4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/activator
molecule keywords BMAL1b
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
1KOUA 4WN5A 2YPBA 2HV1A 4MN6A 1LSVA 1VB6A 4H6JB 1S1ZA 1N9LA 2CMNA 4JGPA 4WLAA 1NLWA 2D01A 3NOTC 4JGOA 2D02A 3H7WB 3LIAA 1S4SA 1NWZA 4PKYA 5HD3A 2A24A 4R70A 5F69A 2PYPA 3H82A 2PR6A 1HLOA 1D7EA 3UB8A 3F1OB 5KIZA 5J7EA 5HSQA 4H10A 2B02A 1T18A 2V1AA 4I3JA 1OT9A 1TS0A 4NXFA 1P97A 3HJKA 3BWLA 3B33A 5J4EA 1T1AA 2YPAB 2ZOIA 2L4RA 1V9YA 2A24B 2PDRA 4HJ4A 1BYWA 3MJQA 2JHEA 4NXEA 2QWSA 4MN5A 2KDKA 2QKPA 4HJ6A 4I5SA 4KQDA 3GECA 4HIAA 4EW7A 3ULFA 3LIDA 1OTAA 4HQAA 2YKHA 4HNBA 2V0WA 3PYPA 4HY8A 5TBMB 3ICYA 4LPZA 2QHKA 3H7WA 2EA9A 2V1BA 4NXGA 1XJ6A 5HDSA 3E4QA 3CLOA 1GSXA 4B9OA 2PYRA 5EFWA 2WKQA 5HDCA 2MH3A 3VOLA 1EW0A 1A0AA 2KX6A 3A0SA 2VV8A 4LRYC 4XT2B 2H28A 4HP9A 4HP4A 4EXOA 4H6JA 3EEHA 5TBMA 1OJ5A 4ATKA 1MZUA 4GS9B 2YPBB 3RTYA 2LFHA 5HWTA 5HD5A 4YWZA 4F3LA 1ODVA 3LI9A 4R3AA 4I3AA 2VV7A 3MFXA 3NHQA 2PD8A 2ZBBA 3IBRA 2PHYA 1UWPX 3HJIA 1G28A 3NOUC 4BBUA 4AYAA 3BY8A 4BBVA 4L9EA 4EEUA 4HOIA 3MUJA 4XT2A 2K7SA 1XFNA 4EERA 1AM9A 1TS8A 1TS6A 4I38A 2M1CA 5F6AA 1DP8A 2QJ5A 4HH2A 2ZOHA 3UB7A 2QL2A 3E4OA 2R78A 3CWFA 2P7JA 1DP6A 5HZHA 4M4XA 5DKKA 3SW1A 3C8CA 1NKPA 3G6OA 3UMDA 5IS1A 4DJ2A 4EESA 5I4ZA 4JGRA 1XJ2A 1T1BA 3FG8A 3UB6A 4GHIB 1UKLC 2I9VA 4GW9A 1GSWA 1AN4A 3BY9A 1GSVA 4H10B 2J80A 4NXBA 3C2WA 4HI4A 3UE6A 1V9ZA 3LICA 2OWHA 4L9GA 2W0NA 3VE3A 3IS2B 3OLOA 1S4RA 2VLGA 3UB9A 1MDYA 1OTDA 4I39A 2L1MA 1OT6A 1T19A 1Y28A 1N9NA 3F1PB 1XJ3A 1JNUA 2INWA 3T50A 1T1CA 3D72A 1F9IA 1LL8A 3H9WA 4L9FA 1X0OA 3NJAA 5HWWA 5DJUA 3UMEA 5F5YA 4F3LB 1S67L 5HDDA 3P7NA 4LLOB 3VE4A 2W27A 4GHIA 1D06A 2Z6DA 3NOPC 2V0UA 5F68A 4EETB 4WUJA 4LRZE 1P0ZA 3GDIA 2PD7A 1UWNX 4R38A 2OOLA 2WKRA 4WL9A 4I3IA 4KUKA 1XJ4A 5DKLA 4HJ3A 1OJGA 1XFQA 3MXQA 5J3WA 5I5LA 1LSWA 4LRXC 2BASA 5I50A 2YKFA 4JGQA 4GS9A 4HHDA 1MDYB 3U5VA 1N9OA 3A0VA 3F1NB 1NKPB 3RH8B 2OWJA 4ATIA 3E4PA 2PR5A 1WA9A 3K3DA 3LUQA 5EYOA 1TS7A 2V9AA 4BBTA 4GCZA 1UGUA 4E04A 1S66L 1LSXA 2L0WA 1S1YA 4KUOA 4HH3A 3A0RA 1NLWB 3EWKA 3MQQA 2VEAA 2Z6CA 3LIEA 3LIBA 3FC7A 5HWVA 4ATHA 1DRMA 4PKYG 4RQ9A 3IS2A 3F1PA 1R05A 3F1OA 2WKPA 3ZQ5A 3MR0A 4EEPA 5DJTA 2QL2B 3LYXA 3H82B 2QJ7A 4K08A 5A8BA 2JN7A 1DP9A 3LIFA 3LI8A 1F98A 1OTIA 5IU1A 5G4YA 4R6LA 5AVEA 3MQOA 1OTBA 4DJ3A 5G4ZA 3PHYA 1LT0A 4EQ1A 1AN2A 1OTEA 3K3CA 5AVFA 3CAXA 3KX0X 3F1NA 2YPAA 2GJ3A 4WF0A 2VV6A
chains in the Genus database with same CATH superfamily
2YPBA 3MXSA 4EWFA 3O87A 4MN6A 4LFUA 3ZNTA 4H6JB 2P9VB 1YQSA 1ERQA 1YLZA 1KE0A 4YOFA 1CI8A 4JGPA 4PM8A 1NLWA 3IXHA 2OLUA 4PKYA 3BQAA 3WS2A 5EECA 3S7NA 1G68A 1HTZA 5L10A 4UQIM 4R70A 3LCEA 1NRFA 2O99A 1SZVA 4RX2A 4EUVA 2WKEA 3SS3A 1MC0A 2XH9A 3UB5P 3G30A 3ZG0A 3UB8A 3UE3A 1K4FA 4S2KA 4ZBEA 2ZQAA 2WGVA 3G2ZA 4C3QA 4BL3A 2OSUA 2V1AA 4I3JA 5CHMA 1DY6A 3R7WA 4QY5A 2MJ6A 3O86A 3MFDA 3LR4A 4NXFA 4FH2A 1GHPA 3HJKA 1W5DA 3O88A 1T1AA 3VP4A 4G3VA 2L4RA 4ETZA 1V9YA 2EFUA 2A24B 4CLCA 3MJQA 2QWSA 1Q2PA 4HIAA 5FASA 3Q07A 4KQQA 1OTAA 3BECA 4HQAA 2YKHA 3BQ8A 4QB8A 1ZZAA 1NZUA 4FUWA 4X69A 2I72A 3HLCA 4OQHA 4Y2FA 3DBAA 3D3OA 2XEPA 1S0WA 3AGEA 4NXGA 4ETXA 3HBRA 3SOIA 3QNBA 2PYRA 3MXRA 1E3UD 1P9RA 2XFTA 1YSQA 1E25A 3N8SA 3T1RA 2JBFA 3D4FA 2KX6A 4FTXA 5AQBA 1BLSA 2H0YA 4XT2B 1KE3A 5EOOA 3IH8A 5FI7A 2H28A 2OV5A 3MQ0A 4G3WA 1FILA 4HP4A 2G2WA 3UNWA 3LEZA 5TFQA 3KSIA 4RVAA 4ATKA 4GS9B 3TSGA 4O7DA 4OP8A 5HWTA 5CERA 5FAPA 4F3LA 1ODVA 3VP0A 4R3AA 3MFXA 5F1FA 1CJFA 4GD8A 3HJIA 1UWPX 3PBRA 4AYAA 1MWTA 2W1TB 4BBVA 1K1FA 2XSSA 3C7VA 2ACGA 4L9EA 4WMCD 4EEUA 4HOIA 4NEED 3MUJA 4XT2A 5FDHA 3K2NA 4GZBA 4EERA 4Q8IA 1ZKJA 3OBFA 2C6WB 1QMEA 3G31A 2M1CA 4ARZA 2QJ5A 4HH2A 3QHYA 4MNRA 3WS0A 2WZZA 1STZA 4FOFA 3T4SA 4P6ZS 4LENA 3CWFA 1K57C 2X02A 2BG1A 3IWOA 1SKOA 3V3SA 3OCNA 3FPVA 5DKKA 1AXBA 3SW1A 3S7PA 2ZJ9A 3PBSA 3C8CA 3GV9A 4Y13A 3G4PA 1J3WA 4CLCB 1NKPA 2WAEA 2XQZA 3UMDA 2PAVP 2WK0A 1NYMA 3Q7VB 3MZEA 3OPHA 2PU2A 3KYZA 3U2AA 3HUOA 4GW9A 4X1MA 1GSWA 1BULA 4KZAA 5L07A 1NLZA 3HLBA 3WS5A 1YSPA 2GX5A 3ZG9B 2HP6A 1ALQA 2J80A 4K0WA 4NXBA 4HBTA 2IWDA 2OWHA 3N6IA 1K6RA 4K0XA 5GL9A 3IS2B 3OLOA 1Y4OA 4PMAA 4I39A 1SDEA 1BLPA 5FI6A 2Y2HA 4NG2A 5LBRA 3BLSA 1XA7A 3CG5A 2INWA 2ZL1A 1RGZA 3T50A 2R9WA 1Y54A 3D72A 5FQMA 4OPZA 4E3IA 1SDNA 5EOEA 5C5KA 3UDXA 4L9FA 2VGLS 5HPIA 1I5QA 1JWPA 3KSGA 3UMEA 1MKMA 3IF6C 1S67L 4LV2A 3VE4A 4QPRA 1PWDA 1K55A 2Z6DA 1SKFA 3NECA 5HAPA 4UA6A 4N1HA 1NYYA 1KVMA 3PR6A 5BOHA 4FCFA 2VJWA 5EVIA 3GRJA 1XGIA 2CC1A 3V39A 3T1SA 4LCLA 3O3VA 4HJ3A 1XFQA 3MXQA 2K31A 4F94A 4LV0A 5DTTA 5I50A 5DF8A 1PNEA 4JGQA 1MDYB 2Y79A 4H8RA 3NULA 4S2JA 2OWJA 1L0DA 4ATIA 3FKVA 4EQIA 3UE0A 3BFFA 1WA9A 1ESUA 2WGIA 4B93A 3LUQA 2WYXA 5JYPA 4MN7A 1YAXA 1L0GA 3GSGA 4E04A 3BRMA 1LSXA 2W3FA 4QWOA 5DF9A 4KUOA 5FL3A 2Q0OA 2B95A 3VP2A 1NLWB 1HD8A 2R9XA 3SS5A 4ATHA 3A3JA 3OPPA 4RQ9A 3VP3A 1K54A 1R05A 4JLFA 1CF0A 3SH9A 1BZAA 4EEPA 3LYXA 3H82B 3G34A 3LIFA 3LR5A 1F98A 1OTIA 4OONA 5EVIC 3VFHA 4R6LA 1FR6A 2HDQA 3S22A 2HDUA 2ZM0A 1OTBA 5G4ZA 2O9BA 2VGJA 1OTEA 1DJBA 2E8JA 4R23A 2YPAA 4GNUA 1QMFA 3ITBA 1KOUA 1ZC2A 4WN5A 3ISGA 1XA1A 2ZC3B 2ZM2A 3O5YA 2EX2A 3VSKA 1VB6A 1VM1A 5EM1A 5D3OA 4KZ9A 1N9LA 3C7UA 