4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/activator
molecule keywords BMAL1b
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
1S4SA 2QWSA 1OTDA 3K3CA 5AVFA 3H7WA 1S66L 1GSWA 5DJTA 1N9OA 4HNBA 1OTEA 4EEPA 4NXFA 2P7JA 1XJ3A 1NLWB 1GSVA 4H6JB 3B33A 1UWPX 3UB8A 4EQ1A 2WKPA 1XJ6A 1S1YA 4AYAA 4EESA 3MQOA 4H10B 3K3DA 5G4YA 2PYRA 1MZUA 4HY8A 5TBMB 2JN7A 1N9LA 3GDIA 3VE4A 1MDYA 4XT2A 2M1CA 4KQDA 2D01A 3H7WB 3IBRA 4GW9A 1AM9A 2A24A 3A0RA 2VLGA 1DP6A 5EYOA 1BYWA 3LIFA 1X0OA 3G6OA 3UE6A 4JGRA 2PR5A 4R38A 1N9NA 3MR0A 2H28A 2WKRA 3LIAA 4R6LA 3F1OB 4RQ9A 4HH2A 4HJ4A 5HSQA 4KUOA 3UB6A 3HJKA 4EERA 5DJUA 1XFNA 2HV1A 5F6AA 3NHQA 4HOIA 1MDYB 5F5YA 2W27A 5J7EA 3EEHA 4GHIA 2A24B 4HP9A 1OT6A 3UB7A 1XJ4A 4PKYA 5AVEA 3UB9A 3RH8B 5F68A 3H82A 2YKHA 3CWFA 4HH3A 3OLOA 4BBVA 2K7SA 4DJ3A 1T1CA 3LIBA 5I5LA 2V0UA 3VE3A 2PDRA 3ZQ5A 4NXEA 4E04A 3BY9A 3PYPA 5HDSA 2KDKA 4EW7A 5DKKA 2V1AA 4L9EA 3ULFA 4BBTA 5IS1A 3NOTC 4GHIB 4HIAA 3MFXA 4LPZA 1D7EA 2GJ3A 4WN5A 1OJ5A 3H82B 1P0ZA 3NOUC 1NKPA 4GS9B 3MJQA 3PHYA 4WF0A 3C8CA 3LI8A 3F1NA 2CMNA 1UKLC 1LSWA 5EFWA 1T18A 1T1AA 1G28A 1A0AA 3EWKA 1R05A 5HWTA 2L0WA 1D06A 2V9AA 1DRMA 4PKYG 3E4QA 2PHYA 1NKPB 3BY8A 4HJ3A 3GECA 1JNUA 1LL8A 5I50A 1NWZA 2VV6A 4JGOA 1DP9A 5HWVA 2ZOIA 3F1NB 2JHEA 2BASA 2V0WA 3D72A 1P97A 4I3JA 3MQQA 4NXGA 2ZBBA 5HZHA 4XT2B 3E4PA 1ODVA 3HJIA 1WA9A 5HD5A 2OOLA 3NJAA 3MXQA 4B9OA 5G4ZA 2Z6DA 4I3IA 4GCZA 4ATKA 4HP4A 3UMDA 4LRYC 2PYPA 4ATIA 4ATHA 5HDDA 2EA9A 2J80A 3C2WA 5F69A 3VOLA 3LI9A 2MH3A 3IS2A 2OWHA 2WKQA 2PD8A 1OJGA 3LIDA 4H6JA 4LLOB 2INWA 5KIZA 3MUJA 3F1PA 2QJ5A 2R78A 2YKFA 1GSXA 3FG8A 2ZOHA 2YPAA 2B02A 4H10A 4MN5A 1UWNX 3P7NA 2PR6A 4EEUA 2QJ7A 3SW1A 5I4ZA 5DKLA 5A8BA 5HDCA 1KOUA 2PD7A 4WLAA 3IS2B 1XJ2A 1TS6A 4HHDA 2L4RA 2LFHA 4I39A 4NXBA 1AN2A 4I3AA 2OWJA 1S4RA 4YWZA 2VV8A 1V9YA 4JGPA 3F1PB 2Z6CA 4HQAA 4WL9A 1F9IA 5J3WA 4JGQA 2YPBA 3F1OA 4M4XA 2QHKA 4L9FA 1DP8A 2YPAB 3E4OA 3RTYA 2VV7A 3LUQA 4KUKA 5J4EA 1S1ZA 1EW0A 4K08A 2D02A 5HD3A 3FC7A 1OTBA 4I5SA 2VEAA 2QL2A 1TS7A 1LSVA 1S67L 3T50A 1TS8A 4HI4A 1OTIA 4LRXC 2YPBB 1T1BA 4F3LA 1F98A 4DJ2A 3CLOA 3LYXA 1OTAA 3BWLA 3KX0X 3H9WA 4HJ6A 3A0VA 2QKPA 4WUJA 4R3AA 1HLOA 1Y28A 4L9GA 4EETB 2KX6A 3UMEA 2QL2B 1AN4A 5HWWA 1XFQA 3LIEA 2I9VA 5IU1A 3CAXA 4GS9A 1LT0A 3NOPC 1NLWA 3ICYA 1VB6A 4I38A 1UGUA 4EXOA 1V9ZA 2V1BA 4F3LB 2W0NA 4R70A 1TS0A 3U5VA 1LSXA 4LRZE 3LICA 1T19A 2L1MA 1OT9A 3A0SA 5TBMA 4MN6A 4BBUA
chains in the Genus database with same CATH superfamily
1OTDA 1GHIA 5AVFA 1WE4A 5HX9A 3H7WA 3D3OA 5FI7A 5DJTA 4HNBA 5L07A 3JVVA 4CJNA 1W8QA 5AQBA 4PAUA 2MJ6A 1S6RA 2WKIA 4C6YA 1L2SA 3FZCA 5CTMA 3B33A 4Q8IA 2WKPA 2Y8HA 3GVBA 2HZ5A 4H10B 4XUXA 3QNBA 3IT9A 2PYRA 5DVAA 5CX7A 4BQMA 1YLZA 4HY8A 4X1LA 3TE8A 3MSHA 3LR4A 1YLJA 2C6WB 3CHWP 3IBRA 1AM9A 3NIAA 3O87A 1I2WA 4Q0IA 3TJZC 3A0RA 1DP6A 2XSSA 4RA7A 4OP8A 1GA0A 3SZTA 5K5BA 1CEGA 4IJGA 4RYEA 3CPTB 2WKRA 1M40A 3LIAA 3VFFA 2HPBA 5HAQA 5FAPA 2ZQ9A 4KUOA 3NC8A 3HJKA 5G18A 2GNXA 3QP8A 5DF8A 2HV1A 5TR7A 5F6AA 3NHQA 3DBAA 5F5YA 5HPFA 1FCMA 5J7EA 4GHIA 4HP9A 1OT6A 4PKYA 5F68A 2ZQDA 3OLOA 4BBVA 2K7SA 4N9LA 1G6AA 1U60A 3G30A 3UE3A 1VHMA 1W79A 3FKWA 3DW0A 5I5LA 5EVIA 1JWZA 1NJ4A 3SH7A 3W8KA 1G6OA 4S2PA 1NZOA 1K56D 4QU3A 4YFMA 3BY9A 1KDWA 3CUEC 4YOFA 3M2JA 3PYPA 2V2FF 3LR0A 2Y79A 3A3JA 2XQZA 3BRMA 3M6HA 3WRZA 2W3HA 2KDKA 1LL5A 1F5MA 4MCWA 2EXBA 1BLSA 5GL9A 2FH5A 1SCWA 2ZM0A 4L9EA 1KE3A 4UQIS 2X01A 4HIAA 4ZRRA 4U3TA 5M1AA 5E2GA 5M19A 3H82B 3HL9A 1EI5A 1P0ZA 2WZZA 1MPLA 3RXXA 4OQ0A 2W1TB 1SDNA 1P9WA 3UB5P 3PAEA 5DF9A 4WF0A 5IT5A 1ZC2A 1IYQA 2WKEA 1TEMA 2JKTM 2Y59A 2CMNA 3T1XA 1H0MA 1UKLC 4QY5A 1RGYA 2Q0OA 1LSWA 3Q07A 5EFWA 4LV3A 2B18A 3BQAA 1T1AA 3IBJA 3BLMA 1IYOA 1K54C 4EBLA 3AGEA 2KLIA 2M7VA 5CECA 3TRCA 4GZBA 2P08A 2V9AA 4X55A 3PR6A 3E4QA 1XGIA 2J3TC 4HJ3A 4U0XA 1H8ZA 2QPNA 4GD6A 1PWGA 2UWXA 5CGXA 1DP9A 5LBRA 2Q9MA 3ZVWA 4WMCD 3CG5A 3HLFA 1W5DA 2Y2PA 3EQUA 1M6KA 2JHEA 3E0YA 4BL2A 4OH0A 2XFSA 5CEBA 3D72A 4KZ8A 3A3IA 2OAP1 5E2EA 5F82A 5HZHA 4XT2B 5FEFA 3E4PA 5M18A 2J3TD 4NG2A 3MXQA 4KG6A 4GCZA 2DCFA 3UMDA 3MKFA 2XA7M 4ATHA 4O8GA 3S1YA 2WGIA 1XXMA 5GLDA 2J80A 5TJJA 5KMWA 5KSCA 2NUTC 2ZJ9A 2C5WB 2GDNA 2JE5A 3HLEA 2A3UA 3MXSA 3G4PA 4LV2A 4NETA 1PI4A 2XK1A 5DFYA 3F1PA 2R78A 2G2UA 1GSXA 3T4JA 2JKRM 2BLSA 1L0DA 2P04A 2ZOHA 4B4ZA 2E8IA 1O07A 3Q7VA 2P9VA 3PBQA 1W8YA 4H10A 4MN5A 2PRFA 3G2YA 4MBKA 1IELA 3P7NA 4R4RA 5DTTA 4EEUA 3MQ0A 4E3OA 1LLBA 3MKEA 2WAFA 4E6XA 3PAGA 5A8BA 3T12B 4WLAA 3DTKA 3IF6C 1XJ2A 3S7NA 2L4RA 2ZQAA 4I39A 3KYQA 2Z6CA 2CC1A 1F9IA 1BLCA 3C38A 4JXGA 2J9OA 3JYIA 3E4OA 2VV7A 4UHUA 1E3UA 3A3FA 3B42A 3V67A 4DE0A 4Z1WA 1RP5A 4Y17A 1JVJA 4DXCA 5HD3A 3NY4A 4WZ4A 2VEAA 1PZOA 5EPHA 2ACGA 4LGWA 3OPPA 3DTEA 1LSVA 3EEAA 4N92A 4DXBA 1W7FA 1VETB 