP A;  2BTF P;  2P9V A;  3E4O A;  2W3F A;  1KGG A;  1IYO A;  1FSY A;  1A0K A;  4CLC A;  4QHC A;  2XH9 A;  3M2K A;  2HP5 A;  1TS0 A;  2W27 A;  4DE2 A;  3N4I A;  5JYO A;  2ZBB A;  4P6Z S;  4LV0 A;  3ZNY A;  3PXP A;  3DBA A;  1XA1 A;  3GR2 A;  4XUZ A;  4PKY A;  4OQ0 A;  4Y5F A;  4R6L A;  4DXB A;  1UKL C;  4YWZ A;  4E3I A;  4P87 A;  3HLF A;  3FPV A;  4NXG A;  5F68 A;  3LFV A;  3MJQ A;  4G3V A;  2VK3 A;  4BBU A;  5HDC A;  1IYQ A;  4UHU A;  3T1X A;  2XRO A;  1Z6F A;  4P6B A;  4BQM A;  3OPH A;  4EBP A;  3H7W A;  4NXF A;  1LL9 A;  3WS5 A;  3P09 A;  3C7U A;  3E4P A;  1NWZ A;  1ERQ A;  2HDR A;  3K3C A;  3IXB A;  3SH7 A;  3VFF A;  3D4F A;  4WLA A;  5FL3 A;  3MQQ A;  3HLB A;  1AXB A;  1L0D A;  5J4E A;  1R05 A;  2I72 A;  1Y4O A;  3CG5 A;  1K54 A;  3T4S A;  2GDN A;  4N1H A;  1YMX A;  2X01 A;  3PBQ A;  1KGE A;  3WS2 A;  4OLD A;  3LIE A;  1YLW A;  2V8F A;  3A0S A;  3T4T A;  1PIO A;  1RGY A;  3IXG A;  3BEB A;  1ES5 A;  5CER A;  1PYY A;  2QL2 B;  5TFQ A;  1CI9 A;  5A8B A;  1F98 A;  2OSU A;  4EUV A;  1NZO A;  5GHY A;  4X55 A;  4RQ9 A;  1FIK A;  1I2S A;  1K55 A;  2J80 A;  3DW0 A;  4MN5 A;  2W1T B;  4IHQ A;  2CC1 A;  1UWN X;  4ZBE A;  3A0V A;  5F5Y A;  4JGQ A;  4QWO A;  1MWT A;  2OOL A;  2WKI A;  2JKR M;  5TGF A;  3UMD A;  2DCF A;  4EBN A;  5A91 A;  1SDE A;  3P7N A;  3K2N A;  1CI8 A;  5CHJ A;  4WBG A;  2JKF A;  4H6J A;  3BFD A;  5TBM B;  4EES A;  4CPK A;  3SZT A;  4R3A A;  3CWF A;  3UO9 A;  3AGD A;  2PHY A;  4I39 A;  3AGF A;  3PAG A;  4E04 A;  1STZ A;  4WM9 A;  4S2O A;  3NCK A;  5EEC A;  3E2K A;  3IBR A;  3C7V A;  4ATK A;  2A3U A;  3BQA A;  3WS0 A;  3JVV A;  3UDX A;  1NJ4 A;  2PRF A;  3R4K A;  4IBX A;  1TDG A;  1YM1 A;  4JPM A;  3TRC A;  4PM6 A;  1VEU B;  4JF5 A;  1IYS A;  3MFD A;  3ZYT A;  3IBJ A;  4C75 A;  3SH8 A;  5K5B A;  2VA0 A;  4DRT A;  5EVI D;  1I2W A;  3LY4 A;  4GB7 A;  2Q0O A;  4WN5 A;  3A3F A;  4HOI A;  4JGR A;  5CHM A;  5CED A;  4KZ9 A;  1KVL A;  2YPA A;  5D3O A;  4WEJ A;  3PAE A;  1YAX A;  4I3A A;  1TD5 A;  4BLM A;  1VQQ A;  1DRM A;  2G2W A;  1CK3 A;  4JXG A;  2DMW A;  3NJA A;  4BBV A;  1K38 A;  3VOL A;  3CI6 A;  5FA7 A;  3UN7 A;  2HF6 A;  5FAT A;  2JHE A;  1LLB A;  3MF0 A;  4OP8 A;  1MBL A;  2HJE A;  2PBD P;  5MC7 A;  5L07 A;  3DWZ A;  4KZ8 A;  4Z1W A;  1MXO A;  1W7F A;  3EWK A;  4P6Z M;  5FQ9 A;  2IA2 A;  4M4X A;  