3R7WB 5EVEA 3Q1FA 2CMNA 3PBQA 2ZQDA 3NOTC 2D02A 3LIAA 3PBOA 2W1TA 5HD3A 2G2UA 4DE0A 2Y55A 3QP5A 1NY0A 3LY4A 2Y2OA 3UO9A 4PHTA 2OLVA 1HLOA 3IHBA 1ACFA 2XFSA 1D7EA 5J7EA 5JYOA 2WGWA 1YM1A 4H10A 5A90A 3RFBA 2M7VA 1MBLA 2LB5A 2QZ6A 3UPNA 1TS0A 5HL1A 1P97A 3BJNA 4CLCC 3OCLA 2A49A 1LLBA 2PBDP 1LL5A 4LV3A 2KOIA 2JHEA 4PM5A 1ONGA 2G7UA 4Y15A 3GECA 4GB7A 1PZOA 4JPMA 5GHZA 1GHIA 3FKWA 2FFFB 3HREA 3DTKA 4Y5FA 3PYPA 4HY8A 2XROA 2LB9A 3ZNYA 4LPZA 5CHUA 5CGSA 3S1YA 2V1BA 5M1AA 1W79A 2VGKA 3FZCA 1H8YA 5FATA 1GSXA 2JKRM 4X53A 1WYCA 2IWCA 2EWWA 2MH3A 1YPRA 4OPYA 1BSGA 2A3UA 4LRYC 1IEMA 3HLEA 4CLCE 2V2FF 4MEZA 1L0EA 4MCWA 2ZQ7A 2HJ9C 5TBMA 2WUQA 4CPKA 4WEKA 2W3DA 2LFHA 4JKTA 2X01A 5HD5A 4IUKA 4I3AA 4MMNA 4A5RA 2ZBBA 3TRCA 3L9KA 3NOUC 5E2GA 5FEGA 3Q82A 2JKTI 5GHXA 1GCEA 3B47A 4CLCD 2PRFA 5CGWA 2K7SA 2Z2MB 1G5UA 3IX4A 1S6RA 1AM9A 1TS6A 1P9WA 4I38A 5EM0A 3MKFA 2DNSA 3HLWA 3BEBA 1KGEA 4NK3A 3G35A 4JBFA 3N7WA 4HBUA 3E4OA 5TGFA 2H5SA 4OOMA 1Q2QA 4WBGA 2Y91A 1XX2A 5GLBA 2XD1A 1DP6A 4XUZA 2Y2QA 4X55A 3C5AA 3EEAA 1YLJA 3JVUA 5IS1A 3VOZA 1F5MA 4EESA 5I4ZA 1KGGA 2ZC6B 3NCKA 1XJ2A 1T1BA 4OQGA 3SH8A 2XF3A 1N9BA 2M7UA 3VSLA 1IELA 5DFXA 4PPRA 3HUNA 3VP1A 3IBJA 4R3BA 4OQIA 3IXBA 5CXWA 1W63M 3MSHA 5GLCA 2ZD8A 1XKZA 4L9GA 5EVID 3E2LA 1XXMA 3DW0A 4DE3A 5IHVA 4OVDA 1RP5A 1FQGA 3ZGAB 3VE3A 2WKHA 1S4RA 3UB9A 5E2FA 4GDBA 1MDYA 4Q0IA 4KZ8A 4ZJ3A 1Z09A 3TG9A 2QYBA 4KZ7A 1OT6A 3NY4A 1KVLA 2HP5A 1Y28A 3LFVA 3F1PB 2C5WB 4Y0UA 2O9CA 1XJ3A 2Y2IA 4K91A 4PM7A 2JKGA 4ID4A 1H0MA 1T1CA 2ZMVA 5A91A 4R4RA 1F9IA 1KE4A 5F82A 5FQQA 3P98A 4IBXA 1W8QA 5FAOA 3W8KA 5F5YA 5EVLA 4KENB 2V8CA 5FI2A 4E3KA 4GHIA 3RXXA 5CX7A 4ZTKA 5G18A 3BYDA 1E3UA 5F68A 3FWLA 1WYBA 1P0ZA 2GZAA 2PD7A 5HFOA 4L0LA 2KLIA 2V8FA 2OOLA 1IYOA 1VETA 2WKRA 3DTIA 4P0MA 4DF6A 3MZDA 4UA9A 1XJ4A 5I5LA 1LSWA 4LRXC 2W3EA 2EXAA 4S2MA 2YKFA 1BT5A 1WE4A 4GD6A 2W3HA 3Q7VA 1AWIA 3Q7ZA 4E3NA 1XP4A 3DTEA 1NKPB 3WRTA 5FQ9A 2H10A 2PR5A 4ZJ1A 3EQUA 1L2SA 2OAP1 1TS7A 2V9AA 3UDIA 3S7OA 1UGUA 4IJGA 2EWVA 2VK3A 3T1QB 5U47A 1S66L 1TVFA 2UWXA 2HDSA 1PZPA 2JKFA 1G6AA 2WZXA 1PWGA 3EWKA 4QJGA 3C4OA 3FC7A 5F1GA 2PBYA 1J9MA 2Y2GA 5HWVA 4WMCA 1DRMA 1TDLA 2VA0A 4KG5A 5E2EA 3IT9A 3LEQA 3IS2A 3F1PA 4S2OA 4CJNA 3N8LA 2WKPA 3ZQ5A 5AQ7A 4K08A 5CRFA 3R4KA 1ZHHB 2ZMFA 3MBZA 1FIKA 1DP9A 3LI8A 1YLYA 4N9KA 2Q9NA 4OLGA 1PI4A 2EX8A 3IWIA 3ITAA 4KG6A 5DTKA 5E2HA 4R3JA 4DJ3A 3LO7A 1XGJA 3NIAA 4LCMA 3PHYA 1AN2A 2XA7S 3BM6A 4LV1A 4ZRRA 2GJ3A 2VV6A 2Y8HA 4RYEA 5HW3A 3BLMA 4OOYA 3JVVA 3T4QA 2UV0E 3IF5A 3IXGA 3WRZA 4Z9QA 3W4QA 2P74A 4UAAA 1MKIA 4JF6A 2O9AA 1PRQA 5TJJA 4BD1A 1NWZA 4S2NA 4R0QA 2A24A 3V50A 5TR7A 3OPRA 3M6HA 4DXBA 1BLHA 2PYPA 3H82A 1JWZA 1PWCA 4X56A 1NRJA 1KDSA 1PFLA 4O0PA 4NKPA 3RXWA 5HSQA 1LI0A 3NI9A 1CK3A 3CJMA 2E8IA 3W4PA 2Q9MA 2B02A 3UPPA 4C6YA 5FQIA 1BTLA 2X71A 3CITA 3DWKA 3ZG7B 1PYYA 3DWZA 1SKOB 1IFQA 3BWLA 3B33A 5KSCA 2Y2JA 3G32A 1O7EA 2A2LA 3IQAA 4DXCA 2GNXA 2ZOIA 5EV0A 3EQVA 1XPBA 2PDRA 4S2PA 1FOFA 4NXEA 3CI6A 2IA2A 3BFEA 1NJ4A 4I5SA 3WS1A 4DMZA 1W7FA 5A93A 3LIDA 4G3KA 4FSFA 5DF7A 3BFGA 2ZC5B 3E2KA 2K2NA 2Y2LA 1JTDA 3H7WA 2EA9A 4GJ4A 4EBLA 5CECA 3MMHA 5FQKA 5FSRA 4B9OA 4KZBA 2WKQA 5HDCA 3NDGA 1CQAA 3VOLA 1EW0A 1I2SA 1A0AA 4RA7A 4X68A 4Y7PA 2VV8A 1VQQA 1MWRA 3M6BA 3DTMA 4HP9A 1F2KA 4H6JA 4IBRA 3EEHA 4YNRA 1DJCA 2J9OA 2YPBB 3HCYA 3RTYA 1K57A 3A3DA 4XUXA 4YWZA 5L09A 3B3XA 3NHQA 2PD8A 4BBUA 1G28A 2Y2KA 3BY8A 4O8GA 4IHQA 4IVIA 1FSYA 2WADA 5F83A 4P87A 3LGOA 3NC8A 4U3TA 3EOIA 4HESA 3UE1A 3ZG5A 3A3IA 3MS6A 3NDEA 1TS8A 1ES5A 5FAQA 1KDWA 1VETB 3QP6A 4EUZA 1TEMA 3UB7A 4BD0A 2QL2A 1ZG6A 4OP5A 5GLAA 5I94A 2J3TD 2P7JA 4P6ZM 3CUEA 4M4XA 2EXBA 1G6OA 3G6OA 2XLNA 5CEDA 4DJ2A 2VX8A 1CEFA 2V1ZA 4JGRA 3GMWA 2FFYA 3FG8A 3UB6A 3T12B 1I2WA 4BLMA 3P01A 3FV7A 5M18A 1AN4A 3S7QA 1GSVA 3RJUA 1HVBA 1ONHA 2HJEA 1YT4A 1U60A 3LICA 3MKEA 3N8RA 5A92A 3C30A 2EFXA 3HL9A 4JXVA 1OTDA 3W4OA 2L1MA 5MC7A 1T19A 1FSWA 3U4LP 5HL6A 2ZC7A 1VEUA 1JNUA 3Q81A 3VFFA 5FA7A 2XD5A 3BFDA 5AQAA 2W1RA 1X0OA 3NJAA 1K6SA 4F3LB 3GTCA 2ZLYA 2FH5A 3AGDA 2W27A 3ZHHA 3OPLA 1E4DA 4QD4A 5FQJA 3ZVTA 4JXSA 2DRWA 3QP4A 1VEUB 2WKIA 4WUJA 1YKDA 4LRZE 3T4OA 4X25A 4EETB 4KZ6A 4WM9A 4YINA 1YMXA 1K56A 2VGLM 3GDIA 4R38A 3ZG8B 4NETA 3C4PA 2W3GA 2EX9A 2VZWA 4WL9A 4I3IA 1YLWA 1OJGA 2B18A 1W8YA 4U0TA 2RL3A 1N4OA 3DAVA 4KQOA 3N4IA 4ESPA 4GS9A 4OPRA 1SCWA 2BTFP 4GDNA 4PAUA 2QMIA 2J3WA 3E4PA 4IUHA 1EWZA 2XK1A 5IT5A 2ZC4B 5CGXA 1MWSA 2Y2NA 5EYOA 2JE5A 3VOYA 4GCZA 3T4KA 4WZ5A 3T4LA 1K38A 1BUEA 3OZHA 1VHMA 3AGFA 1TF1A 3MQQA 4WELA 4IEDA 4LGWA 3LIBA 3QNCA 4Z1WA 4R4SA 4PKYG 3PTEA 5CTMA 3KO6A 3MR0A 1IYPA 2AVXA 1FR1A 3TJZC 2DMWA 2Y4AA 3WS4A 3KYQA 3KYEA 5G4YA 3ZVWA 5L2FA 2J9PA 3G2YA 3NBLA 3MQOA 4KZ4A 1K0KA 4B4ZA 4EQ1A 2P9VA 1YMSA 4CQHA 3LR3A 5EE8A 3IX3A 3A3FA 4WF0A 1K56D 3TW8A 3SH7A 4QY6A 1K25A 4MBHA 4N92A 1TDGA 2PT7A 3PAEA 2HV1A 3IHAA 1LSVA 1PI5A 2NUPC 2ZQ9A 2P08A 3T4TA 4JF5A 2Y2PA 1S1ZA 3HLDA 2DCFA 4O01A 3BFCA 5GLDA 5L8MA 1ZTUA 4WLAA 2D01A 4JGOA 3H7WB 1S4SA 4X6TA 5GHYA 4ME4A 3ZDJA 1L3LA 5F69A 4N1XA 2P04A 2ZMAA 4BL2A 4S2NC 2PR6A 4U0XA 1NZOA 3F1OB 5KIZA 2H0TA 4E6WA 1RCJA 4DRTA 5CTNA 3WWXA 4GN2A 4EV4A 3ZYTA 3TOIA 5DTSA 1T18A 4GKUA 1M6KA 3PAGA 4KQRA 1OT9A 2ZL1B 