4UA6A 4XXRA 2R9XA 3MMHA 1F98A 2HDRA 1IKIA 3Q82A 3ZG5A 3KSHA 5CHMA 3LYXA 4DN0A 3BWLA 1ES2A 4Z9QA 1PWCA 4WUJA 2FFFB 1LL9A 3VP0A 3QP6A 3N8LA 1FSWA 2HDQA 5AQ7A 3BFCA 5HWWA 1K0KA 1Z09A 2I9VA 4E6WA 4JPMA 3BFEA 5EV0A 4P6ZS 4PM6A 1LT0A 2PAVP 3HREA 3ICYA 3N6IA 3V3SA 3AGFA 1BSGA 3UPOA 4GJ4A 3BM6A 5I94A 1RCJA 3LR5A 1OPXA 2EX6A 4BMWA 4EUZA 1ZG6A 3U5VA 3UY6A 2Y2OA 4N1HA 3MF0A 2L1MA 1OT9A 4S2JA 1FOFA 5TBMA 4X56A 4MN6A 4BBUA 4CPKA 4S2MA 1YLWA 2VGKA 2QWSA 3K3CA 4DMZA 2WK0A 4QPRA 3G32A 4Y5FA 1OTEA 4EEPA 4E3NA 1EROA 1HZOA 2P7JA 1YMSA 3SS3A 1XJ3A 4CLCE 2O9AA 1XX2A 3HBRA 5EE8A 4EBPA 4P87A 1MWTA 1ZTUA 1NRFA 4EQ1A 1XJ6A 1P9RA 2HDUA 3KSGA 2VA0A 4AYAA 4GOGA 3Q7ZA 4EESA 4S2NC 3MQOA 4MLLA 5TGFA 5G4YA 2DMWA 1MZUA 1C3BA 4MBHA 4KG5A 2JN7A 3ZNTA 1N9LA 2M7UA 4RVAA 5HFOA 4XT2A 2O9BA 5EM0A 4MDZA 2D01A 4GW9A 2Y91A 2ZQCA 4RX3A 1TDGA 3GR2A 2VLGA 5CXWA 1GA9A 1TD5A 3WWXA 2EX8A 3LY4A 3UPPA 1Z6FA 2G7UA 3M2KA 1HVBA 2PR5A 1K57C 1KE0A 3HLGA 3TSGA 2H28A 1K6RA 4GD8A 4HH2A 3NULA 2WADA 1K56A 4DRTA 5HSQA 3LEQA 4EERA 4GDNA 4KZ6A 3NBLA 4HOIA 4X68A 5FASA 1MDYB 4OPRA 3S4XA 3SH9A 4ZJ3A 5L10A 4C75A 4O01A 1KGFA 3EEHA 4WBGA 2A24B 2ZMVA 5AVEA 3T1QB 1L0GA 3ZFZA 4K0XA 3VP4A 4B88A 3HLDA 4JLFA 3U4LP 3N7WA 4PM9A 1E25A 2EX2A 3T1RA 3CUEA 2PDRA 4OQGA 4PM5A 3ZQ5A 2H0YA 2VGLS 4OOLA 4NXEA 3Q1FA 1YLYA 4S2KA 3LO7A 1SKOA 4U0TA 1NLZA 3GSGA 2HGVA 4G3WA 4IHQA 1XGJA 3C4OA 5GHXA 2ZMAA 3ULFA 4BBTA 1N4OA 1YSPA 2GJ3A 4LPZA 4WN5A 2OLUA 1OJ5A 2X02A 3NOUC 1NKPA 1TVFA 4DDSA 4N1XA 4UQIM 1FCNA 3PBSA 3T4QA 5A92A 3C8CA 3G31A 4PM7A 1MC0A 1NZUA 2NUPC 3S7PA 1KGGA 2H0TA 1K54A 2Y2QA 3UDFA 1T18A 3T4SA 4WZ5A 4E3MA 2JBFA 1PRQA 3EWKA 4NKPA 5HWTA 1D06A 3O88A 4PKYG 1CJFA 3Q81A 5DF7A 3PBTA 1JNUA 3ZVTA 1LL8A 2K31A 3MZEA 1PI5A 1TDLA 5FAQA 4AFIA 4JF6A 4NK3A 3F1NB 2V1ZA 3VFHA 4KZ5A 1PWDA 4P0MA 2V0WA 1MWSA 3MQQA 1OMEA 4NXGA 4R4SA 1ODVA 2XFTA 3R4KA 2QMIA 3NJAA 4B9OA 5G4ZA 2XGNA 2Z6DA 3BFDA 4CLCC 1KGEA 2W3DA 4LRYC 2PYPA 1AWIA 4GLQA 2ZQ8A 3C2WA 1ERMA 1PW8A 3GMWA 1G5UA 1MKMA 3DWZA 3VOLA 3S7OA 3IS2A 4K0WA 1K38A 1ALQA 1Y4OA 4MEZA 3OPHA 2INWA 5FAOA 4B4XA 3PBOA 4HESA 5EVLA 3ZGAB 4B93A 5CGSA 4CLCD 1H8MA 5F1GA 2YPAA 3DWKA 2H10A 2RL3A 1UWNX 2E8JA 2QJ7A 2XF3A 3UN7A 2ZC5B 3VSKA 2Z2MB 3IF6A 3HCYA 3KYZA 3NDGA 3R7WB 3TW8A 4HHDA 2LFHA 4ARZB 4NXBA 3MXRA 1IKGA 4OONA 3C30A 1V9YA 1ES4A 4YWZA 1CI9A 3IXGA 2VGJA 2EFXA 4Y0TA 4HQAA 4WL9A 3O5YA 2HP9A 5FEGA 3T4OA 3ZCZA 2DNSA 3EGDC 4BLMA 3FYZA 3LUQA 3G34A 3I7JA 2D02A 3IXBA 2WKHA 3T4LA 4I5SA 3WS2A 2QL2A 1J9MA 4YINA 1FSYA 1TS7A 2J7VA 2JCHA 4Q0HA 3UO9A 2HP6A 1PYYA 1S67L 4XUZA 3RJUA 2W3EA 2Y2IA 1ONGA 3OC2A 1K6SA 2YPBB 3LY3A 1WYCA 4ID4A 4O0PA 2BG1A 2XLNA 3GTCA 1YKDA 4DJ2A 2Y2LA 4OOYA 3CLOA 5FQ9A 1NLYA 5HPIA 1DY6A 1XPBA 4HJ6A 3G35A 2QKPA 5CTNA 1ES3A 1KE4A 1SDEA 3V39A 4EETB 4YNRA 5L2FA 2XD5A 3UMEA 2A2LA 2WGWB 4GKUA 2ZM2A 3BEBA 2Y55A 1XFQA 1ESIA 5IU1A 3EGXC 3CAXA 4X69A 2Z2LB 3NECA 3NOPC 3S7QA 1VB6A 4EXOA 2GZAA 3SS5A 5EVIC 1PNEA 4KENB 3CI6A 4II7A 3VP2A 3OPRA 4CLCB 1KVMA 4F3LB 1YPRA 5KSHA 1AXBA 4P6ZM 1ZHHB 3HLWA 1LSXA 3V50A 4S2OA 2FFYA 3A0SA 2WZXA 4UAAA 4Y0UA 2W1RA 2W3FA 4E3KA 1S4SA 5HW3A 1S66L 4E3LA 1WYBA 1GSWA 1N9OA 5A93A 4NXFA 1HTZA 2GX5A 4IUKA 1NLWB 5EVID 4H6JB 4GNUA 4GB7A 1MWRA 3CPTA 2J8YA 4FH2A 5GHYA 1S1YA 5J8XA 2BTFP 1K25A 5FDHA 1L3LA 3IXHA 1YMXA 1FILA 2ZL1B 1NRJA 2ZQ7A 4RX2A 2PT7A 4KQDA 3H7WB 4OKPA 3BLSA 1FIKA 1K4FA 5EYOA 3LIFA 3CJMA 2XEPA 1X0OA 1K57A 1VQQA 4IVKA 5CEDA 4R38A 4G3VA 1LI9A 4E3JA 3MR0A 3TG9A 4R6LA 4KZ7A 3O3VA 3F1OB 3WS4A 4HJ4A 5EECA 1FR6A 3UB6A 1XFNA 4R23A 1VM1A 1ACFA 4R3BA 3VMAA 3BQ8A 4UA7A 2PBDP 3CITA 2JKTI 2W27A 3C7UA 2XH9A 4GDBA 3VOYA 1LI0A 3UB7A 3U2AA 1Q2QA 1XJ4A 3H82A 4PPRA 3RH8B 2YKHA 3KYEA 1D1JA 4DKIA 3CWFA 4BL3A 2W1TA 3ZHHA 2WAEA 4DJ3A 1T1CA 3RFBA 3LIBA 1YSQA 2V0UA 5GLCA 3IHBA 3VE3A 5GLBA 2RCXA 1K4EA 3R7WA 1TF1A 5AQ9A 4HBUA 2EWWA 1GHMA 3OOVA 4ZDXA 5HDSA 5AJGA 4PMAA 1KDSA 1K55C 1IYPA 3PBRA 3B3XA 4WEJA 4ARZA 4EW7A 4KZBA 2VGLM 1JWPA 3ZG9B 5IS1A 3NOTC 4GHIB 1D7EA 3MBZA 3A3EA 3E98A 4JXWA 4GS9B 3MJQA 3PHYA 3V3RA 5EVIB 2ZLYA 2R9WA 4X25A 1H8YA 3T4KA 3T1SA 1NYYA 3W2ZA 3A3DA 3AGDA 3FV7A 5CERA 4ME4A 4ZAMA 3IH9A 2OV5A 3IX4A 5JYPA 2ZMFA 1A0AA 4FUWA 4H8RA 2IWCA 2L0WA 4EU0A 2PBYA 1GHPA 4KZAA 5EVEA 1SZVA 4GN2A 5JYOA 2PHYA 3GECA 3UPNA 4QHCA 4Y3IA 5I50A 2VV6A 4Q0JA 5CHJA 5HWVA 3DTIA 2V8CA 2JKRI 3IHAA 3OZHA 2OAQ1 2Y2MA 2O99A 3JVUA 3HLCA 2BASA 4UA9A 3C4PA 4OVDA 1P97A 1ESUA 1BZAA 4HEFA 4S2LA 1S0WA 3LCEA 2ZBBA 5FQKA 1XKZA 1SKFA 1F2KA 2OOLA 3ZNYA 3IWQA 4ZJ2A 4IUHA 4EWFA 4KQRA 2KOIA 5TFQA 4ATKA 4HP4A 1E3UD 2EA9A 2ZC4B 4Y13A 3O86A 5F69A 3BJNA 1Q2PA 5AQAA 3FPWA 1O7EA 4R3JA 3LI9A 4G3KA 4DDYA 3WS5A 2OWHA 2WKQA 3GV9A 5GLAA 2PD8A 1OJGA 2Y2KA 2O9CA 4FOFA 4H6JA 1ONHA 4LLOB 5KIZA 3MUJA 2QJ5A 4OLGA 5U47A 1CQAA 1XA1A 2X71A 3IX3A 4FD8A 4OQIA 4LCMA 