3S7N A;  4HHD A;  2JN7 A;  3LIA A;  1A0A A;  2VV8 A;  1XGJ A;  3CZD A;  2L1M A;  4CLC B;  4JXW A;  3RH8 B;  1DJB A;  3EEA A;  3UE0 A;  1GSV A;  1PI4 A;  3NC8 A;  2K7S A;  1PW1 A;  4R4S A;  2PD7 A;  4GW9 A;  4PAU A;  3EGD C;  1K25 A;  1Q2Q A;  4ID4 A;  2H0Y A;  5HPF A;  4P85 A;  4I38 A;  5FAP A;  2Y2K A;  1EWZ A;  2LFH A;  1D06 A;  5EVI C;  4LRZ E;  5F82 A;  1UWP X;  4BL2 A;  2D02 A;  3PBO A;  4MMN A;  5I5L A;  5GHZ A;  1LT0 A;  5E43 A;  1IKG A;  4LRX C;  4UAA A;  2XRN A;  2B5R A;  3RXX A;  2XD1 A;  2QZ6 A;  2H10 A;  4R4R A;  4IBR A;  4BWI A;  4NET A;  3F1O A;  2Y79 A;  2XSS A;  3S7P A;  1E3U A;  1O07 A;  1P97 A;  5J8X A;  1HZO A;  4PHT A;  1PRQ A;  1M40 A;  1E4D A;  4ME4 A;  4X1M A;  4GDN A;  4HP9 A;  1PI5 A;  3OOV A;  3NDG A;  3T4O A;  3ZGA B;  5IT5 A;  2AVX A;  1D7E A;  4EUZ A;  2G7U A;  3N7W A;  4OQG A;  4JGP A;  2QYB A;  4OLG A;  1TS7 A;  4NXB A;  1FSW A;  1S4S A;  1NRJ A;  3C38 A;  1G68 A;  2WGW A;  4NK3 A;  2W1T A;  4JXS A;  2M7U A;  2VGJ A;  3LYX A;  3HLD A;  4BD1 A;  3LIF A;  3LGO A;  1CEG A;  5HWV A;  2O9B A;  2JKR I;  3D72 A;  2VJW A;  5E2E A;  3IX3 A;  2Y91 A;  2PR5 A;  4LRY C;  1FR1 A;  3OPL A;  3G34 A;  5DKL A;  3O88 A;  1ALQ A;  1K0K A;  2G2U A;  2P9V B;  1OME A;  4EBL A;  5FQK A;  1LSX A;  2PR6 A;  2JE5 A;  4S2N C;  4WL9 A;  3S22 A;  1KOU A;  1Z09 A;  2VV7 A;  5CGS A;  1GCE A;  3EGX C;  3GRJ A;  4IUH A;  2QJ5 A;  2PYP A;  1AN4 A;  3VE4 A;  3Q82 A;  3B47 A;  3PR6 A;  3MUJ A;  4Q0I A;  2ZC5 B;  3NI9 A;  1XJ2 A;  4FCF A;  4KQR A;  4F3L A;  1F9I A;  5EOE A;  5L8M A;  1SDN A;  3MS6 A;  3QP2 A;  1ONH A;  1S1Y A;  4AFI A;  3VOY A;  1H8Y A;  3C4P A;  3QP1 A;  1YSP A;  4EU0 A;  2VGL S;  1KGF A;  4XT2 A;  5FAS A;  3WRT A;  1NLY A;  2GX5 A;  3UB6 A;  3WS4 A;  3MBZ A;  5IHV A;  2Z6D A;  1TS8 A;  4GKU A;  2HJ9 C;  3FV7 A;  4DJ3 A;  1J9M A;  5J3W A;  3SS3 A;  2WGW B;  1N9N A;  3V50 A;  4GD8 A;  1XFQ A;  1K57 A;  1S0W A;  3D3O A;  4OP5 A;  3KSF A;  5GLC A;  3OLO A;  2KDK A;  4Y0U A;  4II7 A;  1K57 C;  3VOZ A;  2V0U A;  4O7D A;  1NKP B;  1FOF A;  5A90 A;  1BTL A;  4HQA A;  1W79 A;  1XX2 A;  4OON A;  5TJJ A;  1BT5 A;  5FSR A;  4U3T A;  2EWW A;  2KOI A;  4U0X A;  3QP8 A;  2NUT C;  3CIT A;  3UPP A;  1TEM A;  2Y2O A;  3MMH A;  1IEL A;  4K08 A;  4DKI A;  4ZJ1 A;  2ZQD A;  3OBF A;  3C30 A;  1ZC2 A;  5DFX A;  3LR3 