4JF4A 5J4EA 2Z2LB 2YPAB 3QP2A 2JC7A 4ZAMA 4GLQA 4E3JA 4HJ4A 1BYWA 3JYIA 3CPTA 4MN5A 2HP9A 2XGNA 3MZFA 2KDKA 2QKPA 2VKSA 4HJ6A 5DVAA 3T4JA 3GR2A 4S2IA 4KQDA 4EW7A 3ULFA 4WZ4A 1KGFA 4HNBA 2V0WA 4B88A 1DJAA 3B42A 5TBMB 3ICYA 3OC2A 4Y0TA 2QHKA 4Y0OA 4EBPA 3HVFA 1D1JA 3HLGA 1XJ6A 5HDSA 4DE2A 3E4QA 3CLOA 3UY6A 1BLCA 5EFWA 1H5XA 2IWBA 3CPTB 4N9LA 1MY8A 4II7A 4ZJ2A 3A0SA 2NUTC 2B5RA 4OKPA 5KSHA 4OQ0A 4EXOA 1OPXA 4E3MA 2WGWB 4Q0JA 3CHWP 2V20A 1OJ5A 4YFMA 3UN7A 1MZUA 4ARZB 1IKGA 1ES4A 2ZQCA 4E3OA 3A3EA 4MBKA 3LI9A 4QU3A 2VV7A 1YLTA 4KZ5A 3V3RA 2XR0A 1FCMA 3KSFA 4BJPA 1FCNA 3IBRA 2PHYA 5K5BA 4WYYA 4BQMA 4P85A 1ES2A 1XFNA 1C3BA 4M3KA 3V67A 5FDSA 3V5MA 2J8YA 2HZ5A 3C38A 1OMEA 2Y59A 3HLFA 5F6AA 3CUEC 1DP8A 1YLPA 2JKRI 3BW6A 2ZOHA 2J3TC 1PW8A 2R78A 3IF6A 5DFYA 5HZHA 3P09A 4DKIA 1LHYA 4DE1A 4Y17A 1Z6FA 3GVBA 5CHJA 4DN0A 4RX3A 5HPFA 1EROA 4D2OA 4GHIB 5FEFA 1L0FA 1UKLC 1LI9A 2I9VA 4EU0A 1PIOA 3LY3A 4BENA 1GHMA 5AQ9A 2HF6A 4QHCA 3BY9A 5J8XA 1H8ZA 4H10B 1W63Q 3QP8A 3D9YA 2HGVA 4BMWA 3C2WA 4HI4A 3W2ZA 2BLSA 3UE6A 1V9ZA 3E98A 2W0NA 2HPBA 5HAQA 3PXPA 3OOVA 4EBNA 2VLGA 4DDYA 1PW1A 4X1LA 1TD5A 1LL9A 4UEYA 1CEGA 2HDRA 5EPHA 1IKIA 1N9NA 3ZFZA 3CZDA 4OPQA 4PM6A 4GOGA 2GDNA 1JWVA 1SHVA 3IWQA 3IXDA 1LL8A 2XA7M 2XDMA 1IYSA 4E3LA 1FCOA 3H9WA 1JVJA 3IF6B 5HWWA 5DJUA 4JXGA 5M19A 5HDDA 3P7NA 3HUMA 3SS4A 4LLOB 2QPNA 5AJGA 2RCXA 2Y2MA 1D06A 3NOPC 2V0UA 2JCHA 2JKTM 3UDFA 3GQZA 1GA9A 4UHUA 1IOUA 3PBTA 3KSHA 1MPLA 3VV4A 3T1XA 5E43A 3CMZA 1UWNX 1HLUP 1O07A 4OLDA 4WZ5C 4KUKA 4OOLA 5DKLA 4IVKA 5J3WA 3L7HA 4PM9A 2BASA 4FD8A 3FPWA 4ZDXA 4Y3IA 1A0KA 1ERMA 3QP1A 4HHDA 1H3QA 3S4XA 3U5VA 1N9OA 1M40A 3A0VA 3F1NB 4B4XA 1ESIA 3RH8B 5CEBA 3JPUA 1IYQA 1ZG4A 3TE8A 3K3DA 3IH9A 4BBTA 4P6BA 2ZM8A 3MF0A 3PBNA 5KMWA 4KG2A 5HARA 2L0WA 3SZTA 4JXWA 3M2KA 4KZ3A 4WEJA 1S1YA 4S2LA 4R1GA 4D60A 1NLYA 2XRNA 3EGDC 2PU4A 4UQIS 2O0YA 4HH3A 3A0RA 5KZHA 1ES3A 2VEAA 1CI9A 2Z6CA 3EGXC 3LIEA 4E6XA 4AFIA 4C75A 1K54C 5HX9A 2J7VA 3IX8A 5HAIA 1MWUA 4MBFA 5EUAA 1H8MA 1RGYA 3UPOA 1MXOA 1K55C 3F1OA 4Q0HA 5DJTA 2QL2B 4MLLA 1JTGA 2QJ7A 3VMAA 4DDSA 5A8BA 2FZ0A 2JN7A 1HZOA 5EVIB 5IU1A 4BWIA 3ZCZA 2OAQ1 5AVEA 4XXRA 4MDZA 1K4EA 3M2JA 2WAFA 4FH4A 4UA7A 4HEFA 1LT0A 1NXYA 2EX6A 1GA0A 2ZQ8A 3LR0A 3E0YA 3K3CA 5AVFA 3CAXA 3KX0X 3F1NA 3FYZA 3I7JA 1EI5A 4OH0A
chains in the Genus database with same CATH topology
1KOUA 4WN5A 2PT7A 2YPBA 3T4QA 3JVVA 2HV1A 4MN6A 3O5YA 1LSVA 1VB6A 2NUPC 2P08A 3T4TA 4H6JB 1S1ZA 1N9LA 3R7WB 4O01A 2O9AA 4YOFA 5L8MA 1ZTUA 2CMNA 5TJJA 3PBQA 4JGPA 4WLAA 1NLWA 2D01A 3NOTC 4JGOA 2D02A 3H7WB 3LIAA 1S4SA 3PBOA 1NWZA 4PKYA 3BQAA 2W1TA 5HD3A 3S7NA 2A24A 4ME4A 4UQIM 4R70A 2O99A 5F69A 4EUVA 2P04A 4PHTA 1MC0A 2PYPA 3H82A 1NRJA 2PR6A 1HLOA 4O0PA 1D7EA 4NKPA 3UB8A 3F1OB 3UE3A 5KIZA 5J7EA 5HSQA 4H10A 3RFBA 2M7VA 2B02A 3ZYTA 2LB5A 3CITA 1T18A 2V1AA 4I3JA 3R7WA 1OT9A 2MJ6A 1TS0A 3LR4A 4NXFA 1P97A 3BJNA 3HJKA 1IFQA 3BWLA 4CLCC 3OCLA 3B33A 5J4EA 2A2LA 1T1AA 4G3VA 2GNXA 2ZOIA 2L4RA 2YPAB 4ETZA 3EQVA 1V9YA 4GLQA 2A24B 2PDRA 4HJ4A 1BYWA 3MJQA 4CLCA 2KOIA 2JHEA 4NXEA 2QWSA 3CI6A 2IA2A 4MN5A 2KDKA 2QKPA 2G7UA 2VKSA 4HJ6A 3T4JA 4I5SA 4KQDA 3GECA 4HIAA 4EW7A 4DMZA 3ULFA 3LIDA 4G3KA 1OTAA 4FSFA 4HQAA 2YKHA 3BQ8A 4HNBA 2V0WA 4Y5FA 3PYPA 4HY8A 2XROA 2LB9A 3B42A 5TBMB 3ICYA 3OC2A 2K2NA 4LPZA 2QHKA 4Y2FA 3DBAA 3H7WA 3D3OA 2EA9A 2V1BA 4GJ4A 4NXGA 1XJ6A 3MMHA 5HDSA 3E4QA 4ETXA 3CLOA 1GSXA 4B9OA 2PYRA 5EFWA 2JKRM 2WKQA 5HDCA 1P9RA 2EWWA 1YSQA 2MH3A 3VOLA 1EW0A 4II7A 1A0AA 2KX6A 3A0SA 2NUTC 2VV8A 4LRYC 4XT2B 2H28A 5KSHA 4HP9A 3MQ0A 4CLCE 4G3WA 4HP4A 1OPXA 4MCWA 4EXOA 4H6JA 2HJ9C 3EEHA 3KSIA 4Q0JA 4YNRA 5TBMA 1OJ5A 4ATKA 1MZUA 4GS9B 4WEKA 4ARZB 2YPBB 3HCYA 3RTYA 2W3DA 2LFHA 5HWTA 5HD5A 4YWZA 4F3LA 1ODVA 3LI9A 4IUKA 4R3AA 4I3AA 2VV7A 3MFXA 4MMNA 3NHQA 2PD8A 3KSFA 4BJPA 2ZBBA 3TRCA 3IBRA 2PHYA 1UWPX 3HJIA 1G28A 3NOUC 3PBRA 4BBUA 5K5BA 4AYAA 3BY8A 4O8GA 4IHQA 2JKTI 2W1TB 4BBVA 2XSSA 4L9EA 3EOIA 4EEUA 4HOIA 3B47A 4CLCD 4NEED 3MUJA 4XT2A 2K7SA 1XFNA 3K2NA 4EERA 3V67A 3OBFA 1TS8A 1AM9A 1TS6A 1P9WA 4I38A 2M1CA 3C38A 5F6AA 4ARZA 3CUEC 1DP8A 2QJ5A 2JKRI 3BW6A 4HH2A 2ZOHA 3UB7A 2QL2A 1STZA 4FOFA 2J3TC 3T4SA 3E4OA 4P6ZS 2R78A 3CWFA 4OOMA 2J3TD 2P7JA 4P6ZM 3CUEA 5DFYA 1DP6A 5HZHA 4M4XA 3OCNA 3FPVA 5DKKA 3SW1A 1G6OA 3C8CA 3S7PA 3EEAA 3PBSA 4CLCB 1NKPA 3G6OA 3JVUA 3UMDA 5IS1A 1F5MA 4DJ2A 2VX8A 4EESA 5I4ZA 4JGRA 4DN0A 1XJ2A 1T1BA 3FG8A 5HPFA 3UB6A 3KYZA 4GHIB 2M7UA 3U2AA 1UKLC 5DFXA 3P01A 2I9VA 4EU0A 4GW9A 1GSWA 2HF6A 1AN4A 3BY9A 3IBJA 3S7QA 1GSVA 1NLZA 1W63M 1YSPA 2GX5A 4H10B 1W63Q 2J80A 4NXBA 2HGVA 4BMWA 2HJEA 3C2WA 4HI4A 3W2ZA 3UE6A 1V9ZA 3E98A 3LICA 2OWHA 4L9GA 2W0NA 3PXPA 3C30A 3OOVA 3VE3A 3IS2B 3OLOA 1S4RA 2VLGA 3UB9A 1MDYA 4Q0IA 1OTDA 4I39A 1TD5A 2QYBA 2L1MA 1OT6A 5MC7A 4UEYA 1T19A 1Y28A 1N9NA 3LFVA 3F1PB 5LBRA 2O9CA 5HL6A 1XJ3A 1JNUA 2INWA 3T50A 1T1CA 2ZMVA 3D72A 1F9IA 1LL8A 2XA7M 5C5KA 3H9WA 4L9FA 2W1RA 2VGLS 1X0OA 5HPIA 3NJAA 5HWWA 5DJUA 3KSGA 3UMEA 5F5YA 1MKMA 4F3LB 1S67L 2FH5A 5HDDA 3P7NA 4LLOB 2W27A 5AJGA 3VE4A 4QPRA 4GHIA 1D06A 2Z6DA 3NOPC 5CX7A 2V0UA 2JKTM 5F68A 3T4OA 4WUJA 1YKDA 3KSHA 3PBTA 4LRZE 4EETB 1IOUA 1P0ZA 2GZAA 3VV4A 2VGLM 3GDIA 2PD7A 3PR6A 1UWNX 4L0LA 