2PR6A 3ZG8B 4WMCA 1ZKJA 5DKLA 4A5RA 4DE1A 4WM9A 5HDCA 2PD7A 3N4IA 2EXAA 2UV0E 4Y0OA 4X53A 1AN2A 2OWJA 2VV8A 4IBXA 4JGPA 2ZM8A 3F1PB 1VETA 4X1MA 5FQMA 5J3WA 2LB9A 2EX9A 3F1OA 4M4XA 2QHKA 3Q7VB 4L9FA 1DP8A 2P9VB 3RTYA 1XA7A 4LFUA 4JXSA 2ZD8A 4IVIA 4R1GA 5J4EA 4D60A 1S1ZA 3KSIA 4Y2FA 4WELA 2IA2A 3OCNA 3UDIA 5CRFA 2VZWA 3BFGA 3NDEA 5L8MA 3HUNA 1QMEA 4BENA 3K2NA 4FSFA 3ZDJA 4EUVA 4HI4A 1OTIA 4LRXC 1H3QA 1JTGA 1T1BA 4NEED 3TOIA 4JF5A 3UDXA 1RGZA 3B47A 4BWIA 3ITBA 4Y7PA 1OTAA 3T4TA 5DTSA 4R3AA 1YLTA 1HLOA 5FQQA 4MMNA 4L9GA 1NY0A 4QB8A 4GS9A 3KO6A 2K2NA 3VSLA 1UGUA 3N8RA 3E2LA 4BD1A 1STZA 4Y15A 2EWVA 3GQZA 2J9PA 4R70A 3LFVA 1G68A 2HF6A 3BECA 4OPZA 3LICA 3IWOA 4JF4A 3QHYA 4E3IA 3UE0A 2XD1A 1CK3A 4JBFA 3D4FA 4OPYA 1MXOA 1L0FA 2JKGA 3WS1A 1JWVA 3HVFA 4BJPA 1YT4A 1IYSA 5FI6A 3KSFA 2AVXA 1GSVA 1UWPX 3UB8A 3IQAA 2HP5A 5A91A 1L0EA 5L09A 4KZ4A 3VP3A 3VP1A 3K3DA 3QP5A 4CQHA 5HAPA 5FDSA 5TBMB 3GDIA 1VEUB 4WYYA 3VE4A 4WZ5C 1MDYA 2M1CA 1GCEA 4KZ9A 3IX8A 2A24A 2DRWA 3BFFA 1BYWA 4MBFA 2H5SA 3G6OA 4FH4A 3UE6A 5FSRA 4JGRA 1N9NA 5FA7A 3UE1A 4PHTA 5F83A 3NI9A 3HUMA 4RQ9A 5EOOA 4WEKA 2PU2A 2WGVA 5DJUA 1ZZAA 1HD8A 3E2KA 3DAVA 3GRJA 3ISGA 3QNCA 1MKIA 3IXDA 1NYMA 4QWOA 2JC7A 5HL1A 2Q9NA 3FPVA 3D9YA 4S2IA 3UB9A 1ZG4A 3IF5A 2XRNA 4HH3A 2VJWA 2QZ6A 1DJBA 3OPLA 1PFLA 2J3WA 4F94A 1PZPA 2PU4A 4LCLA 3WRTA 4DF6A 1DJAA 4E04A 3SOIA 1HLUP 4LV0A 3OCLA 3MFDA 1K55A 3M6BA 2Y2JA 2B5RA 3CMZA 2OSUA 1K1FA 3PTEA 1PW1A 2XROA 1JTDA 5DKKA 2V1AA 3HUOA 4IBRA 4M3KA 2A49A 4KG2A 4ETXA 3MFXA 1NXYA 1W63Q 1BTLA 1FCOA 1BUEA 1BLPA 4FTXA 3ITAA 4LV1A 1IFQA 3SS4A 2W3GA 3LI8A 4S2NA 3P09A 3PBNA 3F1NA 4KZ3A 2Y2NA 3OBFA 1CEFA 1SKOB 5FI2A 4P85A 2ZC6B 1EWZA 2EFUA 1G28A 1ES5A 5DFXA 1R05A 2ZC3B 3EQVA 3FWLA 4KQOA 1DRMA 1PIOA 3ZG7B 2VKSA 1MY8A 1XP4A 4QJGA 1NKPB 3BY8A 2Y4AA 3P01A 2O0YA 1J3WA 5HAIA 4PM8A 1NWZA 4JGOA 5CGWA 2IWDA 4OQHA 3ZG0A 2ZOIA 4ESPA 4C3QA 3N8SA 2ZC7A 4OPQA 5E2FA 3FKVA 4EBNA 4MN7A 2FZ0A 1FR1A 3L9KA 4I3JA 3NCKA 1BT5A 3P98A 4ETZA 3ZYTA 2XA7S 4OOMA 3JPUA 1KVLA 1BULA 3MZDA 3HJIA 2V20A 1WA9A 5HD5A 1CF0A 5EOEA 5A90A 5FL3A 2B95A 4I3IA 4D2OA 3L7HA 4ATIA 5HDDA 5FATA 2QYBA 5E2HA 4DE2A 2HJEA 3BW6A 5HL6A 3WS0A 2MH3A 2OLVA 1DJCA 5CHUA 5F1FA 2G2WA 2HJ9C 4LENA 4QD4A 4EQIA 3DTMA 3LIDA 1CI8A 1MWUA 2LB5A 3LR3A 5E43A 2YKFA 5KZHA 3SH8A 1BLHA 3FG8A 1SHVA 1MBLA 3IH8A 1Y54A 4FCFA 1E4DA 5HARA 4K91A 2B02A 4OLDA 1IEMA 1YQSA 1VEUA 4ZTKA 3SW1A 3MS6A 3LGOA 5I4ZA 5BOHA 1KOUA 4L0LA 1W63M 3IS2B 4KQQA 1ERQA 1N9BA 1TS6A 1FQGA 1QMFA 3UNWA 3RXWA 4I3AA 4MNRA 1S4RA 4R0QA 3HLBA 2WUQA 2Y2GA 4JGQA 2XDMA 2YPBA 2HDSA 2YPAB 3LEZA 4ZBEA 2WYXA 4UEYA 5MC7A 4N9KA 5IHVA 4HBTA 4KUKA 3QP1A 5GHZA 1EW0A 4K08A 3IF6B 3FC7A 1YLPA 2VX8A 1OTBA 5FQJA 3IWIA 1LHYA 2WGWA 3W4PA 3QP4A 4QY6A 3V5MA 5FQIA 3VOZA 3T50A 4DE3A 1TS8A 2XR0A 4CLCA 4F3LA 3MZFA 4BD0A 4ZJ1A 1YM1A 2IWBA 4O7DA 3CZDA 5DTKA 5EUAA 3KX0X 1A0KA 3H9WA 3A0VA 1YAXA 5C5KA 1H5XA 3S22A 1Y28A 3C5AA 3QP2A 2KX6A 1IOUA 4X6TA 2QL2B 1AN4A 4JKTA 2JKFA 3LIEA 2Y2HA 3W4QA 1NLWA 4EV4A 4I38A 4OP5A 1V9ZA 1I2SA 2VK3A 2V8FA 3G2ZA 5EM1A 2I72A 2V1BA 3EOIA 2P74A 2W0NA 3VV4A 1TS0A 4P6BA 4IEDA 3PXPA 4LRZE 4JXVA 3BYDA 1T19A 1I5QA 2ZL1A 3C7VA 5D3OA 3W4OA
chains in the Genus database with same CATH topology
1S4SA 2QWSA 1OTDA 3K3CA 5AVFA 4DMZA 3H7WA 1S66L 3D3OA 4QPRA 1GSWA 5DJTA 1N9OA 4Y5FA 4HNBA 1OTEA 4EEPA 3JVVA 4BJPA 4PAUA 4NXFA 2MJ6A 2P7JA 2GX5A 3KSFA 4IUKA 1XJ3A 1NLWB 4CLCE 1GSVA 2O9AA 4H6JB 3B33A 1UWPX 1ZTUA 3UB8A 4EQ1A 2WKPA 1XJ6A 1S1YA 1P9RA 2Y8HA 3KSGA 2VA0A 4AYAA 4EESA 3MQOA 4H10B 3K3DA 5G4YA 2DMWA 4CQHA 2PYRA 1MZUA 5CX7A 4HY8A 3TE8A 5TBMB 2JN7A 1N9LA 3GDIA 1NRJA 2M7UA 3LR4A 3VE4A 1MDYA 2PT7A 2O9BA 4XT2A 2M1CA 4KQDA 4MDZA 2D01A 3H7WB 3IBRA 4GW9A 1AM9A 2A24A 4Q0IA 3TJZC 3A0RA 2VLGA 1DP6A 2XSSA 5EYOA 1TD5A 1BYWA 3LIFA 5K5BA 1X0OA 2G7UA 3G6OA 3UE6A 4IJGA 4JGRA 2PR5A 4R38A 1N9NA 4G3VA 4PHTA 3MR0A 2H28A 2WKRA 3LIAA 4R6LA 3F1OB 4RQ9A 4HH2A 4HJ4A 5HSQA 4KUOA 3UB6A 3HJKA 4WEKA 4EERA 5DJUA 1XFNA 2GNXA 2HV1A 5F6AA 3BQ8A 3CITA 3NHQA 3DBAA 4HOIA 1MDYB 5F5YA 2JKTI 2W27A 5HPFA 4O01A 5J7EA 3EEHA 4GHIA 3FPVA 2A24B 2ZMVA 4HP9A 1OT6A 3UB7A 3U2AA 1XJ4A 4PKYA 5AVEA 3UB9A 3H82A 5F68A 3RH8B 2YKHA 3CWFA 2XRNA 4HH3A 3OLOA 4BBVA 2K7SA 2VJWA 2W1TA 3UE3A 1VHMA 4DJ3A 1T1CA 3RFBA 2J3WA 3LIBA 5I5LA 1YSQA 2V0UA 3VE3A 3CUEA 2PDRA 3ZQ5A 1G6OA 2VGLS 4OOLA 4NXEA 4E04A 3BY9A 3CUEC 4YOFA 3R7WA 1TF1A 3OCLA 3PYPA 2EWWA 3OOVA 3LR0A 2Y79A 5HDSA 1NLZA 5AJGA 2HGVA 2W3HA 2KDKA 4G3WA 1F5MA 4MCWA 4IHQA 3PBRA 2XROA 4ARZA 4WEJA 4EW7A 5DKKA 2FH5A 2VGLM 2V1AA 4L9EA 3ULFA 4BBTA 5IS1A 4UQIS 4ETXA 3NOTC 4GHIB 4HIAA 3MFXA 1YSPA 1D7EA 2GJ3A 4LPZA 4ZRRA 1W63Q 4WN5A 1OJ5A 3H82B 1P0ZA 3NOUC 3E98A 1NKPA 2W1TB 4GS9B 1P9WA 3MJQA 3PHYA 4UQIM 5DF9A 1IFQA 3PBSA 4WF0A 5IT5A 3T4QA 3T4KA 3C8CA 