A;  1DJA A;  1PZP A;  1E3U D;  2O9A A;  4K91 A;  1N4O A;  3S7O A;  2Y2P A;  1VET A;  2KLI A;  4ZAM A;  3CUE A;  2PAV P;  3DTM A;  3CLO A;  3ZCZ A;  1WA9 A;  1XP4 A;  3R7W B;  2HP9 A;  3ZNT A;  4UA6 A;  4N9K A;  4OVD A;  4JBF A;  1ESI A;  3L7H A;  5FEG A;  4O01 A;  4HP4 A;  3IX4 A;  2Y2Q A;  4EW7 A;  5I4Z A;  2VEA A;  1S6R A;  5KIZ A;  4WZ5 A;  2P7J A;  2HGV A;  1CQA A;  2XA7 M;  3DWK A;  3N8S A;  4Y13 A;  1PNE A;  5KMW A;  3FC7 A;  1G6O A;  1KDW A;  3CUE C;  1SKF A;  3K3D A;  3OCN A;  3NY4 A;  4L0L A;  1MZU A;  5EM1 A;  2QPN A;  4HY8 A;  4UQI S;  1ES2 A;  1ODV A;  1K56 A;  4S2N A;  3CJM A;  4R70 A;  3KYE A;  1MC0 A;  2KX6 A;  1L3L A;  2B18 A;  4UEY A;  3C5A A;  3KX0 X;  1OT6 A;  3GMW A;  4E3N A;  1GSW A;  5HW3 A;  5HL1 A;  4FOF A;  3UB8 A;  3W4O A;  4NEE D;  4L9F A;  3E98 A;  4EXO A;  2Y2H A;  4HJ3 A;  4PM8 A;  3VSK A;  1JNU A;  5HDD A;  3B3X A;  3VP2 A;  4JXV A;  2ZQ8 A;  5I94 A;  5FAO A;  5AQA A;  3G2Y A;  4N9L A;  2YPA B;  2P74 A;  1V9Z A;  2LB9 A;  5FQJ A;  3BQ8 A;  4PM5 A;  2XK1 A;  4JKT A;  1H5X A;  4GHI A;  4IJG A;  4F3L B;  1Y54 A;  3V3R A;  4C3Q A;  4EV4 A;  4DF6 A;  5M18 A;  3P01 A;  1YKD A;  1KE0 A;  5CHU A;  3SH9 A;  1S67 L;  3DTI A;  1NLZ A;  2GNX A;  4OOM A;  5M1A A;  1S4R A;  1ERO A;  3UB5 P;  1DJC A;  4LCL A;  4JF4 A;  5AVE A;  3TG9 A;  2UV0 E;  3JYI A;  1GA0 A;  1JWP A;  3T1S A;  5EOO A;  2EXA A;  1YMS A;  4I3I A;  1DP8 A;  3FWL A;  2ZM2 A;  2JBF A;  5FQI A;  5CEB A;  2ZOH A;  4XUX A;  3V5M A;  5DKK A;  2PD8 A;  5HAI A;  2W3H A;  1G28 A;  4KZ6 A;  1VHM A;  2QHK A;  4G3W A;  3MXR A;  4X6T A;  2Y2M A;  1VEU A;  1WYB A;  2HPB A;  2VGL M;  5L2F A;  4RVA A;  5F1F A;  4GN2 A;  2ZC6 B;  1TVF A;  1PWG A;  2XDM A;  2ZC4 B;  2A24 A;  3VFH A;  3I7J A;  4KG6 A;  3ITA A;  3U4L P;  2Y2J A;  3QNC A;  3TW8 A;  3MZD A;  3HCY A;  5HWW A;  5CGW A;  5JYP A;  5J7E A;  1XA7 A;  3E0Y A;  5AQB A;  1YLY A;  1YLT A;  2IWC A;  5GL9 A;  3WWX A;  5A93 A;  1HLO A;  5HD3 A;  2Y2N A;  4FH4 A;  3VP3 A;  1IFQ A;  2PDR A;  4OPR A;  4R38 A;  1LSW A;  4KUO A;  4MBF A;  2EFX A;  4H6J B;  4PM7 A;  4YIN A;  3BWL A;  3BLS A;  4NG2 A;  3DTK A;  5F1G A;  3V39 A;  3FYZ A;  2GZA A;  4K0X A;  1MY8 A;  1OJG A;  3ISG A;  4X56 A;  4OOL A;  3IHB A;  2L4R A;  4IED A;  2ZD8 A;  4ATI A;  1HD8 A;  2ZL1 A;  3VMA A;  2Y55 A;  3AGE A;  5FI7 A;  