2KLIA 2VJWA 4R38A 2OOLA 2WKRA 2W3GA 2VZWA 4WL9A 4I3IA 4KUKA 4OOLA 1XJ4A 5DKLA 4HJ3A 1OJGA 2B18A 1XFQA 3MXQA 2K31A 5I5LA 5J3WA 1LSWA 4LRXC 2BASA 4KQOA 2W3EA 3FPWA 4Y3IA 5I50A 2YKFA 4JGQA 4GS9A 1H3QA 4HHDA 2W3HA 1MDYB 2Y79A 3U5VA 1N9OA 3A0VA 3F1NB 4PAUA 1NKPB 3RH8B 2OWJA 2J3WA 4ATIA 3E4PA 2PR5A 3EQUA 4IUHA 1WA9A 3TE8A 2OAP1 5IT5A 4B93A 3K3DA 3LUQA 5EYOA 1TS7A 2V9AA 4MN7A 3S7OA 4BBTA 1YAXA 4GCZA 1UGUA 4IJGA 2EWVA 3T4KA 3MF0A 3PBNA 4E04A 1S66L 1LSXA 2W3FA 2L0WA 5DF9A 4WEJA 1S1YA 3T4LA 4KUOA 1NLYA 2XRNA 3EGDC 4UQIS 1VHMA 5FL3A 2O0YA 4HH3A 3A0RA 1TF1A 1NLWB 3EWKA 3MQQA 4WELA 2VEAA 2Z6CA 3EGXC 3LIEA 3LIBA 3FC7A 4AFIA 5HWVA 4Z1WA 4ATHA 1DRMA 2VA0A 1H8MA 4PKYG 4RQ9A 3IS2A 3F1PA 1R05A 3F1OA 2WKPA 3ZQ5A 4Q0HA 3KO6A 3MR0A 4EEPA 5DJTA 2QL2B 3TJZC 2DMWA 3LYXA 3H82B 2QJ7A 4K08A 3KYQA 3R4KA 1ZHHB 2ZMFA 5A8BA 2FZ0A 2JN7A 1DP9A 3LIFA 3LI8A 3LR5A 1F98A 1OTIA 5IU1A 4BWIA 5G4YA 4R6LA 2OAQ1 5AVEA 4MDZA 3MQOA 1OTBA 4DJ3A 5G4ZA 3PHYA 2O9BA 1LT0A 4EQ1A 3LR0A 1AN2A 3E0YA 1OTEA 3K3CA 4CQHA 3LR3A 5AVFA 2XA7S 3CAXA 3KX0X 3F1NA 4ZRRA 2YPAA 2GJ3A 4WF0A 3TW8A 2VV6A 2Y8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOU A;  4WN5 A;  2YPB A;  2HV1 A;  4MN6 A;  1LSV A;  1VB6 A;  4H6J B;  1S1Z A;  1N9L A;  2CMN A;  4JGP A;  4WLA A;  1NLW A;  2D01 A;  3NOT C;  4JGO A;  2D02 A;  3H7W B;  3LIA A;  1S4S A;  1NWZ A;  4PKY A;  5HD3 A;  2A24 A;  4R70 A;  5F69 A;  2PYP A;  3H82 A;  2PR6 A;  1HLO A;  1D7E A;  3UB8 A;  3F1O B;  5KIZ A;  5J7E A;  5HSQ A;  4H10 A;  2B02 A;  1T18 A;  2V1A A;  4I3J A;  1OT9 A;  1TS0 A;  4NXF A;  1P97 A;  3HJK A;  3BWL A;  3B33 A;  5J4E A;  1T1A A;  2YPA B;  2ZOI A;  2L4R A;  1V9Y A;  2A24 B;  2PDR A;  4HJ4 A;  1BYW A;  3MJQ A;  2JHE A;  4NXE A;  2QWS A;  4MN5 A;  2KDK A;  2QKP A;  4HJ6 A;  4I5S A;  4KQD A;  3GEC A;  4HIA A;  4EW7 A;  3ULF A;  3LID A;  1OTA A;  4HQA A;  2YKH A;  4HNB A;  2V0W A;  3PYP A;  4HY8 A;  5TBM B;  3ICY A;  4LPZ A;  2QHK A;  3H7W A;  2EA9 A;  2V1B A;  4NXG A;  1XJ6 A;  5HDS A;  3E4Q A;  3CLO A;  1GSX A;  4B9O A;  2PYR A;  5EFW A;  2WKQ A;  5HDC A;  2MH3 A;  3VOL A;  1EW0 A;  1A0A A;  2KX6 A;  3A0S A;  2VV8 A;  4LRY C;  4XT2 B;  2H28 A;  4HP9 A;  4HP4 A;  4EXO A;  4H6J A;  3EEH A;  5TBM A;  1OJ5 A;  4ATK A;  1MZU A;  4GS9 B;  2YPB B;  3RTY A;  2LFH A;  5HWT A;  5HD5 A;  4YWZ A;  4F3L A;  1ODV A;  3LI9 A;  4R3A A;  4I3A A;  2VV7 A;  3MFX A;  3NHQ A;  2PD8 A;  2ZBB A;  3IBR A;  2PHY A;  1UWP X;  3HJI A;  1G28 A;  3NOU C;  4BBU A;  4AYA A;  3BY8 A;  4BBV A;  4L9E A;  4EEU A;  4HOI A;  3MUJ A;  4XT2 A;  2K7S A;  1XFN A;  4EER A;  1AM9 A;  1TS8 A;  1TS6 A;  4I38 A;  2M1C A;  5F6A A;  1DP8 A;  2QJ5 A;  4HH2 A;  2ZOH A;  3UB7 A;  2QL2 A;  3E4O A;  2R78 A;  3CWF A;  2P7J A;  1DP6 A;  5HZH A;  4M4X A;  5DKK A;  3SW1 A;  3C8C A;  1NKP A;  3G6O A;  3UMD A;  5IS1 A;  4DJ2 A;  4EES A;  5I4Z A;  4JGR A;  1XJ2 A;  1T1B A;  3FG8 A;  3UB6 A;  4GHI B;  1UKL C;  2I9V A;  4GW9 A;  1GSW A;  1AN4 A;  3BY9 A;  1GSV A;  4H10 B;  2J80 A;  4NXB A;  3C2W A;  4HI4 A;  3UE6 A;  1V9Z A;  3LIC A;  2OWH A;  4L9G A;  2W0N A;  3VE3 A;  3IS2 B;  3OLO A;  1S4R A;  2VLG A;  3UB9 A;  1MDY A;  1OTD A;  4I39 A;  2L1M A;  1OT6 A;  1T19 A;  1Y28 A;  1N9N A;  3F1P B;  1XJ3 A;  1JNU A;  2INW A;  3T50 A;  1T1C A;  3D72 A;  1F9I A;  1LL8 A;  3H9W A;  4L9F A;  1X0O A;  3NJA A;  5HWW A;  5DJU A;  3UME A;  5F5Y A;  4F3L B;  1S67 L;  5HDD A;  3P7N A;  4LLO B;  3VE4 A;  2W27 A;  4GHI A;  1D06 A;  2Z6D A;  3NOP C;  2V0U A;  5F68 A;  4EET B;  4WUJ A;  4LRZ E;  1P0Z A;  3GDI A;  2PD7 A;  1UWN X;  4R38 A;  2OOL A;  2WKR A;  4WL9 A;  4I3I A;  4KUK A;  1XJ4 A;  5DKL A;  4HJ3 A;  1OJG A;  1XFQ A;  3MXQ A;  5J3W A;  5I5L A;  1LSW A;  4LRX C;  2BAS A;  5I50 A;  2YKF A;  4JGQ A;  4GS9 A;  4HHD A;  1MDY B;  3U5V A;  1N9O A;  3A0V A;  3F1N B;  1NKP B;  3RH8 B;  2OWJ A;  4ATI A;  3E4P A;  2PR5 A;  1WA9 A;  3K3D A;  3LUQ A;  5EYO A;  1TS7 A;  2V9A A;  4BBT A;  4GCZ A;  1UGU A;  4E04 A;  1S66 L;  1LSX A;  2L0W A;  1S1Y A;  4KUO A;  4HH3 A;  3A0R A;  1NLW B;  3EWK A;  3MQQ A;  2VEA A;  2Z6C A;  3LIE A;  3LIB A;  3FC7 A;  5HWV A;  4ATH A;  1DRM A;  4PKY G;  4RQ9 A;  3IS2 A;  3F1P A;  1R05 A;  3F1O A;  2WKP A;  3ZQ5 A;  3MR0 A;  4EEP A;  5DJT A;  2QL2 B;  3LYX A;  3H82 B;  2QJ7 A;  4K08 A;  5A8B A;  2JN7 A;  1DP9 A;  3LIF A;  3LI8 A;  1F98 A;  1OTI A;  5IU1 A;  5G4Y A;  4R6L A;  5AVE A;  3MQO A;  1OTB A;  4DJ3 A;  5G4Z A;  3PHY A;  1LT0 A;  4EQ1 A;  1AN2 A;  1OTE A;  3K3C A;  5AVF A;  3CAX A;  3KX0 X;  3F1N A;  2YPA A;  2GJ3 A;  4WF0 A;  2VV6 A; 
#chains in the Genus database with same CATH topology