2W3GA 3LI8A 3W2ZA 2JKTM 3PBNA 1MC0A 3F1NA 2CMNA 1UKLC 2NUPC 3S7PA 1LSWA 5EFWA 4ME4A 3OBFA 2B18A 3BQAA 1T18A 1T1AA 2ZMFA 3IBJA 3T4SA 1G28A 1A0AA 3EWKA 5DFXA 1R05A 4NKPA 5HWTA 2L0WA 2KLIA 3EQVA 2M7VA 3TRCA 4KQOA 4EU0A 1D06A 2P08A 2V9AA 1DRMA 3PR6A 4PKYG 2VKSA 3E4QA 2PHYA 2J3TC 1NKPB 3BY8A 4HJ3A 3GECA 3P01A 3PBTA 1JNUA 2O0YA 1LL8A 4Y3IA 2K31A 5I50A 1NWZA 2VV6A 4JGOA 4Q0JA 1DP9A 5LBRA 5HWVA 4AFIA 2JKRI 3EQUA 2OAQ1 2ZOIA 3F1NB 2JHEA 3E0YA 2O99A 3JVUA 2BASA 2V0WA 3D72A 1P97A 4MN7A 2FZ0A 4I3JA 3MQQA 2OAP1 4NXGA 4ETZA 2ZBBA 5HZHA 4XT2B 3ZYTA 2XA7S 4OOMA 3E4PA 1ODVA 3HJIA 3R4KA 1WA9A 2J3TD 5HD5A 2OOLA 3NJAA 3MXQA 4B9OA 5G4ZA 2Z6DA 4IUHA 5FL3A 4I3IA 4GCZA 2KOIA 4ATKA 4CLCC 4HP4A 3UMDA 2W3DA 2XA7M 4LRYC 2PYPA 4ATIA 4GLQA 4ATHA 4O8GA 5HDDA 2EA9A 2J80A 5TJJA 3C2WA 5F69A 3BJNA 1MKMA 2NUTC 2QYBA 3FPWA 3VOLA 2HJEA 3BW6A 5HL6A 3LI9A 2MH3A 4G3KA 3S7OA 3IS2A 2HJ9C 2OWHA 2WKQA 2PD8A 1OJGA 3LIDA 2O9CA 4FOFA 2LB5A 3LR3A 4H6JA 4LLOB 2INWA 5KIZA 3PBOA 5DFYA 3MUJA 3F1PA 2QJ5A 4B93A 2R78A 2YKFA 1GSXA 3T4JA 2JKRM 3FG8A 2P04A 4CLCD 1H8MA 2ZOHA 2YPAA 3PBQA 2B02A 4H10A 4MN5A 1UWNX 3P7NA 2PR6A 4EEUA 3MQ0A 2QJ7A 3SW1A 5I4ZA 5DKLA 5A8BA 5HDCA 3HCYA 1KOUA 2PD7A 3KYZA 4WLAA 4L0LA 1W63M 3R7WB 3IS2B 3TW8A 1XJ2A 1TS6A 4HHDA 3S7NA 2L4RA 2LFHA 4ARZB 4I39A 4NXBA 1AN2A 2OWJA 3KYQA 1S4RA 2VV8A 1V9YA 3C30A 4I3AA 3F1PB 4JGPA 2Z6CA 4YWZA 4HQAA 4WL9A 1F9IA 3O5YA 5J3WA 4JGQA 3T4OA 3C38A 2LB9A 2YPBA 3F1OA 4M4XA 2QHKA 4L9FA 1DP8A 2YPAB 3E4OA 3EGDC 3RTYA 2VV7A 4UEYA 5MC7A 3LUQA 3B42A 3V67A 4KUKA 5J4EA 1S1ZA 1EW0A 3KSIA 4Z1WA 4K08A 2D02A 5HD3A 3FC7A 4Y2FA 4WELA 2IA2A 1OTBA 2VX8A 3OCNA 3T4LA 4I5SA 2VEAA 2QL2A 2VZWA 1TS7A 4Q0HA 5L8MA 1LSVA 3EEAA 1S67L 3K2NA 4FSFA 4EUVA 3T50A 1TS8A 2W3EA 4HI4A 3OC2A 1OTIA 4LRXC 2YPBB 1H3QA 4O0PA 1T1BA 4NEED 3MMHA 4CLCA 4F3LA 1F98A 1YKDA 4DJ2A 4BWIA 3B47A 3KSHA 3CLOA 3LYXA 4DN0A 1NLYA 1OTAA 3BWLA 3T4TA 3KX0X 5HPIA 3H9WA 4HJ6A 3A0VA 2QKPA 4WUJA 1YAXA 4R3AA 5C5KA 1HLOA 1Y28A 4MMNA 4L9GA 4EETB 4YNRA 2KX6A 1IOUA 3UMEA 2QL2B 2A2LA 1AN4A 5HWWA 1XFQA 3LIEA 2I9VA 5IU1A 3EGXC 3CAXA 4GS9A 4P6ZS 3KO6A 1LT0A 3NOPC 1NLWA 3S7QA 3ICYA 2K2NA 1VB6A 4I38A 1UGUA 4EXOA 1V9ZA 2GZAA 4GJ4A 1STZA 3CI6A 4II7A 2EWVA 4CLCB 2V1BA 3EOIA 4F3LB 2W0NA 5KSHA 3LR5A 4P6ZM 1OPXA 4R70A 3VV4A 4BMWA 1TS0A 3U5VA 1ZHHB 2HF6A 3LFVA 1LSXA 3PXPA 4LRZE 3LICA 1T19A 3MF0A 2L1MA 1OT9A 3A0SA 5TBMA 4MN6A 4BBUA 2W1RA 2W3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4S A;  2QWS A;  1OTD A;  3K3C A;  5AVF A;  3H7W A;  1S66 L;  1GSW A;  5DJT A;  1N9O A;  4HNB A;  1OTE A;  4EEP A;  4NXF A;  2P7J A;  1XJ3 A;  1NLW B;  1GSV A;  4H6J B;  3B33 A;  1UWP X;  3UB8 A;  4EQ1 A;  2WKP A;  1XJ6 A;  1S1Y A;  4AYA A;  4EES A;  3MQO A;  4H10 B;  3K3D A;  5G4Y A;  2PYR A;  1MZU A;  4HY8 A;  5TBM B;  2JN7 A;  1N9L A;  3GDI A;  3VE4 A;  1MDY A;  4XT2 A;  2M1C A;  4KQD A;  2D01 A;  3H7W B;  3IBR A;  4GW9 A;  1AM9 A;  2A24 A;  3A0R A;  2VLG A;  1DP6 A;  5EYO A;  1BYW A;  3LIF A;  1X0O A;  3G6O A;  3UE6 A;  4JGR A;  2PR5 A;  4R38 A;  1N9N A;  3MR0 A;  2H28 A;  2WKR A;  3LIA A;  4R6L A;  3F1O B;  4RQ9 A;  4HH2 A;  4HJ4 A;  5HSQ A;  4KUO A;  3UB6 A;  3HJK A;  4EER A;  5DJU A;  1XFN A;  2HV1 A;  5F6A A;  3NHQ A;  4HOI A;  1MDY B;  5F5Y A;  2W27 A;  5J7E A;  3EEH A;  4GHI A;  2A24 B;  4HP9 A;  1OT6 A;  3UB7 A;  1XJ4 A;  4PKY A;  5AVE A;  3UB9 A;  3RH8 B;  5F68 A;  3H82 A;  2YKH A;  3CWF A;  4HH3 A;  3OLO A;  4BBV A;  2K7S A;  4DJ3 A;  1T1C A;  3LIB A;  5I5L A;  2V0U A;  3VE3 A;  2PDR A;  3ZQ5 A;  4NXE A;  4E04 A;  3BY9 A;  3PYP A;  5HDS A;  2KDK A;  4EW7 A;  5DKK A;  2V1A A;  4L9E A;  3ULF A;  4BBT A;  5IS1 A;  3NOT C;  4GHI B;  4HIA A;  3MFX A;  4LPZ A;  1D7E A;  2GJ3 A;  4WN5 A;  1OJ5 A;  3H82 B;  1P0Z A;  3NOU C;  1NKP A;  4GS9 B;  3MJQ A;  3PHY A;  4WF0 A;  3C8C A;  3LI8 A;  3F1N A;  2CMN A;  1UKL C;  1LSW A;  5EFW A;  1T18 A;  1T1A A;  1G28 A;  1A0A A;  3EWK A;  1R05 A;  5HWT A;  2L0W A;  1D06 A;  2V9A A;  1DRM A;  4PKY G;  3E4Q A;  2PHY A;  1NKP B;  3BY8 A;  4HJ3 A;  3GEC A;  1JNU A;  1LL8 A;  5I50 A;  1NWZ A;  2VV6 A;  4JGO A;  1DP9 A;  5HWV A;  2ZOI A;  3F1N B;  2JHE A;  2BAS A;  2V0W A;  3D72 A;  1P97 A;  4I3J A;  3MQQ A;  4NXG A;  2ZBB A;  5HZH A;  4XT2 B;  3E4P A;  1ODV A;  3HJI A;  1WA9 A;  5HD5 A;  2OOL A;  3NJA A;  3MXQ A;  4B9O A;  5G4Z A;  2Z6D A;  4I3I A;  4GCZ A;  4ATK A;  4HP4 A;  3UMD A;  4LRY C;  2PYP A;  4ATI A;  4ATH A;  5HDD A;  2EA9 A;  2J80 A;  3C2W A;  5F69 A;  3VOL A;  3LI9 A;  2MH3 A;  3IS2 A;  2OWH A;  2WKQ A;  2PD8 A;  1OJG A;  3LID A;  4H6J A;  4LLO B;  2INW A;  5KIZ A;  3MUJ A;  3F1P A;  2QJ5 A;  2R78 A;  2YKF A;  1GSX A;  3FG8 A;  2ZOH A;  2YPA A;  2B02 A;  4H10 A;  4MN5 A;  1UWN X;  3P7N A;  2PR6 A;  4EEU