3C2W A;  1SHV A;  2Z6C A;  3F1O B;  1W8Q A;  2QWS A;  1OT9 A;  2X02 A;  2MH3 A;  3NBL A;  4DDS A;  2WAF A;  5TR7 A;  2WKQ A;  3IXH A;  2EX2 A;  3IH8 A;  2Z2L B;  1QMF A;  2XLN A;  3G31 A;  1F5M A;  2R78 A;  5EM0 A;  4B4Z A;  3ZFZ A;  2ZJ9 A;  4B93 A;  3QP4 A;  3IS2 A;  4S2P A;  4E3K A;  3M2J A;  3A3E A;  3BYD A;  1H3Q A;  3MKE A;  4DE0 A;  5KSC A;  4ARZ A;  3MR0 A;  4MEZ A;  2ZC7 A;  1GSX A;  4KG5 A;  2L0W A;  4YFM A;  4B9O A;  3W8K A;  4CLC E;  3IT9 A;  4HH3 A;  3NDE A;  4EER A;  1FCO A;  3KSG A;  4E6X A;  1VET B;  2HP6 A;  4H10 B;  5HSQ A;  2V0W A;  3QNB A;  4WMC A;  3KO6 A;  2DRW A;  2FFY A;  1OTD A;  1HLU P;  3Q7Z A;  5G4Y A;  1MDY B;  5IU1 A;  1NZU A;  2ZM8 A;  1ZKJ A;  3T4L A;  5FI6 A;  5HPI A;  3HRE A;  5DTS A;  1W63 Q;  1Y28 A;  4Q0J A;  1W5D A;  4Y15 A;  4QU3 A;  1SCW A;  2A49 A;  2WKP A;  2X71 A;  3SOI A;  1LHY A;  2ZL1 B;  4P0M A;  5DVA A;  1MPL A;  1K55 C;  4Q0H A;  2M1C A;  3P98 A;  5GHX A;  3TOI A;  1YT4 A;  5HL6 A;  3HVF A;  4KG2 A;  2W0N A;  2Y8H A;  2Q9M A;  4FSF A;  1OTE A;  1T18 A;  4MCW A;  3S4X A;  5FAQ A;  3LIC A;  3ZQ5 A;  3T12 B;  4MLL A;  4KZ4 A;  1I5Q A;  1FIL A;  3W2Z A;  2B02 A;  3PHY A;  4QY5 A;  4S2M A;  3H9W A;  4R3J A;  1Q2P A;  1LL5 A;  2C5W B;  2ZQ7 A;  3GVB A;  1K6S A;  4K0W A;  4WF0 A;  2EA9 A;  5CTM A;  2ZMV A;  3BFC A;  3NOP C;  3CPT A;  4EWF A;  1X0O A;  2A24 B;  1AM9 A;  1JVJ A;  1N9O A;  3BY8 A;  4S2K A;  3NIA A;  3SS4 A;  5DTT A;  3O3V A;  3TJZ C;  2PBY A;  4ATH A;  3MFX A;  2JKG A;  4KQD A;  2CMN A;  1H8M A;  4D2O A;  2O9C A;  1LI0 A;  2HV1 A;  3A3J A;  4OPQ A;  2H28 A;  1K4E A;  5CX7 A;  4ZJ2 A;  5AQ7 A;  1OTA A;  4X53 A;  4GS9 A;  5HX9 A;  2Y59 A;  3EEH A;  4LFU A;  3BFE A;  1VB6 A;  4L9G A;  2Z2M B;  1GA9 A;  3BFG A;  4LPZ A;  4H8R A;  3HBR A;  3JPU A;  3U2A A;  1YSQ A;  4WZ4 A;  5EVL A;  2DNS A;  2ZMA A;  1H0M A;  3LEZ A;  4EEU A;  4ZRR A;  1FCM A;  3QP6 A;  1EI5 A;  2OV5 A;  3M6H A;  3O86 A;  1YLP A;  4HIA A;  1RP5 A;  3FZC A;  1S1Z A;  4OQI A;  1T1C A;  3H82 B;  4QPR A;  4H10 A;  3O5Y A;  4DE1 A;  4HEF A;  5FDH A;  2ACG A;  4LCM A;  5G18 A;  2HDU A;  5DF9 A;  5DF7 A;  4GDB A;  4Y17 A;  5DFY A;  3PBR A;  3GDI A;  2VKS A;  2QKP A;  4KQO A;  3IXD A;  2A2L A;  3N6I A;  1K1F A;  3F1N A;  1NRF A;  2J9O A;  4QY6 A;  4WUJ A;  3Q7V B;  4S2I A;  2PU2 A;  1P9R A;  1L2S