 2YPB A;  3MXS A;  4EWF A;  3O87 A;  4MN6 A;  4LFU A;  3ZNT A;  4H6J B;  2P9V B;  1YQS A;  1ERQ A;  1YLZ A;  1KE0 A;  4YOF A;  1CI8 A;  4JGP A;  4PM8 A;  1NLW A;  3IXH A;  2OLU A;  4PKY A;  3BQA A;  3WS2 A;  5EEC A;  3S7N A;  1G68 A;  1HTZ A;  5L10 A;  4UQI M;  4R70 A;  3LCE A;  1NRF A;  2O99 A;  1SZV A;  4RX2 A;  4EUV A;  2WKE A;  3SS3 A;  1MC0 A;  2XH9 A;  3UB5 P;  3G30 A;  3ZG0 A;  3UB8 A;  3UE3 A;  1K4F A;  4S2K A;  4ZBE A;  2ZQA A;  2WGV A;  3G2Z A;  4C3Q A;  4BL3 A;  2OSU A;  2V1A A;  4I3J A;  5CHM A;  1DY6 A;  3R7W A;  4QY5 A;  2MJ6 A;  3O86 A;  3MFD A;  3LR4 A;  4NXF A;  4FH2 A;  1GHP A;  3HJK A;  1W5D A;  3O88 A;  1T1A A;  3VP4 A;  4G3V A;  2L4R A;  4ETZ A;  1V9Y A;  2EFU A;  2A24 B;  4CLC A;  3MJQ A;  2QWS A;  1Q2P A;  4HIA A;  5FAS A;  3Q07 A;  4KQQ A;  1OTA A;  3BEC A;  4HQA A;  2YKH A;  3BQ8 A;  4QB8 A;  1ZZA A;  1NZU A;  4FUW A;  4X69 A;  2I72 A;  3HLC A;  4OQH A;  4Y2F A;  3DBA A;  3D3O A;  2XEP A;  1S0W A;  3AGE A;  4NXG A;  4ETX A;  3HBR A;  3SOI A;  3QNB A;  2PYR A;  3MXR A;  1E3U D;  1P9R A;  2XFT A;  1YSQ A;  1E25 A;  3N8S A;  3T1R A;  2JBF A;  3D4F A;  2KX6 A;  4FTX A;  5AQB A;  1BLS A;  2H0Y A;  4XT2 B;  1KE3 A;  5EOO A;  3IH8 A;  5FI7 A;  2H28 A;  2OV5 A;  3MQ0 A;  4G3W A;  1FIL A;  4HP4 A;  2G2W A;  3UNW A;  3LEZ A;  5TFQ A;  3KSI A;  4RVA A;  4ATK A;  4GS9 B;  3TSG A;  4O7D A;  4OP8 A;  5HWT A;  5CER A;  5FAP A;  4F3L A;  1ODV A;  3VP0 A;  4R3A A;  3MFX A;  5F1F A;  1CJF A;  4GD8 A;  3HJI A;  1UWP X;  3PBR A;  4AYA A;  1MWT A;  2W1T B;  4BBV A;  1K1F A;  2XSS A;  3C7V A;  2ACG A;  4L9E A;  4WMC D;  4EEU A;  4HOI A;  4NEE D;  3MUJ A;  4XT2 A;  5FDH A;  3K2N A;  4GZB A;  4EER A;  4Q8I A;  1ZKJ A;  3OBF A;  2C6W B;  1QME A;  3G31 A;  2M1C A;  4ARZ A;  2QJ5 A;  4HH2 A;  3QHY A;  4MNR A;  3WS0 A;  2WZZ A;  1STZ A;  4FOF A;  3T4S A;  4P6Z S;  4LEN A;  3CWF A;  1K57 C;  2X02 A;  2BG1 A;  3IWO A;  1SKO A;  3V3S A;  3OCN A;  3FPV A;  5DKK A;  1AXB A;  3SW1 A;  3S7P A;  2ZJ9 A;  3PBS A;  3C8C A;  3GV9 A;  4Y13 A;  3G4P A;  1J3W A;  4CLC B;  1NKP A;  2WAE A;  2XQZ A;  3UMD A;  2PAV P;  2WK0 A;  1NYM A;  3Q7V B;  3MZE A;  3OPH A;  2PU2 A;  3KYZ A;  3U2A A;  3HUO A;  4GW9 A;  4X1M A;  1GSW A;  1BUL A;  4KZA A;  5L07 A;  1NLZ A;  3HLB A;  3WS5 A;  1YSP A;  2GX5 A;  3ZG9 B;  2HP6 A;  1ALQ A;  2J80 A;  4K0W A;  4NXB A;  4HBT A;  2IWD A;  2OWH A;  3N6I A;  1K6R A;  4K0X A;  5GL9 A;  3IS2 B;  3OLO A;  1Y4O A;  4PMA A;  4I39 A;  1SDE A;  1BLP A;  5FI6 A;  2Y2H A;  4NG2 A;  5LBR A;  3BLS A;  1XA7 A;  3CG5 A;  2INW A;  2ZL1 A;  1RGZ A;  3T50 A;  2R9W A;  1Y54 A;  3D72 A;  5FQM A;  4OPZ A;  4E3I A;  1SDN A;  5EOE A;  5C5K A;  3UDX A;  4L9F A;  2VGL S;  5HPI A;  1I5Q A;  1JWP A;  3KSG A;  3UME A;  1MKM A;  3IF6 C;  1S67 L;  4LV2 A;  3VE4 A;  4QPR A;  1PWD A;  1K55 A;  2Z6D A;  1SKF A;  3NEC A;  5HAP A;  4UA6 A;  4N1H A;  1NYY A;  1KVM A;  3PR6 A;  5BOH A;  4FCF A;  2VJW A;  5EVI A;  3GRJ A;  1XGI A;  2CC1 A;  3V39 A;  3T1S A;  4LCL A;  3O3V A;  4HJ3 A;  1XFQ A;  3MXQ A;  2K31 A;  4F94 A;  4LV0 A;  5DTT A;  5I50 A;  5DF8 A;  1PNE A;  4JGQ A;  1MDY B;  2Y79 A;  4H8R A;  3NUL A;  4S2J A;  2OWJ A;  1L0D A;  4ATI A;  3FKV A;  4EQI A;  3UE0 A;  3BFF A;  1WA9 A;  1ESU A;  2WGI A;  4B93 A;  3LUQ A;  2WYX A;  5JYP A;  4MN7 A;  1YAX A;  1L0G A;  3GSG A;  4E04 A;  3BRM A;  1LSX A;  2W3F A;  4QWO A;  5DF9 A;  4KUO A;  5FL3 A;  2Q0O A;  2B95 A;  3VP2 A;  1NLW B;  1HD8 A;  2R9X A;  3SS5 A;  4ATH A;  3A3J A;  3OPP A;  4RQ9 A;  3VP3 A;  1K54 A;  1R05 A;  4JLF A;  1CF0 A;  3SH9 A;  1BZA A;  4EEP A;  3LYX A;  3H82 B;  3G34 A;  3LIF A;  3LR5 A;  1F98 A;  1OTI A;  4OON A;  5EVI C;  3VFH A;  4R6L A;  1FR6 A;  2HDQ A;  3S22 A;  2HDU A;  2ZM0 A;  1OTB A;  5G4Z A;  2O9B A;  2VGJ A;  1OTE A;  1DJB A;  2E8J A;  4R23 A;  2YPA A;  4GNU A;  1QMF A;  3ITB A;  1KOU A;  1ZC2 A;  4WN5 A;  3ISG A;  1XA1 A;  2ZC3 B;  2ZM2 A;  3O5Y A;  2EX2 A;  3VSK A;  1VB6 A;  1VM1 A;  5EM1 A;  5D3O A;  4KZ9 A;  1N9L A;  3C7U A;  3R7W B;  5EVE A;  3Q1F A;  2CMN A;  3PBQ A;  2ZQD A;  3NOT C;  2D02 A;  3LIA A;  3PBO A;  2W1T A;  5HD3 A;  2G2U A;  4DE0 A;  2Y55 A;  3QP5 A;  1NY0 A;  3LY4 A;  2Y2O A;  3UO9 A;  4PHT A;  2OLV A;  1HLO A;  3IHB A;  1ACF A;  2XFS A;  1D7E A;  5J7E A;  5JYO A;  2WGW A;  1YM1 A;  4H10 A;  5A90 A;  3RFB A;  2M7V A;  1MBL A;  2LB5 A;  2QZ6 A;  3UPN A;  1TS0 A;  5HL1 A;  1P97 A;  3BJN A;  4CLC C;  3OCL A;  2A49 A;  1LLB A;  2PBD P;  1LL5 A;  4LV3 A;  2KOI A;  2JHE A;  4PM5 A;  1ONG A;  2G7U A;  4Y15 A;  3GEC A;  4GB7 A;  1PZO A;  4JPM A;  5GHZ A;  1GHI A;  3FKW A;  2FFF B;  3HRE A;  3DTK A;  4Y5F A;  3PYP A;  4HY8 A;  2XRO A;  2LB9 A;  3ZNY A;  4LPZ A;  5CHU A;  5CGS A;  3S1Y A;  2V1B A;  5M1A A;  1W79 A;  2VGK A;  3FZC A;  1H8Y A;  5FAT A;  1GSX A;  2JKR M;  4X53 A;  1WYC A;  2IWC A;  2EWW A;  2MH3 A;  1YPR A;  4OPY A;  1BSG A;  2A3U A;  4LRY C;  1IEM A;  3HLE A;  4CLC E;  2V2F F;  4MEZ A;  1L0E A;  4MCW A;  2ZQ7 A;  2HJ9 C;  5TBM A;  2WUQ A;  4CPK A;  4WEK A;  2W3D A;  2LFH A;  4JKT A;  2X01 A;  5HD5 A;  4IUK A;  4I3A A;  4MMN A;  4A5R A;  2ZBB A;  3TRC A;  3L9K A;  3NOU C;  5E2G A;  5FEG A;  3Q82 A;  2JKT I;  5GHX A;  1GCE A;  3B47 A;  4CLC D;  2PRF A;  5CGW A;  2K7S A;  2Z2M B;  1G5U A;  3IX4 A;  1S6R A;  1AM9 A;  1TS6 A;  1P9W A;  4I38 A;  5EM0 A;  3MKF A;  2DNS A;  3HLW A;  3BEB A;  1KGE A;  4NK3 A;  3G35 A;  4JBF A;  3N7W A;  4HBU A;  3E4O A;  5TGF A;  2H5S A;  4OOM A;  1Q2Q A;  4WBG A;  2Y91 A;  1XX2 A;  5GLB A;  2XD1 A;  1DP6 A;  4XUZ A;  2Y2Q A;  4X55 A;  3C5A A;  3EEA A;  1YLJ A;  3JVU A;  5IS1 A;  3VOZ A;  1F5M A;  4EES A;  5I4Z A;  1KGG A;  2ZC6 B;  3NCK A;  1XJ2 A;  1T1B A;  