A;  2QJ7 A;  3SW1 A;  5I4Z A;  5DKL A;  5A8B A;  5HDC A;  1KOU A;  2PD7 A;  4WLA A;  3IS2 B;  1XJ2 A;  1TS6 A;  4HHD A;  2L4R A;  2LFH A;  4I39 A;  4NXB A;  1AN2 A;  4I3A A;  2OWJ A;  1S4R A;  4YWZ A;  2VV8 A;  1V9Y A;  4JGP A;  3F1P B;  2Z6C A;  4HQA A;  4WL9 A;  1F9I A;  5J3W A;  4JGQ A;  2YPB A;  3F1O A;  4M4X A;  2QHK A;  4L9F A;  1DP8 A;  2YPA B;  3E4O A;  3RTY A;  2VV7 A;  3LUQ A;  4KUK A;  5J4E A;  1S1Z A;  1EW0 A;  4K08 A;  2D02 A;  5HD3 A;  3FC7 A;  1OTB A;  4I5S A;  2VEA A;  2QL2 A;  1TS7 A;  1LSV A;  1S67 L;  3T50 A;  1TS8 A;  4HI4 A;  1OTI A;  4LRX C;  2YPB B;  1T1B A;  4F3L A;  1F98 A;  4DJ2 A;  3CLO A;  3LYX A;  1OTA A;  3BWL A;  3KX0 X;  3H9W A;  4HJ6 A;  3A0V A;  2QKP A;  4WUJ A;  4R3A A;  1HLO A;  1Y28 A;  4L9G A;  4EET B;  2KX6 A;  3UME A;  2QL2 B;  1AN4 A;  5HWW A;  1XFQ A;  3LIE A;  2I9V A;  5IU1 A;  3CAX A;  4GS9 A;  1LT0 A;  3NOP C;  1NLW A;  3ICY A;  1VB6 A;  4I38 A;  1UGU A;  4EXO A;  1V9Z A;  2V1B A;  4F3L B;  2W0N A;  4R70 A;  1TS0 A;  3U5V A;  1LSX A;  4LRZ E;  3LIC A;  1T19 A;  2L1M A;  1OT9 A;  3A0S A;  5TBM A;  4MN6 A;  4BBU A; 
#chains in the Genus database with same CATH topology
 1OTD A;  1GHI A;  5AVF A;  1WE4 A;  5HX9 A;  3H7W A;  3D3O A;  5FI7 A;  5DJT A;  4HNB A;  5L07 A;  3JVV A;  4CJN A;  1W8Q A;  5AQB A;  4PAU A;  2MJ6 A;  1S6R A;  2WKI A;  4C6Y A;  1L2S A;  3FZC A;  5CTM A;  3B33 A;  4Q8I A;  2WKP A;  2Y8H A;  3GVB A;  2HZ5 A;  4H10 B;  4XUX A;  3QNB A;  3IT9 A;  2PYR A;  5DVA A;  5CX7 A;  4BQM A;  1YLZ A;  4HY8 A;  4X1L A;  3TE8 A;  3MSH A;  3LR4 A;  1YLJ A;  2C6W B;  3CHW P;  3IBR A;  1AM9 A;  3NIA A;  3O87 A;  1I2W A;  4Q0I A;  3TJZ C;  3A0R A;  1DP6 A;  2XSS A;  4RA7 A;  4OP8 A;  1GA0 A;  3SZT A;  5K5B A;  1CEG A;  4IJG A;  4RYE A;  3CPT B;  2WKR A;  1M40 A;  3LIA A;  3VFF A;  2HPB A;  5HAQ A;  5FAP A;  2ZQ9 A;  4KUO A;  3NC8 A;  3HJK A;  5G18 A;  2GNX A;  3QP8 A;  5DF8 A;  2HV1 A;  5TR7 A;  5F6A A;  3NHQ A;  3DBA A;  5F5Y A;  5HPF A;  1FCM A;  5J7E A;  4GHI A;  4HP9 A;  1OT6 A;  4PKY A;  5F68 A;  2ZQD A;  3OLO A;  4BBV A;  2K7S A;  4N9L A;  1G6A A;  1U60 A;  3G30 A;  3UE3 A;  1VHM A;  1W79 A;  3FKW A;  3DW0 A;  5I5L A;  5EVI A;  1JWZ A;  1NJ4 A;  3SH7 A;  3W8K A;  1G6O A;  4S2P A;  1NZO A;  1K56 D;  4QU3 A;  4YFM A;  3BY9 A;  1KDW A;  3CUE C;  4YOF A;  3M2J A;  3PYP A;  2V2F F;  3LR0 A;  2Y79 A;  3A3J A;  2XQZ A;  3BRM A;  3M6H A;  3WRZ A;  2W3H A;  2KDK A;  1LL5 A;  1F5M A;  4MCW A;  2EXB A;  1BLS A;  5GL9 A;  2FH5 A;  1SCW A;  2ZM0 A;  4L9E A;  1KE3 A;  4UQI S;  2X01 A;  4HIA A;  4ZRR A;  4U3T A;  5M1A A;  5E2G A;  5M19 A;  3H82 B;  3HL9 A;  1EI5 A;  1P0Z A;  2WZZ A;  1MPL A;  3RXX A;  4OQ0 A;  2W1T B;  1SDN A;  1P9W A;  3UB5 P;  3PAE A;  5DF9 A;  4WF0 A;  5IT5 A;  1ZC2 A;  1IYQ A;  2WKE A;  1TEM A;  2JKT M;  2Y59 A;  2CMN A;  3T1X A;  1H0M A;  1UKL C;  4QY5 A;  1RGY A;  2Q0O A;  1LSW A;  3Q07 A;  5EFW A;  4LV3 A;  2B18 A;  3BQA A;  1T1A A;  3IBJ A;  3BLM A;  1IYO A;  1K54 C;  4EBL A;  3AGE A;  2KLI A;  2M7V A;  5CEC A;  3TRC A;  4GZB A;  2P08 A;  2V9A A;  4X55 A;  3PR6 A;  3E4Q A;  1XGI A;  2J3T C;  4HJ3 A;  4U0X A;  1H8Z A;  2QPN A;  4GD6 A;  1PWG A;  2UWX A;  5CGX A;  1DP9 A;  5LBR A;  2Q9M A;  3ZVW A;  4WMC D;  3CG5 A;  3HLF A;  1W5D A;  2Y2P A;  3EQU A;  1M6K A;  2JHE A;  3E0Y A;  4BL2 A;  4OH0 A;  2XFS A;  5CEB A;  3D72 A;  4KZ8 A;  3A3I A;  2OAP 1;  5E2E A;  5F82 A;  5HZH A;  4XT2 B;  5FEF A;  3E4P A;  5M18 A;  2J3T D;  4NG2 A;  3MXQ A;  4KG6 A;  4GCZ A;  2DCF A;  3UMD A;  3MKF A;  2XA7 M;  4ATH A;  4O8G A;  3S1Y A;  2WGI A;  1XXM A;  5GLD A;  2J80 A;  5TJJ A;  5KMW A;  5KSC A;  2NUT C;  2ZJ9 A;  2C5W B;  2GDN A;  2JE5 A;  3HLE A;  2A3U A;  3MXS A;  3G4P A;  4LV2 A;  4NET A;  1PI4 A;  2XK1 A;  5DFY A;  3F1P A;  2R78 A;  2G2U A;  1GSX A;  3T4J A;  2JKR M;  2BLS A;  1L0D A;  2P04 A;  2ZOH A;  4B4Z A;  2E8I A;  1O07 A;  3Q7V A;  2P9V A;  3PBQ A;  1W8Y A;  4H10 A;  4MN5 A;  2PRF A;  3G2Y A;  4MBK A;  1IEL A;  3P7N A;  4R4R A;  5DTT A;  4EEU A;  3MQ0 A;  4E3O A;  1LLB A;  3MKE A;  2WAF A;  4E6X A;  3PAG A;  5A8B A;  3T12 B;  4WLA A;  3DTK A;  3IF6 C;  1XJ2 A;  3S7N A;  2L4R A;  2ZQA A;  4I39 A;  3KYQ A;  2Z6C A;  2CC1 A;  1F9I A;  1BLC A;  3C38 A;  4JXG A;  2J9O A;  3JYI A;  3E4O A;  2VV7 A;  4UHU A;  1E3U A;  3A3F A;  3B42 A;  3V67 A;  4DE0 A;  4Z1W A;  1RP5 A;  4Y17 A;  1JVJ A;  4DXC A;  5HD3 A;  3NY4 A;  4WZ4 A;  2VEA A;  1PZO A;  5EPH A;  2ACG A;  4LGW A;  3OPP A;  3DTE A;  1LSV A;  3EEA A;  4N92 A;  4DXB A;  1W7F A;  1VET B;  4UA6 A;  4XXR A;  2R9X A;  3MMH A;  1F98 A;  2HDR A;  1IKI A;  3Q82 A;  3ZG5 A;  3KSH A;  5CHM A;  3LYX A;  4DN0 A;  3BWL A;  1ES2 A;  4Z9Q A;  1PWC A;  4WUJ A;  2FFF B;  