A;  4ZDX A;  1AN2 A;  4EEP A;  3H7W B;  3LR5 A;  3RJU A;  1H8Z A;  4LV2 A;  4EQ1 A;  2VV6 A;  3BRM A;  2WAD A;  4DXC A;  4WEL A;  1HVB A;  2B95 A;  3HUO A;  4UQI M;  2INW A;  5AVF A;  2P04 A;  2PYR A;  2WK0 A;  4LV1 A;  5E2G A;  3DTE A;  3LCE A;  1T1A A;  3O87 A;  1FR6 A;  4MDZ A;  3Q1F A;  2O99 A;  1BSG A;  4CLC C;  1MKI A;  3TE8 A;  3BFF A;  1WYC A;  4GCZ A;  2V9A A;  5GLB A;  1WE4 A;  3FG8 A;  1JWZ A;  3VV4 A;  5IS1 A;  3N8L A;  5G4Z A;  4HBT A;  4HNB A;  4C6Y A;  3IWQ A;  3T1Q B;  5FQM A;  4N92 A;  1XKZ A;  1P9W A;  4BD0 A;  2XQZ A;  2ZM0 A;  3Q81 A;  3FKW A;  2XA7 S;  2ZQC A;  3CAX A;  4RX2 A;  2V1A A;  4KQQ A;  4OPY A;  4HBU A;  1W63 M;  4IUK A;  4L9E A;  4Y7P A;  2H0T A;  5CRF A;  3LR0 A;  2W3G A;  2D01 A;  5EVI A;  1DP9 A;  3UE6 A;  3D9Y A;  3BLM A;  2M7V A;  2J8Y A;  2V1B A;  3G4P A;  3MKF A;  3ICY A;  5AQ9 A;  2MJ6 A;  3IX8 A;  4BBT A;  1BZA A;  1DY6 A;  3BY9 A;  4QJG A;  4OOY A;  1JWV A;  2V8C A;  3LR4 A;  4ZJ3 A;  4ZTK A;  4PPR A;  5A92 A;  3VSL A;  2JC7 A;  1YLJ A;  5LBR A;  1TDL A;  1XPB A;  3IHA A;  4CQH A;  4I5S A;  3GV9 A;  1CF0 A;  1LI9 A;  3EOI A;  1MDY A;  3HLG A;  2XEP A;  4CJN A;  1OTB A;  5F69 A;  3W4Q A;  4D60 A;  4S2L A;  2WKR A;  4KZ3 A;  2PU4 A;  2WGI A;  1NLW B;  2E8I A;  4CLC D;  3HUN A;  4KUK A;  2WZZ A;  3HJI A;  4PKY G;  3ZVW A;  4Y0O A;  5EE8 A;  5EYO A;  3T1R A;  2ZQ9 A;  4R0Q A;  2QJ7 A;  3HL9 A;  2EX9 A;  3IS2 B;  4E3J A;  1GHI A;  3V67 A;  2HDS A;  2BAS A;  3T4J A;  3LIB A;  3MSH A;  2H5S A;  1CEF A;  5U47 A;  2WGV A;  3HLE A;  2FH5 A;  3DAV A;  1NKP A;  3KYZ A;  5EVE A;  5F83 A;  3NOT C;  5HFO A;  4PMA A;  1P0Z A;  4GHI B;  1XJ6 A;  2BLS A;  1C3B A;  3OC2 A;  3NEC A;  1BLS A;  3E2L A;  1K6R A;  3E4Q A;  2OAP 1;  3PYP A;  4GNU A;  4BJP A;  1SZV A;  4YOF A;  3KSH A;  1MWU A;  3MZE A;  3UPN A;  2RCX A;  4YNR A;  2ZQA A;  5GLD A;  2RL3 A;  3G6O A;  1ACF A;  3OPP A;  2EX8 A;  1ESU A;  1GHM A;  3IWI A;  3S1Y A;  4BL3 A;  5C5K A;  1ZG4 A;  4DMZ A;  5EV0 A;  1G5U A;  5E2H A;  3NHQ A;  1LSV A;  3B33 A;  3IQA A;  3LID A;  1T19 A;  1XJ3 A;  3ULF A;  2WZX A;  1J3W A;  3MQ0 A;  4LLO B;  1FQG A;  4X1L A;  2ZC3 B;  2VZW A;  1RCJ A;  4M3K A;  3BW6 A;  1N9L A;  5F6A A;  1PWD A;  4O8G A;  5CTN A;  3A3D A;  1L0G A;  4OPZ A;  3GTC A;  3BJN A;  1JTD A;  1MWS A;  2LB5 A;  5EPH A;  1BLH A;  