4OQG A;  3SH8 A;  2XF3 A;  1N9B A;  2M7U A;  3VSL A;  1IEL A;  5DFX A;  4PPR A;  3HUN A;  3VP1 A;  3IBJ A;  4R3B A;  4OQI A;  3IXB A;  5CXW A;  1W63 M;  3MSH A;  5GLC A;  2ZD8 A;  1XKZ A;  4L9G A;  5EVI D;  3E2L A;  1XXM A;  3DW0 A;  4DE3 A;  5IHV A;  4OVD A;  1RP5 A;  1FQG A;  3ZGA B;  3VE3 A;  2WKH A;  1S4R A;  3UB9 A;  5E2F A;  4GDB A;  1MDY A;  4Q0I A;  4KZ8 A;  4ZJ3 A;  1Z09 A;  3TG9 A;  2QYB A;  4KZ7 A;  1OT6 A;  3NY4 A;  1KVL A;  2HP5 A;  1Y28 A;  3LFV A;  3F1P B;  2C5W B;  4Y0U A;  2O9C A;  1XJ3 A;  2Y2I A;  4K91 A;  4PM7 A;  2JKG A;  4ID4 A;  1H0M A;  1T1C A;  2ZMV A;  5A91 A;  4R4R A;  1F9I A;  1KE4 A;  5F82 A;  5FQQ A;  3P98 A;  4IBX A;  1W8Q A;  5FAO A;  3W8K A;  5F5Y A;  5EVL A;  4KEN B;  2V8C A;  5FI2 A;  4E3K A;  4GHI A;  3RXX A;  5CX7 A;  4ZTK A;  5G18 A;  3BYD A;  1E3U A;  5F68 A;  3FWL A;  1WYB A;  1P0Z A;  2GZA A;  2PD7 A;  5HFO A;  4L0L A;  2KLI A;  2V8F A;  2OOL A;  1IYO A;  1VET A;  2WKR A;  3DTI A;  4P0M A;  4DF6 A;  3MZD A;  4UA9 A;  1XJ4 A;  5I5L A;  1LSW A;  4LRX C;  2W3E A;  2EXA A;  4S2M A;  2YKF A;  1BT5 A;  1WE4 A;  4GD6 A;  2W3H A;  3Q7V A;  1AWI A;  3Q7Z A;  4E3N A;  1XP4 A;  3DTE A;  1NKP B;  3WRT A;  5FQ9 A;  2H10 A;  2PR5 A;  4ZJ1 A;  3EQU A;  1L2S A;  2OAP 1;  1TS7 A;  2V9A A;  3UDI A;  3S7O A;  1UGU A;  4IJG A;  2EWV A;  2VK3 A;  3T1Q B;  5U47 A;  1S66 L;  1TVF A;  2UWX A;  2HDS A;  1PZP A;  2JKF A;  1G6A A;  2WZX A;  1PWG A;  3EWK A;  4QJG A;  3C4O A;  3FC7 A;  5F1G A;  2PBY A;  1J9M A;  2Y2G A;  5HWV A;  4WMC A;  1DRM A;  1TDL A;  2VA0 A;  4KG5 A;  5E2E A;  3IT9 A;  3LEQ A;  3IS2 A;  3F1P A;  4S2O A;  4CJN A;  3N8L A;  2WKP A;  3ZQ5 A;  5AQ7 A;  4K08 A;  5CRF A;  3R4K A;  1ZHH B;  2ZMF A;  3MBZ A;  1FIK A;  1DP9 A;  3LI8 A;  1YLY A;  4N9K A;  2Q9N A;  4OLG A;  1PI4 A;  2EX8 A;  3IWI A;  3ITA A;  4KG6 A;  5DTK A;  5E2H A;  4R3J A;  4DJ3 A;  3LO7 A;  1XGJ A;  3NIA A;  4LCM A;  3PHY A;  1AN2 A;  2XA7 S;  3BM6 A;  4LV1 A;  4ZRR A;  2GJ3 A;  2VV6 A;  2Y8H A;  4RYE A;  5HW3 A;  3BLM A;  4OOY A;  3JVV A;  3T4Q A;  2UV0 E;  3IF5 A;  3IXG A;  3WRZ A;  4Z9Q A;  3W4Q A;  2P74 A;  4UAA A;  1MKI A;  4JF6 A;  2O9A A;  1PRQ A;  5TJJ A;  4BD1 A;  1NWZ A;  4S2N A;  4R0Q A;  2A24 A;  3V50 A;  5TR7 A;  3OPR A;  3M6H A;  4DXB A;  1BLH A;  2PYP A;  3H82 A;  1JWZ A;  1PWC A;  4X56 A;  1NRJ A;  1KDS A;  1PFL A;  4O0P A;  4NKP A;  3RXW A;  5HSQ A;  1LI0 A;  3NI9 A;  1CK3 A;  3CJM A;  2E8I A;  3W4P A;  2Q9M A;  2B02 A;  3UPP A;  4C6Y A;  5FQI A;  1BTL A;  2X71 A;  3CIT A;  3DWK A;  3ZG7 B;  1PYY A;  3DWZ A;  1SKO B;  1IFQ A;  3BWL A;  3B33 A;  5KSC A;  2Y2J A;  3G32 A;  1O7E A;  2A2L A;  3IQA A;  4DXC A;  2GNX A;  2ZOI A;  5EV0 A;  3EQV A;  1XPB A;  2PDR A;  4S2P A;  1FOF A;  4NXE A;  3CI6 A;  2IA2 A;  3BFE A;  1NJ4 A;  4I5S A;  3WS1 A;  4DMZ A;  1W7F A;  5A93 A;  3LID A;  4G3K A;  4FSF A;  5DF7 A;  3BFG A;  2ZC5 B;  3E2K A;  2K2N A;  2Y2L A;  1JTD A;  3H7W A;  2EA9 A;  4GJ4 A;  4EBL A;  5CEC A;  3MMH A;  5FQK A;  5FSR A;  4B9O A;  4KZB A;  2WKQ A;  5HDC A;  3NDG A;  1CQA A;  3VOL A;  1EW0 A;  1I2S A;  1A0A A;  4RA7 A;  4X68 A;  4Y7P A;  2VV8 A;  1VQQ A;  1MWR A;  3M6B A;  3DTM A;  4HP9 A;  1F2K A;  4H6J A;  4IBR A;  3EEH A;  4YNR A;  1DJC A;  2J9O A;  2YPB B;  3HCY A;  3RTY A;  1K57 A;  3A3D A;  4XUX A;  4YWZ A;  5L09 A;  3B3X A;  3NHQ A;  2PD8 A;  4BBU A;  1G28 A;  2Y2K A;  3BY8 A;  4O8G A;  4IHQ A;  4IVI A;  1FSY A;  2WAD A;  5F83 A;  4P87 A;  3LGO A;  3NC8 A;  4U3T A;  3EOI A;  4HES A;  3UE1 A;  3ZG5 A;  3A3I A;  3MS6 A;  3NDE A;  1TS8 A;  1ES5 A;  5FAQ A;  1KDW A;  1VET B;  3QP6 A;  4EUZ A;  1TEM A;  3UB7 A;  4BD0 A;  2QL2 A;  1ZG6 A;  4OP5 A;  5GLA A;  5I94 A;  2J3T D;  2P7J A;  4P6Z M;  3CUE A;  4M4X A;  2EXB A;  1G6O A;  3G6O A;  2XLN A;  5CED A;  4DJ2 A;  2VX8 A;  1CEF A;  2V1Z A;  4JGR A;  3GMW A;  2FFY A;  3FG8 A;  3UB6 A;  3T12 B;  1I2W A;  4BLM A;  3P01 A;  3FV7 A;  5M18 A;  1AN4 A;  3S7Q A;  1GSV A;  3RJU A;  1HVB A;  1ONH A;  2HJE A;  1YT4 A;  1U60 A;  3LIC A;  3MKE A;  3N8R A;  5A92 A;  3C30 A;  2EFX A;  3HL9 A;  4JXV A;  1OTD A;  3W4O A;  2L1M A;  5MC7 A;  1T19 A;  1FSW A;  3U4L P;  5HL6 A;  2ZC7 A;  1VEU A;  1JNU A;  3Q81 A;  3VFF A;  5FA7 A;  2XD5 A;  3BFD A;  5AQA A;  2W1R A;  1X0O A;  3NJA A;  1K6S A;  4F3L B;  3GTC A;  2ZLY A;  2FH5 A;  3AGD A;  2W27 A;  3ZHH A;  3OPL A;  1E4D A;  4QD4 A;  5FQJ A;  3ZVT A;  4JXS A;  2DRW A;  3QP4 A;  1VEU B;  2WKI A;  4WUJ A;  1YKD A;  4LRZ E;  3T4O A;  4X25 A;  4EET B;  4KZ6 A;  4WM9 A;  4YIN A;  1YMX A;  1K56 A;  2VGL M;  3GDI A;  4R38 A;  3ZG8 B;  4NET A;  3C4P A;  2W3G A;  2EX9 A;  2VZW A;  4WL9 A;  4I3I A;  1YLW A;  1OJG A;  2B18 A;  1W8Y A;  4U0T A;  2RL3 A;  1N4O A;  3DAV A;  4KQO A;  3N4I A;  4ESP A;  4GS9 A;  4OPR A;  1SCW A;  2BTF P;  4GDN A;  4PAU A;  2QMI A;  2J3W A;  3E4P A;  4IUH A;  1EWZ A;  2XK1 A;  5IT5 A;  2ZC4 B;  5CGX A;  1MWS A;  2Y2N A;  5EYO A;  2JE5 A;  3VOY A;  4GCZ A;  3T4K A;  4WZ5 A;  3T4L A;  1K38 A;  1BUE A;  3OZH A;  1VHM A;  3AGF A;  1TF1 A;  3MQQ A;  4WEL A;  4IED A;  4LGW A;  3LIB A;  3QNC A;  4Z1W A;  4R4S A;  4PKY G;  3PTE A;  5CTM A;  3KO6 A;  3MR0 