1LL9 A;  3VP0 A;  3QP6 A;  3N8L A;  1FSW A;  2HDQ A;  5AQ7 A;  3BFC A;  5HWW A;  1K0K A;  1Z09 A;  2I9V A;  4E6W A;  4JPM A;  3BFE A;  5EV0 A;  4P6Z S;  4PM6 A;  1LT0 A;  2PAV P;  3HRE A;  3ICY A;  3N6I A;  3V3S A;  3AGF A;  1BSG A;  3UPO A;  4GJ4 A;  3BM6 A;  5I94 A;  1RCJ A;  3LR5 A;  1OPX A;  2EX6 A;  4BMW A;  4EUZ A;  1ZG6 A;  3U5V A;  3UY6 A;  2Y2O A;  4N1H A;  3MF0 A;  2L1M A;  1OT9 A;  4S2J A;  1FOF A;  5TBM A;  4X56 A;  4MN6 A;  4BBU A;  4CPK A;  4S2M A;  1YLW A;  2VGK A;  2QWS A;  3K3C A;  4DMZ A;  2WK0 A;  4QPR A;  3G32 A;  4Y5F A;  1OTE A;  4EEP A;  4E3N A;  1ERO A;  1HZO A;  2P7J A;  1YMS A;  3SS3 A;  1XJ3 A;  4CLC E;  2O9A A;  1XX2 A;  3HBR A;  5EE8 A;  4EBP A;  4P87 A;  1MWT A;  1ZTU A;  1NRF A;  4EQ1 A;  1XJ6 A;  1P9R A;  2HDU A;  3KSG A;  2VA0 A;  4AYA A;  4GOG A;  3Q7Z A;  4EES A;  4S2N C;  3MQO A;  4MLL A;  5TGF A;  5G4Y A;  2DMW A;  1MZU A;  1C3B A;  4MBH A;  4KG5 A;  2JN7 A;  3ZNT A;  1N9L A;  2M7U A;  4RVA A;  5HFO A;  4XT2 A;  2O9B A;  5EM0 A;  4MDZ A;  2D01 A;  4GW9 A;  2Y91 A;  2ZQC A;  4RX3 A;  1TDG A;  3GR2 A;  2VLG A;  5CXW A;  1GA9 A;  1TD5 A;  3WWX A;  2EX8 A;  3LY4 A;  3UPP A;  1Z6F A;  2G7U A;  3M2K A;  1HVB A;  2PR5 A;  1K57 C;  1KE0 A;  3HLG A;  3TSG A;  2H28 A;  1K6R A;  4GD8 A;  4HH2 A;  3NUL A;  2WAD A;  1K56 A;  4DRT A;  5HSQ A;  3LEQ A;  4EER A;  4GDN A;  4KZ6 A;  3NBL A;  4HOI A;  4X68 A;  5FAS A;  1MDY B;  4OPR A;  3S4X A;  3SH9 A;  4ZJ3 A;  5L10 A;  4C75 A;  4O01 A;  1KGF A;  3EEH A;  4WBG A;  2A24 B;  2ZMV A;  5AVE A;  3T1Q B;  1L0G A;  3ZFZ A;  4K0X A;  3VP4 A;  4B88 A;  3HLD A;  4JLF A;  3U4L P;  3N7W A;  4PM9 A;  1E25 A;  2EX2 A;  3T1R A;  3CUE A;  2PDR A;  4OQG A;  4PM5 A;  3ZQ5 A;  2H0Y A;  2VGL S;  4OOL A;  4NXE A;  3Q1F A;  1YLY A;  4S2K A;  3LO7 A;  1SKO A;  4U0T A;  1NLZ A;  3GSG A;  2HGV A;  4G3W A;  4IHQ A;  1XGJ A;  3C4O A;  5GHX A;  2ZMA A;  3ULF A;  4BBT A;  1N4O A;  1YSP A;  2GJ3 A;  4LPZ A;  4WN5 A;  2OLU A;  1OJ5 A;  2X02 A;  3NOU C;  1NKP A;  1TVF A;  4DDS A;  4N1X A;  4UQI M;  1FCN A;  3PBS A;  3T4Q A;  5A92 A;  3C8C A;  3G31 A;  4PM7 A;  1MC0 A;  1NZU A;  2NUP C;  3S7P A;  1KGG A;  2H0T A;  1K54 A;  2Y2Q A;  3UDF A;  1T18 A;  3T4S A;  4WZ5 A;  4E3M A;  2JBF A;  1PRQ A;  3EWK A;  4NKP A;  5HWT A;  1D06 A;  3O88 A;  4PKY G;  1CJF A;  3Q81 A;  5DF7 A;  3PBT A;  1JNU A;  3ZVT A;  1LL8 A;  2K31 A;  3MZE A;  1PI5 A;  1TDL A;  5FAQ A;  4AFI A;  4JF6 A;  4NK3 A;  3F1N B;  2V1Z A;  3VFH A;  4KZ5 A;  1PWD A;  4P0M A;  2V0W A;  1MWS A;  3MQQ A;  1OME A;  4NXG A;  4R4S A;  1ODV A;  2XFT A;  3R4K A;  2QMI A;  3NJA A;  4B9O A;  5G4Z A;  2XGN A;  2Z6D A;  3BFD A;  4CLC C;  1KGE A;  2W3D A;  4LRY C;  2PYP A;  1AWI A;  4GLQ A;  2ZQ8 A;  3C2W A;  1ERM A;  1PW8 A;  3GMW A;  1G5U A;  1MKM A;  3DWZ A;  3VOL A;  3S7O A;  3IS2 A;  4K0W A;  1K38 A;  1ALQ A;  1Y4O A;  4MEZ A;  3OPH A;  2INW A;  5FAO A;  4B4X A;  3PBO A;  4HES A;  5EVL A;  3ZGA B;  4B93 A;  5CGS A;  4CLC D;  1H8M A;  5F1G A;  2YPA A;  3DWK A;  2H10 A;  2RL3 A;  1UWN X;  2E8J A;  2QJ7 A;  2XF3 A;  3UN7 A;  2ZC5 B;  3VSK A;  2Z2M B;  3IF6 A;  3HCY A;  3KYZ A;  3NDG A;  3R7W B;  3TW8 A;  4HHD A;  2LFH A;  4ARZ B;  4NXB A;  3MXR A;  1IKG A;  4OON A;  3C30 A;  1V9Y A;  1ES4 A;  4YWZ A;  1CI9 A;  3IXG A;  2VGJ A;  2EFX A;  4Y0T A;  4HQA A;  4WL9 A;  3O5Y A;  2HP9 A;  5FEG A;  3T4O A;  3ZCZ A;  2DNS A;  3EGD C;  4BLM A;  3FYZ A;  3LUQ A;  3G34 A;  3I7J A;  2D02 A;  3IXB A;  2WKH A;  3T4L A;  4I5S A;  3WS2 A;  2QL2 A;  1J9M A;  4YIN A;  1FSY A;  1TS7 A;  2J7V A;  2JCH A;  4Q0H A;  3UO9 A;  2HP6 A;  1PYY A;  1S67 L;  4XUZ A;  3RJU A;  2W3E A;  2Y2I A;  1ONG A;  3OC2 A;  1K6S A;  2YPB B;  3LY3 A;  1WYC A;  4ID4 A;  4O0P A;  2BG1 A;  2XLN A;  3GTC A;  1YKD A;  4DJ2 A;  2Y2L A;  4OOY A;  3CLO A;  5FQ9 A;  1NLY A;  5HPI A;  1DY6 A;  1XPB A;  4HJ6 A;  3G35 A;  2QKP A;  5CTN A;  1ES3 A;  1KE4 A;  1SDE A;  3V39 A;  4EET B;  4YNR A;  5L2F A;  2XD5 A;  3UME A;  2A2L A;  2WGW B;  4GKU A;  2ZM2 A;  3BEB A;  2Y55 A;  1XFQ A;  1ESI A;  5IU1 A;  3EGX C;  3CAX A;  4X69 A;  2Z2L B;  3NEC A;  3NOP C;  3S7Q A;  1VB6 A;  4EXO A;  2GZA A;  3SS5 A;  5EVI C;  1PNE A;  4KEN B;  3CI6 A;  4II7 A;  3VP2 A;  3OPR A;  4CLC B;  1KVM A;  4F3L B;  1YPR A;  5KSH A;  1AXB A;  4P6Z M;  1ZHH B;  3HLW A;  1LSX A;  3V50 A;  4S2O A;  2FFY A;  3A0S A;  2WZX A;  4UAA A;  4Y0U A;  2W1R A;  2W3F A;  4E3K A;  1S4S A;  5HW3 A;  1S66 L;  4E3L A;  1WYB A;  1GSW A;  1N9O A;  5A93 A;  4NXF A;  1HTZ A;  2GX5 A;  4IUK A;  1NLW B;  5EVI D;  4H6J B;  4GNU A;  4GB7 A;  1MWR A;  3CPT A;  2J8Y A;  4FH2 A;  5GHY A;  1S1Y A;  5J8X A;  2BTF P;  1K25 A;  5FDH A;  1L3L A;  3IXH A;  1YMX A;  1FIL A;  2ZL1 B;  1NRJ A;  