4WEK A;  4PM9 A;  3G35 A;  4Q8I A;  2O0Y A;  4X69 A;  3UDF A;  1IYP A;  1IKI A;  3GEC A;  3PTE A;  5EFW A;  4WMC D;  2XFT A;  1E25 A;  4JGO A;  2XF3 A;  2BG1 A;  1HTZ A;  1EW0 A;  5BOH A;  5DTK A;  3FPW A;  2EWV A;  3OCL A;  1LL8 A;  4ETZ A;  3R7W A;  4JF6 A;  2Y4A A;  3ZG9 B;  1ZTU A;  3ZVT A;  2J7V A;  3UPO A;  1MWR A;  3KYQ A;  3C4O A;  3ZG7 B;  3HUM A;  3T4K A;  4LV3 A;  4GLQ A;  5TBM A;  1KE3 A;  4R3B A;  2K2N A;  5HWT A;  2IWB A;  4FUW A;  3IWO A;  3B42 A;  1ES3 A;  2W3D A;  5GLA A;  1FCN A;  1NYY A;  1XJ4 A;  3T4Q A;  2ZLY A;  4RYE A;  2VLG A;  3F1P A;  2PT7 A;  2OLU A;  1DP6 A;  3QP5 A;  3MXS A;  3PBN A;  4Y2F A;  1K56 D;  2XR0 A;  4GOG A;  3UY6 A;  2HZ5 A;  5L09 A;  1N9B A;  5HDS A;  5AJG A;  4DE3 A;  3EQV A;  4DDY A;  2ZOI A;  3UB9 A;  4UA9 A;  1YLZ A;  1BLC A;  2XFS A;  3L9K A;  4FH2 A;  2ZMF A;  4GD6 A;  1ONG A;  2EXB A;  3T50 A;  2GJ3 A;  3MXQ A;  4QD4 A;  4X68 A;  1XFN A;  3HJK A;  1OTI A;  4NKP A;  4LGW A;  1G6A A;  2EFU A;  3RFB A;  2K31 A;  3W4P A;  4OH0 A;  2OLV A;  4NXE A;  2FZ0 A; 
#chains in the Genus database with same CATH homology
 3K2N A;  2HGV A;  4G3K A;  2XA7 M;  4H6J A;  3NOU C;  1S1Z A;  1T1C A;  4EES A;  5TBM B;  3RTY A;  3H82 B;  4QPR A;  4H10 A;  3O5Y A;  4R3A A;  3FC7 A;  3CWF A;  1G6O A;  3CUE C;  1S66 L;  3K3D A;  3OCN A;  4L0L A;  1MZU A;  2PHY A;  4I39 A;  4Y3I A;  4HY8 A;  4E04 A;  4UQI S;  1STZ A;  5DF9 A;  1ODV A;  5DFY A;  3IBR A;  3PBR A;  3GDI A;  2VKS A;  2QKP A;  4KQO A;  4R70 A;  2A2L A;  1MC0 A;  2KX6 A;  4O0P A;  4ATK A;  2B18 A;  4UEY A;  3BQA A;  3KX0 X;  1OT6 A;  2P08 A;  3JVV A;  3F1N A;  3VE3 A;  1GSW A;  3R4K A;  4FOF A;  3UB8 A;  4NEE D;  4L9F A;  4WUJ A;  4GS9 B;  1P9R A;  3E98 A;  4EXO A;  1AN2 A;  3PBS A;  4HJ3 A;  3LI8 A;  4EEP A;  3H7W B;  3LR5 A;  4EQ1 A;  3TRC A;  1JNU A;  5HDD A;  2VV6 A;  4WEL A;  2OWH A;  3ZYT A;  3IBJ A;  4UQI M;  2YKH A;  4XT2 B;  2INW A;  5K5B A;  5AVF A;  2VA0 A;  2YPA B;  2P04 A;  2PYR A;  4AYA A;  1T1A A;  4DJ2 A;  1V9Z A;  2LB9 A;  3BQ8 A;  5DJU A;  1TS6 A;  4WN5 A;  4MN6 A;  4MDZ A;  4HOI A;  4JGR A;  2JKT M;  2O99 A;  4CLC C;  4GHI A;  4IJG A;  4HI4 A;  4F3L B;  3TE8 A;  2I9V A;  4GCZ A;  2V9A A;  1YKD A;  3P01 A;  2YPA A;  3FG8 A;  4WEJ A;  1S67 L;  2NUP C;  1NLZ A;  1YAX A;  3VV4 A;  4I3A A;  1TD5 A;  5IS1 A;  5G4Z