A;  1IYP A;  2AVX A;  1FR1 A;  3TJZ C;  2DMW A;  2Y4A A;  3WS4 A;  3KYQ A;  3KYE A;  5G4Y A;  3ZVW A;  5L2F A;  2J9P A;  3G2Y A;  3NBL A;  3MQO A;  4KZ4 A;  1K0K A;  4B4Z A;  4EQ1 A;  2P9V A;  1YMS A;  4CQH A;  3LR3 A;  5EE8 A;  3IX3 A;  3A3F A;  4WF0 A;  1K56 D;  3TW8 A;  3SH7 A;  4QY6 A;  1K25 A;  4MBH A;  4N92 A;  1TDG A;  2PT7 A;  3PAE A;  2HV1 A;  3IHA A;  1LSV A;  1PI5 A;  2NUP C;  2ZQ9 A;  2P08 A;  3T4T A;  4JF5 A;  2Y2P A;  1S1Z A;  3HLD A;  2DCF A;  4O01 A;  3BFC A;  5GLD A;  5L8M A;  1ZTU A;  4WLA A;  2D01 A;  4JGO A;  3H7W B;  1S4S A;  4X6T A;  5GHY A;  4ME4 A;  3ZDJ A;  1L3L A;  5F69 A;  4N1X A;  2P04 A;  2ZMA A;  4BL2 A;  4S2N C;  2PR6 A;  4U0X A;  1NZO A;  3F1O B;  5KIZ A;  2H0T A;  4E6W A;  1RCJ A;  4DRT A;  5CTN A;  3WWX A;  4GN2 A;  4EV4 A;  3ZYT A;  3TOI A;  5DTS A;  1T18 A;  4GKU A;  1M6K A;  3PAG A;  4KQR A;  1OT9 A;  2ZL1 B;  4JF4 A;  5J4E A;  2Z2L B;  2YPA B;  3QP2 A;  2JC7 A;  4ZAM A;  4GLQ A;  4E3J A;  4HJ4 A;  1BYW A;  3JYI A;  3CPT A;  4MN5 A;  2HP9 A;  2XGN A;  3MZF A;  2KDK A;  2QKP A;  2VKS A;  4HJ6 A;  5DVA A;  3T4J A;  3GR2 A;  4S2I A;  4KQD A;  4EW7 A;  3ULF A;  4WZ4 A;  1KGF A;  4HNB A;  2V0W A;  4B88 A;  1DJA A;  3B42 A;  5TBM B;  3ICY A;  3OC2 A;  4Y0T A;  2QHK A;  4Y0O A;  4EBP A;  3HVF A;  1D1J A;  3HLG A;  1XJ6 A;  5HDS A;  4DE2 A;  3E4Q A;  3CLO A;  3UY6 A;  1BLC A;  5EFW A;  1H5X A;  2IWB A;  3CPT B;  4N9L A;  1MY8 A;  4II7 A;  4ZJ2 A;  3A0S A;  2NUT C;  2B5R A;  4OKP A;  5KSH A;  4OQ0 A;  4EXO A;  1OPX A;  4E3M A;  2WGW B;  4Q0J A;  3CHW P;  2V20 A;  1OJ5 A;  4YFM A;  3UN7 A;  1MZU A;  4ARZ B;  1IKG A;  1ES4 A;  2ZQC A;  4E3O A;  3A3E A;  4MBK A;  3LI9 A;  4QU3 A;  2VV7 A;  1YLT A;  4KZ5 A;  3V3R A;  2XR0 A;  1FCM A;  3KSF A;  4BJP A;  1FCN A;  3IBR A;  2PHY A;  5K5B A;  4WYY A;  4BQM A;  4P85 A;  1ES2 A;  1XFN A;  1C3B A;  4M3K A;  3V67 A;  5FDS A;  3V5M A;  2J8Y A;  2HZ5 A;  3C38 A;  1OME A;  2Y59 A;  3HLF A;  5F6A A;  3CUE C;  1DP8 A;  1YLP A;  2JKR I;  3BW6 A;  2ZOH A;  2J3T C;  1PW8 A;  2R78 A;  3IF6 A;  5DFY A;  5HZH A;  3P09 A;  4DKI A;  1LHY A;  4DE1 A;  4Y17 A;  1Z6F A;  3GVB A;  5CHJ A;  4DN0 A;  4RX3 A;  5HPF A;  1ERO A;  4D2O A;  4GHI B;  5FEF A;  1L0F A;  1UKL C;  1LI9 A;  2I9V A;  4EU0 A;  1PIO A;  3LY3 A;  4BEN A;  1GHM A;  5AQ9 A;  2HF6 A;  4QHC A;  3BY9 A;  5J8X A;  1H8Z A;  4H10 B;  1W63 Q;  3QP8 A;  3D9Y A;  2HGV A;  4BMW A;  3C2W A;  4HI4 A;  3W2Z A;  2BLS A;  3UE6 A;  1V9Z A;  3E98 A;  2W0N A;  2HPB A;  5HAQ A;  3PXP A;  3OOV A;  4EBN A;  2VLG A;  4DDY A;  1PW1 A;  4X1L A;  1TD5 A;  1LL9 A;  4UEY A;  1CEG A;  2HDR A;  5EPH A;  1IKI A;  1N9N A;  3ZFZ A;  3CZD A;  4OPQ A;  4PM6 A;  4GOG A;  2GDN A;  1JWV A;  1SHV A;  3IWQ A;  3IXD A;  1LL8 A;  2XA7 M;  2XDM A;  1IYS A;  4E3L A;  1FCO A;  3H9W A;  1JVJ A;  3IF6 B;  5HWW A;  5DJU A;  4JXG A;  5M19 A;  5HDD A;  3P7N A;  3HUM A;  3SS4 A;  4LLO B;  2QPN A;  5AJG A;  2RCX A;  2Y2M A;  1D06 A;  3NOP C;  2V0U A;  2JCH A;  2JKT M;  3UDF A;  3GQZ A;  1GA9 A;  4UHU A;  1IOU A;  3PBT A;  3KSH A;  1MPL A;  3VV4 A;  3T1X A;  5E43 A;  3CMZ A;  1UWN X;  1HLU P;  1O07 A;  4OLD A;  4WZ5 C;  4KUK A;  4OOL A;  5DKL A;  4IVK A;  5J3W A;  3L7H A;  4PM9 A;  2BAS A;  4FD8 A;  3FPW A;  4ZDX A;  4Y3I A;  1A0K A;  1ERM A;  3QP1 A;  4HHD A;  1H3Q A;  3S4X A;  3U5V A;  1N9O A;  1M40 A;  3A0V A;  3F1N B;  4B4X A;  1ESI A;  3RH8 B;  5CEB A;  3JPU A;  1IYQ A;  1ZG4 A;  3TE8 A;  3K3D A;  3IH9 A;  4BBT A;  4P6B A;  2ZM8 A;  3MF0 A;  3PBN A;  5KMW A;  4KG2 A;  5HAR A;  2L0W A;  3SZT A;  4JXW A;  3M2K A;  4KZ3 A;  4WEJ A;  1S1Y A;  4S2L A;  4R1G A;  4D60 A;  1NLY A;  2XRN A;  3EGD C;  2PU4 A;  4UQI S;  2O0Y A;  4HH3 A;  3A0R A;  5KZH A;  1ES3 A;  2VEA A;  1CI9 A;  2Z6C A;  3EGX C;  3LIE A;  4E6X A;  4AFI A;  4C75 A;  1K54 C;  5HX9 A;  2J7V A;  3IX8 A;  5HAI A;  1MWU A;  4MBF A;  5EUA A;  1H8M A;  1RGY A;  3UPO A;  1MXO A;  1K55 C;  3F1O A;  4Q0H A;  5DJT A;  2QL2 B;  4MLL A;  1JTG A;  2QJ7 A;  3VMA A;  4DDS A;  5A8B A;  2FZ0 A;  2JN7 A;  1HZO A;  5EVI B;  5IU1 A;  4BWI A;  3ZCZ A;  2OAQ 1;  5AVE A;  4XXR A;  4MDZ A;  1K4E A;  3M2J A;  2WAF A;  4FH4 A;  4UA7 A;  4HEF A;  1LT0 A;  1NXY A;  2EX6 A;  1GA0 A;  2ZQ8 A;  3LR0 A;  3E0Y A;  3K3C A;  5AVF A;  3CAX A;  3KX0 X;  3F1N A;  3FYZ A;  3I7J A;  1EI5 A;  4OH0 A; 
#chains in the Genus database with same CATH homology