2ZQ7 A;  4RX2 A;  2PT7 A;  4KQD A;  3H7W B;  4OKP A;  3BLS A;  1FIK A;  1K4F A;  5EYO A;  3LIF A;  3CJM A;  2XEP A;  1X0O A;  1K57 A;  1VQQ A;  4IVK A;  5CED A;  4R38 A;  4G3V A;  1LI9 A;  4E3J A;  3MR0 A;  3TG9 A;  4R6L A;  4KZ7 A;  3O3V A;  3F1O B;  3WS4 A;  4HJ4 A;  5EEC A;  1FR6 A;  3UB6 A;  1XFN A;  4R23 A;  1VM1 A;  1ACF A;  4R3B A;  3VMA A;  3BQ8 A;  4UA7 A;  2PBD P;  3CIT A;  2JKT I;  2W27 A;  3C7U A;  2XH9 A;  4GDB A;  3VOY A;  1LI0 A;  3UB7 A;  3U2A A;  1Q2Q A;  1XJ4 A;  3H82 A;  4PPR A;  3RH8 B;  2YKH A;  3KYE A;  1D1J A;  4DKI A;  3CWF A;  4BL3 A;  2W1T A;  3ZHH A;  2WAE A;  4DJ3 A;  1T1C A;  3RFB A;  3LIB A;  1YSQ A;  2V0U A;  5GLC A;  3IHB A;  3VE3 A;  5GLB A;  2RCX A;  1K4E A;  3R7W A;  1TF1 A;  5AQ9 A;  4HBU A;  2EWW A;  1GHM A;  3OOV A;  4ZDX A;  5HDS A;  5AJG A;  4PMA A;  1KDS A;  1K55 C;  1IYP A;  3PBR A;  3B3X A;  4WEJ A;  4ARZ A;  4EW7 A;  4KZB A;  2VGL M;  1JWP A;  3ZG9 B;  5IS1 A;  3NOT C;  4GHI B;  1D7E A;  3MBZ A;  3A3E A;  3E98 A;  4JXW A;  4GS9 B;  3MJQ A;  3PHY A;  3V3R A;  5EVI B;  2ZLY A;  2R9W A;  4X25 A;  1H8Y A;  3T4K A;  3T1S A;  1NYY A;  3W2Z A;  3A3D A;  3AGD A;  3FV7 A;  5CER A;  4ME4 A;  4ZAM A;  3IH9 A;  2OV5 A;  3IX4 A;  5JYP A;  2ZMF A;  1A0A A;  4FUW A;  4H8R A;  2IWC A;  2L0W A;  4EU0 A;  2PBY A;  1GHP A;  4KZA A;  5EVE A;  1SZV A;  4GN2 A;  5JYO A;  2PHY A;  3GEC A;  3UPN A;  4QHC A;  4Y3I A;  5I50 A;  2VV6 A;  4Q0J A;  5CHJ A;  5HWV A;  3DTI A;  2V8C A;  2JKR I;  3IHA A;  3OZH A;  2OAQ 1;  2Y2M A;  2O99 A;  3JVU A;  3HLC A;  2BAS A;  4UA9 A;  3C4P A;  4OVD A;  1P97 A;  1ESU A;  1BZA A;  4HEF A;  4S2L A;  1S0W A;  3LCE A;  2ZBB A;  5FQK A;  1XKZ A;  1SKF A;  1F2K A;  2OOL A;  3ZNY A;  3IWQ A;  4ZJ2 A;  4IUH A;  4EWF A;  4KQR A;  2KOI A;  5TFQ A;  4ATK A;  4HP4 A;  1E3U D;  2EA9 A;  2ZC4 B;  4Y13 A;  3O86 A;  5F69 A;  3BJN A;  1Q2P A;  5AQA A;  3FPW A;  1O7E A;  4R3J A;  3LI9 A;  4G3K A;  4DDY A;  3WS5 A;  2OWH A;  2WKQ A;  3GV9 A;  5GLA A;  2PD8 A;  1OJG A;  2Y2K A;  2O9C A;  4FOF A;  4H6J A;  1ONH A;  4LLO B;  5KIZ A;  3MUJ A;  2QJ5 A;  4OLG A;  5U47 A;  1CQA A;  1XA1 A;  2X71 A;  3IX3 A;  4FD8 A;  4OQI A;  4LCM A;  2PR6 A;  3ZG8 B;  4WMC A;  1ZKJ A;  5DKL A;  4A5R A;  4DE1 A;  4WM9 A;  5HDC A;  2PD7 A;  3N4I A;  2EXA A;  2UV0 E;  4Y0O A;  4X53 A;  1AN2 A;  2OWJ A;  2VV8 A;  4IBX A;  4JGP A;  2ZM8 A;  3F1P B;  1VET A;  4X1M A;  5FQM A;  5J3W A;  2LB9 A;  2EX9 A;  3F1O A;  4M4X A;  2QHK A;  3Q7V B;  4L9F A;  1DP8 A;  2P9V B;  3RTY A;  1XA7 A;  4LFU A;  4JXS A;  2ZD8 A;  4IVI A;  4R1G A;  5J4E A;  4D60 A;  1S1Z A;  3KSI A;  4Y2F A;  4WEL A;  2IA2 A;  3OCN A;  3UDI A;  5CRF A;  2VZW A;  3BFG A;  3NDE A;  5L8M A;  3HUN A;  1QME A;  4BEN A;  3K2N A;  4FSF A;  3ZDJ A;  4EUV A;  4HI4 A;  1OTI A;  4LRX C;  1H3Q A;  1JTG A;  1T1B A;  4NEE D;  3TOI A;  4JF5 A;  3UDX A;  1RGZ A;  3B47 A;  4BWI A;  3ITB A;  4Y7P A;  1OTA A;  3T4T A;  5DTS A;  4R3A A;  1YLT A;  1HLO A;  5FQQ A;  4MMN A;  4L9G A;  1NY0 A;  4QB8 A;  4GS9 A;  3KO6 A;  2K2N A;  3VSL A;  1UGU A;  3N8R A;  3E2L A;  4BD1 A;  1STZ A;  4Y15 A;  2EWV A;  3GQZ A;  2J9P A;  4R70 A;  3LFV A;  1G68 A;  2HF6 A;  3BEC A;  4OPZ A;  3LIC A;  3IWO A;  4JF4 A;  3QHY A;  4E3I A;  3UE0 A;  2XD1 A;  1CK3 A;  4JBF A;  3D4F A;  4OPY A;  1MXO A;  1L0F A;  2JKG A;  3WS1 A;  1JWV A;  3HVF A;  4BJP A;  1YT4 A;  1IYS A;  5FI6 A;  3KSF A;  2AVX A;  1GSV A;  1UWP X;  3UB8 A;  3IQA A;  2HP5 A;  5A91 A;  1L0E A;  5L09 A;  4KZ4 A;  3VP3 A;  3VP1 A;  3K3D A;  3QP5 A;  4CQH A;  5HAP A;  5FDS A;  5TBM B;  3GDI A;  1VEU B;  4WYY A;  3VE4 A;  4WZ5 C;  1MDY A;  2M1C A;  1GCE A;  4KZ9 A;  3IX8 A;  2A24 A;  2DRW A;  3BFF A;  1BYW A;  4MBF A;  2H5S A;  3G6O A;  4FH4 A;  3UE6 A;  5FSR A;  4JGR A;  1N9N A;  5FA7 A;  3UE1 A;  4PHT A;  5F83 A;  3NI9 A;  3HUM A;  4RQ9 A;  5EOO A;  4WEK A;  2PU2 A;  2WGV A;  5DJU A;  1ZZA A;  1HD8 A;  3E2K A;  3DAV A;  3GRJ A;  3ISG A;  3QNC A;  1MKI A;  3IXD A;  1NYM A;  4QWO A;  2JC7 A;  5HL1 A;  2Q9N A;  3FPV A;  3D9Y A;  4S2I A;  3UB9 A;  1ZG4 A;  3IF5 A;  2XRN A;  4HH3 A;  2VJW A;  2QZ6 A;  1DJB A;  3OPL A;  1PFL A;  2J3W A;  4F94 A;  1PZP A;  2PU4 A;  4LCL A;  3WRT A;  4DF6 A;  1DJA A;  4E04 A;  3SOI A;  1HLU P;  4LV0 A;  3OCL A;  3MFD A;  1K55 A;  3M6B A;  2Y2J A;  2B5R A;  3CMZ A;  2OSU A;  1K1F A;  3PTE A;  1PW1 A;  2XRO A;  1JTD A;  5DKK A;  2V1A A;  3HUO A;  4IBR A;  4M3K A;  2A49 A;  4KG2 A;  4ETX A;  3MFX A;  1NXY A;  1W63 Q;  1BTL A;  1FCO A;  1BUE A;  1BLP A;  4FTX A;  3ITA A;  4LV1 A;  1IFQ A;  3SS4 A;  2W3G A;  3LI8 A;  4S2N A;  3P09 A;  3PBN A;  3F1N A;  4KZ3 A;  2Y2N A;  3OBF A;  1CEF A;  1SKO B;  5FI2 A;  4P85 A;  2ZC6 B;  1EWZ A;  2EFU A;  1G28 