A;  4HNB A;  2GNX A;  4OOM A;  3UE3 A;  1DRM A;  1S4R A;  3EQU A;  2YPB B;  5AVE A;  1P9W A;  2DMW A;  2J3T D;  3NJA A;  2W3E A;  4BBV A;  2XA7 S;  3VOL A;  3CAX A;  2FZ0 A;  2V1A A;  3CI6 A;  4I3I A;  1DP8 A;  1W63 M;  2HF6 A;  2JHE A;  3MF0 A;  3C8C A;  4IUK A;  2ZOH A;  3KSI A;  4L9E A;  3U5V A;  2HJE A;  5DKK A;  2PD8 A;  2W3G A;  3LR0 A;  5MC7 A;  2W3H A;  1G28 A;  2D01 A;  1DP9 A;  4Z1W A;  3UE6 A;  1UGU A;  1NLW A;  1VHM A;  2QHK A;  4G3W A;  3EWK A;  4P6Z M;  1OPX A;  2M7V A;  1TF1 A;  2IA2 A;  4M4X A;  2OAQ 1;  2V1B A;  3S7N A;  3ICY A;  2VGL M;  4HHD A;  2JN7 A;  2MJ6 A;  3LIA A;  2VV8 A;  1A0A A;  4BBT A;  4GJ4 A;  3BY9 A;  2A24 A;  2W1R A;  4HJ6 A;  3S7Q A;  1BYW A;  3TW8 A;  2L1M A;  3F1N B;  3UB7 A;  4CLC B;  3HCY A;  3RH8 B;  5HWW A;  3EEA A;  5J7E A;  3E0Y A;  3LR4 A;  1GSV A;  4ETX A;  1V9Y A;  2K7S A;  2PD7 A;  4GW9 A;  1HLO A;  4PAU A;  5HD3 A;  3EGD C;  5KSH A;  5LBR A;  3MQO A;  1IFQ A;  2PDR A;  4CQH A;  4I5S A;  4R38 A;  1LSW A;  4KUO A;  5HPF A;  4I38 A;  3EOI A;  1MDY A;  3H82 A;  2LFH A;  4H6J B;  1D06 A;  4I3J A;  3BWL A;  4LRZ E;  1OTB A;  5F69 A;  1UWP X;  2JKT I;  2WKR A;  2D02 A;  3PBO A;  4MMN A;  3JVU A;  5I5L A;  1LT0 A;  4HH2 A;  1NLW B;  4LRX C;  2GZA A;  3PBT A;  1OJG A;  2XRN A;  4DN0 A;  4CLC D;  4KUK A;  4OOL A;  2L4R A;  2VX8 A;  4ATI A;  3HJI A;  4PKY G;  3C2W A;  5DJT A;  2Z6C A;  3F1O B;  5EYO A;  4BWI A;  3F1O A;  2Y79 A;  2QWS A;  1OT9 A;  2XSS A;  3S7P A;  2MH3 A;  1P97 A;  1T1B A;  2QJ7 A;  2WKQ A;  3SW1 A;  4PHT A;  3IS2 B;  2QL2 A;  3V67 A;  4ME4 A;  3LUQ A;  2J3T C;  4HP9 A;  2BAS A;  1OJ5 A;  3OOV A;  4EET B;  1F5M A;  3T4J A;  3LIB A;  3T4O A;  2R78 A;  2FH5 A;  5IT5 A;  4B93 A;  1NKP A;  3IS2 A;  3KYZ A;  1D7E A;  2G7U A;  3A0R A;  4JGP A;  1ZHH B;  3NOT C;  1H3Q A;  2QYB A;  1P0Z A;  4GHI B;  1TS7 A;  4ARZ A;  4NXB A;  1XJ6 A;  3MR0 A;  3OC2 A;  4ARZ B;  1S4S A;  1GSX A;  1NRJ A;  2L0W A;  3UME A;  3C38 A;  3LI9 A;  4B9O A;  4CLC E;  3E4Q A;  3PYP A;  2OAP 1;  5I50 A;  4HH3 A;  4BJP A;  2W1T A;  4EER A;  4YOF A;  3KSH A;  3KSG A;  1MKM A;  2M7U A;  3LYX A;  2YKF A;  5HZH A;  3LIF A;  5HSQ A;  4H10 B;  4YNR A;  2V0W A;  5HWV A;  2O9B A;  3KO6 A;  4HJ4 A;  2JKR I;  5HD5 A;  3G6O A;  1OTD A;  3D72 A;  4BMW A;  2VJW A;  5G4Y A;  1MDY B;  5IU1 A;  2YPB A;  5C5K