 1KOU A;  4WN5 A;  2PT7 A;  2YPB A;  3T4Q A;  3JVV A;  2HV1 A;  4MN6 A;  3O5Y A;  1LSV A;  1VB6 A;  2NUP C;  2P08 A;  3T4T A;  4H6J B;  1S1Z A;  1N9L A;  3R7W B;  4O01 A;  2O9A A;  4YOF A;  5L8M A;  1ZTU A;  2CMN A;  5TJJ A;  3PBQ A;  4JGP A;  4WLA A;  1NLW A;  2D01 A;  3NOT C;  4JGO A;  2D02 A;  3H7W B;  3LIA A;  1S4S A;  3PBO A;  1NWZ A;  4PKY A;  3BQA A;  2W1T A;  5HD3 A;  3S7N A;  2A24 A;  4ME4 A;  4UQI M;  4R70 A;  2O99 A;  5F69 A;  4EUV A;  2P04 A;  4PHT A;  1MC0 A;  2PYP A;  3H82 A;  1NRJ A;  2PR6 A;  1HLO A;  4O0P A;  1D7E A;  4NKP A;  3UB8 A;  3F1O B;  3UE3 A;  5KIZ A;  5J7E A;  5HSQ A;  4H10 A;  3RFB A;  2M7V A;  2B02 A;  3ZYT A;  2LB5 A;  3CIT A;  1T18 A;  2V1A A;  4I3J A;  3R7W A;  1OT9 A;  2MJ6 A;  1TS0 A;  3LR4 A;  4NXF A;  1P97 A;  3BJN A;  3HJK A;  1IFQ A;  3BWL A;  4CLC C;  3OCL A;  3B33 A;  5J4E A;  2A2L A;  1T1A A;  4G3V A;  2GNX A;  2ZOI A;  2L4R A;  2YPA B;  4ETZ A;  3EQV A;  1V9Y A;  4GLQ A;  2A24 B;  2PDR A;  4HJ4 A;  1BYW A;  3MJQ A;  4CLC A;  2KOI A;  2JHE A;  4NXE A;  2QWS A;  3CI6 A;  2IA2 A;  4MN5 A;  2KDK A;  2QKP A;  2G7U A;  2VKS A;  4HJ6 A;  3T4J A;  4I5S A;  4KQD A;  3GEC A;  4HIA A;  4EW7 A;  4DMZ A;  3ULF A;  3LID A;  4G3K A;  1OTA A;  4FSF A;  4HQA A;  2YKH A;  3BQ8 A;  4HNB A;  2V0W A;  4Y5F A;  3PYP A;  4HY8 A;  2XRO A;  2LB9 A;  3B42 A;  5TBM B;  3ICY A;  3OC2 A;  2K2N A;  4LPZ A;  2QHK A;  4Y2F A;  3DBA A;  3H7W A;  3D3O A;  2EA9 A;  2V1B A;  4GJ4 A;  4NXG A;  1XJ6 A;  3MMH A;  5HDS A;  3E4Q A;  4ETX A;  3CLO A;  1GSX A;  4B9O A;  2PYR A;  5EFW A;  2JKR M;  2WKQ A;  5HDC A;  1P9R A;  2EWW A;  1YSQ A;  2MH3 A;  3VOL A;  1EW0 A;  4II7 A;  1A0A A;  2KX6 A;  3A0S A;  2NUT C;  2VV8 A;  4LRY C;  4XT2 B;  2H28 A;  5KSH A;  4HP9 A;  3MQ0 A;  4CLC E;  4G3W A;  4HP4 A;  1OPX A;  4MCW A;  4EXO A;  4H6J A;  2HJ9 C;  3EEH A;  3KSI A;  4Q0J A;  4YNR A;  5TBM A;  1OJ5 A;  4ATK A;  1MZU A;  4GS9 B;  4WEK A;  4ARZ B;  2YPB B;  3HCY A;  3RTY A;  2W3D A;  2LFH A;  5HWT A;  5HD5 A;  4YWZ A;  4F3L A;  1ODV A;  3LI9 A;  4IUK A;  4R3A A;  4I3A A;  2VV7 A;  3MFX A;  4MMN A;  3NHQ A;  2PD8 A;  3KSF A;  4BJP A;  2ZBB A;  3TRC A;  3IBR A;  2PHY A;  1UWP X;  3HJI A;  1G28 A;  3NOU C;  3PBR A;  4BBU A;  5K5B A;  4AYA A;  3BY8 A;  4O8G A;  4IHQ A;  2JKT I;  2W1T B;  4BBV A;  2XSS A;  4L9E A;  3EOI A;  4EEU A;  4HOI A;  3B47 A;  4CLC D;  4NEE D;  3MUJ A;  4XT2 A;  2K7S A;  1XFN A;  3K2N A;  4EER A;  3V67 A;  3OBF A;  1TS8 A;  1AM9 A;  1TS6 A;  1P9W A;  4I38 A;  2M1C A;  3C38 A;  5F6A A;  4ARZ A;  3CUE C;  1DP8 A;  2QJ5 A;  2JKR I;  3BW6 A;  4HH2 A;  2ZOH A;  3UB7 A;  2QL2 A;  1STZ A;  4FOF A;  2J3T C;  3T4S A;  3E4O A;  4P6Z S;  2R78 A;  3CWF A;  4OOM A;  2J3T D;  2P7J A;  4P6Z M;  3CUE A;  5DFY A;  1DP6 A;  5HZH A;  4M4X A;  3OCN A;  3FPV A;  5DKK A;  3SW1 A;  1G6O A;  3C8C A;  3S7P A;  3EEA A;  3PBS A;  4CLC B;  1NKP A;  3G6O A;  3JVU A;  3UMD A;  5IS1 A;  1F5M A;  4DJ2 A;  2VX8 A;  4EES A;  5I4Z A;  4JGR A;  4DN0 A;  1XJ2 A;  1T1B A;  3FG8 A;  5HPF A;  3UB6 A;  3KYZ A;  4GHI B;  2M7U A;  3U2A A;  1UKL C;  5DFX A;  3P01 A;  2I9V A;  4EU0 A;  4GW9 A;  1GSW A;  2HF6 A;  1AN4 A;  3BY9 A;  3IBJ A;  3S7Q A;  1GSV A;  1NLZ A;  1W63 M;  1YSP A;  2GX5 A;  4H10 B;  1W63 Q;  2J80 A;  4NXB A;  2HGV A;  4BMW A;  2HJE A;  3C2W A;  4HI4 A;  3W2Z A;  3UE6 A;  1V9Z A;  3E98 A;  3LIC A;  2OWH A;  4L9G A;  2W0N A;  3PXP A;  3C30 A;  3OOV A;  3VE3 A;  3IS2 B;  3OLO A;  1S4R A;  2VLG A;  3UB9 A;  1MDY A;  4Q0I A;  1OTD A;  4I39 A;  1TD5 A;  2QYB A;  2L1M A;  1OT6 A;  5MC7 A;  4UEY A;  1T19 A;  1Y28 A;  1N9N A;  3LFV A;  3F1P B;  5LBR A;  2O9C A;  5HL6 A;  1XJ3 A;  1JNU A;  2INW A;  3T50 A;  1T1C A;  2ZMV A;  3D72 A;  1F9I A;  1LL8 A;  2XA7 M;  5C5K A;  3H9W A;  4L9F A;  2W1R A;  2VGL S;  1X0O A;  5HPI A;  3NJA A;  5HWW A;  5DJU A;  3KSG A;  3UME A;  5F5Y A;  1MKM A;  4F3L B;  1S67 L;  2FH5 A;  5HDD A;  3P7N A;  4LLO B;  2W27 A;  5AJG A;  3VE4 A;  4QPR A;  4GHI A;  1D06 A;  2Z6D A;  3NOP C;  5CX7 A;  2V0U A;  2JKT M;  5F68 A;  3T4O A;  4WUJ A;  1YKD A;  3KSH A;  3PBT A;  4LRZ E;  4EET B;  1IOU A;  1P0Z A;  2GZA A;  3VV4 A;  2VGL M;  3GDI A;  2PD7 A;  3PR6 A;  1UWN X;  4L0L A;  2KLI A;  2VJW A;  4R38 A;  2OOL A;  2WKR A;  2W3G A;  2VZW A;  4WL9 A;  4I3I A;  4KUK A;  4OOL A;  1XJ4 A;  5DKL A;  4HJ3 A;  1OJG A;  2B18 A;  1XFQ A;  3MXQ A;  2K31 A;  5I5L A;  5J3W A;  1LSW A;  4LRX C;  2BAS A;  4KQO A;  2W3E A;  3FPW A;  4Y3I A;  5I50 A;  2YKF A;  4JGQ A;  4GS9 A;  1H3Q A;  4HHD A;  2W3H A;  1MDY B;  2Y79 A;  3U5V A;  1N9O A;  3A0V A;  3F1N B;  4PAU A;  1NKP B;  3RH8 B;  2OWJ A;  2J3W A;  4ATI A;  3E4P A;  2PR5 A;  3EQU A;  4IUH A;  1WA9 A;  3TE8 A;  2OAP 1;  5IT5 A;  4B93 A;  3K3D A;  3LUQ A;  5EYO A;  1TS7 A;  2V9A A;  4MN7 A;  3S7O A;  4BBT A;  1YAX A;  4GCZ A;  1UGU A;  4IJG A;  2EWV A;  3T4K A;  3MF0 A;  3PBN A;  4E04 A;  1S66 L;  1LSX A;  2W3F A;  2L0W A;  5DF9 A;  4WEJ A;  1S1Y A;  3T4L A;  4KUO A;  1NLY A;  2XRN A;  3EGD C;  4UQI S;  1VHM A;  5FL3 A;  2O0Y A;  4HH3 A;  3A0R A;  1TF1 A;  1NLW B;  3EWK A;  3MQQ A;  4WEL A;  2VEA A;  2Z6C A;  3EGX C;  3LIE A;  3LIB A;  3FC7 A;  4AFI A;  5HWV A;  4Z1W A;  4ATH A;  1DRM A;  2VA0 A;  1H8M A;  4PKY G;  4RQ9 A;  3IS2 A;  3F1P A;  1R05 A;  3F1O A;  2WKP A;  3ZQ5 A;  4Q0H A;  3KO6 A;  3MR0 A;  4EEP A;  5DJT A;  2QL2 B;  3TJZ C;  2DMW A;  3LYX A;  3H82 B;  2QJ7 A;  4K08 A;  3KYQ A;  3R4K A;  1ZHH B;  2ZMF A;  5A8B A;  2FZ0 A;  2JN7 A;  1DP9 A;  3LIF A;  3LI8 A;  3LR5 A;  1F98 A;  1OTI A;  5IU1 A;  4BWI A;  5G4Y A;  4R6L A;  2OAQ 1;  5AVE A;  4MDZ A;  3MQO A;  1OTB A;  4DJ3 A;  5G4Z A;  3PHY A;  2O9B A;  1LT0 A;  4EQ1 A;  3LR0 A;  1AN2 A;  3E0Y A;  1OTE A;  3K3C A;  4CQH A;  3LR3 A;  5AVF A;  2XA7 S;  3CAX A;  3KX0 X;  3F1N A;  4ZRR A;  2YPA A;  2GJ3 A;  4WF0 A;  3TW8 A;  2VV6 A;  2Y8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...