A;  2PR5 A;  3T4L A;  4DMZ A;  5HPI A;  4LRY C;  3NHQ A;  1W63 Q;  1LSV A;  3B33 A;  1Y28 A;  4Q0J A;  1IOU A;  2OWJ A;  5DKL A;  2J3W A;  3F1P B;  3LID A;  1T19 A;  2WKP A;  4MN7 A;  1XJ3 A;  3ULF A;  3E4O A;  3MQ0 A;  2W3F A;  4LLO B;  2VZW A;  3BW6 A;  1N9L A;  5F6A A;  1LSX A;  4CLC A;  4O8G A;  2PR6 A;  4Q0H A;  2M1C A;  4WL9 A;  3BJN A;  5HL6 A;  1KOU A;  2LB5 A;  1TS0 A;  2W0N A;  2VV7 A;  2W27 A;  2Y8H A;  2ZBB A;  4P6Z S;  4WEK A;  4FSF A;  3EGX C;  2O0Y A;  1OTE A;  1T18 A;  4IUH A;  4MCW A;  2QJ5 A;  3PXP A;  3DBA A;  2PYP A;  3GEC A;  3LIC A;  1AN4 A;  5EFW A;  3ZQ5 A;  4PKY A;  4JGO A;  4Y5F A;  4R6L A;  3VE4 A;  4NXE A;  3B47 A;  3W2Z A;  3PR6 A;  1UKL C;  3MUJ A;  4Q0I A;  4YWZ A;  2B02 A;  1EW0 A;  3FPV A;  3PHY A;  1XJ2 A;  3H9W A;  4F3L A;  1F9I A;  5L8M A;  3FPW A;  2EWV A;  3OCL A;  4NXG A;  1LL8 A;  4ETZ A;  3R7W A;  1ZTU A;  1S1Y A;  5F68 A;  4AFI A;  4WF0 A;  2EA9 A;  2ZMV A;  3KYQ A;  1YSP A;  3LFV A;  3MJQ A;  4G3V A;  4EU0 A;  4BBU A;  5HDC A;  2VGL S;  3T4K A;  3NOP C;  4GLQ A;  5TBM A;  4XT2 A;  1X0O A;  2A24 B;  2XRO A;  1NLY A;  2GX5 A;  3UB6 A;  3H7W A;  1AM9 A;  4NXF A;  1N9O A;  3BY8 A;  2Z6D A;  1TS8 A;  2K2N A;  2HJ9 C;  4DJ3 A;  5HWT A;  3E4P A;  3TJZ C;  5J3W A;  1NWZ A;  1N9N A;  4ATH A;  3MFX A;  1XFQ A;  3B42 A;  3K3C A;  3D3O A;  2W3D A;  4WLA A;  4KQD A;  5FL3 A;  2CMN A;  3KSF A;  3MQQ A;  3OLO A;  2KDK A;  1XJ4 A;  4II7 A;  5J4E A;  1R05 A;  3T4Q A;  1H8M A;  2V0U A;  2VLG A;  3F1P A;  2PT7 A;  2O9C A;  3T4S A;  1DP6 A;  1NKP B;  2HV1 A;  3PBN A;  4HQA A;  2H28 A;  3PBQ A;  4Y2F A;  5TJJ A;  5CX7 A;  2EWW A;  2KOI A;  3LIE A;  2NUT C;  3CIT A;  3MMH A;  4K08 A;  5HDS A;  1OTA A;  3A0S A;  5AJG A;  3T4T A;  3OBF A;  3C30 A;  4GS9 A;  3EQV A;  5DFX A;  2ZOI A;  3LR3 A;  2QL2 B;  3EEH A;  1VB6 A;  2O9A A;  3UB9 A;  5A8B A;  1F98 A;  3S7O A;  4L9G A;  4EUV A;  2KLI A;  3CUE A;  4RQ9 A;  4LPZ A;  2J80 A;  4MN5 A;  3CLO A;  2W1T B;  2ZMF A;  1WA9 A;  4IHQ A;  1UWN X;  3R7W B;  3T50 A;  3A0V A;  5F5Y A;  3U2A A;  1YSQ A;  3MXQ A;  2GJ3 A;  4JGQ A;  1XFN A;  2OOL A;  3HJK A;  1OTI A;  4NKP A;  2JKR M;  4O01 A;  4EEU A;  4ZRR A;  4HP4 A;  4EW7 A;  3UMD A;  5I4Z A;  2VEA A;  3RFB A;  2K31 A;  5KIZ A;  3P7N A;  4HIA A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...