A;  1ES5 A;  5DFX A;  1R05 A;  2ZC3 B;  3EQV A;  3FWL A;  4KQO A;  1DRM A;  1PIO A;  3ZG7 B;  2VKS A;  1MY8 A;  1XP4 A;  4QJG A;  1NKP B;  3BY8 A;  2Y4A A;  3P01 A;  2O0Y A;  1J3W A;  5HAI A;  4PM8 A;  1NWZ A;  4JGO A;  5CGW A;  2IWD A;  4OQH A;  3ZG0 A;  2ZOI A;  4ESP A;  4C3Q A;  3N8S A;  2ZC7 A;  4OPQ A;  5E2F A;  3FKV A;  4EBN A;  4MN7 A;  2FZ0 A;  1FR1 A;  3L9K A;  4I3J A;  3NCK A;  1BT5 A;  3P98 A;  4ETZ A;  3ZYT A;  2XA7 S;  4OOM A;  3JPU A;  1KVL A;  1BUL A;  3MZD A;  3HJI A;  2V20 A;  1WA9 A;  5HD5 A;  1CF0 A;  5EOE A;  5A90 A;  5FL3 A;  2B95 A;  4I3I A;  4D2O A;  3L7H A;  4ATI A;  5HDD A;  5FAT A;  2QYB A;  5E2H A;  4DE2 A;  2HJE A;  3BW6 A;  5HL6 A;  3WS0 A;  2MH3 A;  2OLV A;  1DJC A;  5CHU A;  5F1F A;  2G2W A;  2HJ9 C;  4LEN A;  4QD4 A;  4EQI A;  3DTM A;  3LID A;  1CI8 A;  1MWU A;  2LB5 A;  3LR3 A;  5E43 A;  2YKF A;  5KZH A;  3SH8 A;  1BLH A;  3FG8 A;  1SHV A;  1MBL A;  3IH8 A;  1Y54 A;  4FCF A;  1E4D A;  5HAR A;  4K91 A;  2B02 A;  4OLD A;  1IEM A;  1YQS A;  1VEU A;  4ZTK A;  3SW1 A;  3MS6 A;  3LGO A;  5I4Z A;  5BOH A;  1KOU A;  4L0L A;  1W63 M;  3IS2 B;  4KQQ A;  1ERQ A;  1N9B A;  1TS6 A;  1FQG A;  1QMF A;  3UNW A;  3RXW A;  4I3A A;  4MNR A;  1S4R A;  4R0Q A;  3HLB A;  2WUQ A;  2Y2G A;  4JGQ A;  2XDM A;  2YPB A;  2HDS A;  2YPA B;  3LEZ A;  4ZBE A;  2WYX A;  4UEY A;  5MC7 A;  4N9K A;  5IHV A;  4HBT A;  4KUK A;  3QP1 A;  5GHZ A;  1EW0 A;  4K08 A;  3IF6 B;  3FC7 A;  1YLP A;  2VX8 A;  1OTB A;  5FQJ A;  3IWI A;  1LHY A;  2WGW A;  3W4P A;  3QP4 A;  4QY6 A;  3V5M A;  5FQI A;  3VOZ A;  3T50 A;  4DE3 A;  1TS8 A;  2XR0 A;  4CLC A;  4F3L A;  3MZF A;  4BD0 A;  4ZJ1 A;  1YM1 A;  2IWB A;  4O7D A;  3CZD A;  5DTK A;  5EUA A;  3KX0 X;  1A0K A;  3H9W A;  3A0V A;  1YAX A;  5C5K A;  1H5X A;  3S22 A;  1Y28 A;  3C5A A;  3QP2 A;  2KX6 A;  1IOU A;  4X6T A;  2QL2 B;  1AN4 A;  4JKT A;  2JKF A;  3LIE A;  2Y2H A;  3W4Q A;  1NLW A;  4EV4 A;  4I38 A;  4OP5 A;  1V9Z A;  1I2S A;  2VK3 A;  2V8F A;  3G2Z A;  5EM1 A;  2I72 A;  2V1B A;  3EOI A;  2P74 A;  2W0N A;  3VV4 A;  1TS0 A;  4P6B A;  4IED A;  3PXP A;  4LRZ E;  4JXV A;  3BYD A;  1T19 A;  1I5Q A;  2ZL1 A;  3C7V A;  5D3O A;  3W4O A; 
#chains in the Genus database with same CATH homology
 1S4S A;  2QWS A;  1OTD A;  3K3C A;  5AVF A;  4DMZ A;  3H7W A;  1S66 L;  3D3O A;  4QPR A;  1GSW A;  5DJT A;  1N9O A;  4Y5F A;  4HNB A;  1OTE A;  4EEP A;  3JVV A;  4BJP A;  4PAU A;  4NXF A;  2MJ6 A;  2P7J A;  2GX5 A;  3KSF A;  4IUK A;  1XJ3 A;  1NLW B;  4CLC E;  1GSV A;  2O9A A;  4H6J B;  3B33 A;  1UWP X;  1ZTU A;  3UB8 A;  4EQ1 A;  2WKP A;  1XJ6 A;  1S1Y A;  1P9R A;  2Y8H A;  3KSG A;  2VA0 A;  4AYA A;  4EES A;  3MQO A;  4H10 B;  3K3D A;  5G4Y A;  2DMW A;  4CQH A;  2PYR A;  1MZU A;  5CX7 A;  4HY8 A;  3TE8 A;  5TBM B;  2JN7 A;  1N9L A;  3GDI A;  1NRJ A;  2M7U A;  3LR4 A;  3VE4 A;  1MDY A;  2PT7 A;  2O9B A;  4XT2 A;  2M1C A;  4KQD A;  4MDZ A;  2D01 A;  3H7W B;  3IBR A;  4GW9 A;  1AM9 A;  2A24 A;  4Q0I A;  3TJZ C;  3A0R A;  2VLG A;  1DP6 A;  2XSS A;  5EYO A;  1TD5 A;  1BYW A;  3LIF A;  5K5B A;  1X0O A;  2G7U A;  3G6O A;  3UE6 A;  4IJG A;  4JGR A;  2PR5 A;  4R38 A;  1N9N A;  4G3V A;  4PHT A;  3MR0 A;  2H28 A;  2WKR A;  3LIA A;  4R6L A;  3F1O B;  4RQ9 A;  4HH2 A;  4HJ4 A;  5HSQ A;  4KUO A;  3UB6 A;  3HJK A;  4WEK A;  4EER A;  5DJU A;  1XFN A;  2GNX A;  2HV1 A;  5F6A A;  3BQ8 A;  3CIT A;  3NHQ A;  3DBA A;  4HOI A;  1MDY B;  5F5Y A;  2JKT I;  2W27 A;  5HPF A;  4O01 A;  5J7E A;  3EEH A;  4GHI A;  3FPV A;  2A24 B;  2ZMV A;  4HP9 A;  1OT6 A;  3UB7 A;  3U2A A;  1XJ4 A;  4PKY A;  5AVE A;  3UB9 A;  3H82 A;  5F68 A;  3RH8 B;  2YKH A;  3CWF A;  2XRN A;  4HH3 A;  3OLO A;  4BBV A;  2K7S A;  2VJW A;  2W1T A;  3UE3 A;  1VHM A;  4DJ3 A;  1T1C A;  3RFB A;  2J3W A;  3LIB A;  5I5L A;  1YSQ A;  2V0U A;  3VE3 A;  3CUE A;  2PDR A;  3ZQ5 A;  1G6O A;  2VGL S;  4OOL A;  4NXE A;  4E04 A;  3BY9 A;  3CUE C;  4YOF A;  3R7W A;  1TF1 A;  3OCL A;  3PYP A;  2EWW A;  3OOV A;  3LR0 A;  2Y79 A;  5HDS A;  1NLZ A;  5AJG A;  2HGV A;  2W3H A;  2KDK A;  4G3W A;  1F5M A;  4MCW A;  4IHQ A;  3PBR A;  2XRO A;  4ARZ A;  4WEJ A;  4EW7 A;  5DKK A;  2FH5 A;  2VGL M;  2V1A A;  4L9E A;  3ULF A;  4BBT A;  5IS1 A;  4UQI S;  4ETX A;  3NOT C;  4GHI B;  4HIA A;  3MFX A;  1YSP A;  1D7E A;  2GJ3 A;  4LPZ A;  4ZRR A;  1W63 Q;  4WN5 A;  1OJ5 A;  3H82 B;  1P0Z A;  3NOU C;  3E98 A;  1NKP A;  2W1T B;  4GS9 B;  1P9W A;  3MJQ A;  3PHY A;  4UQI M;  5DF9 A;  1IFQ A;  3PBS A;  4WF0 A;  5IT5 A;  3T4Q A;  3T4K A;  3C8C A;  2W3G A;  3LI8 A;  3W2Z A;  2JKT M;  3PBN A;  1MC0 A;  3F1N A;  2CMN A;  1UKL C;  2NUP C;  3S7P A;  1LSW A;  5EFW A;  4ME4 A;  3OBF A;  2B18 A;  3BQA A;  1T18 A;  1T1A A;  2ZMF A;  3IBJ A;  3T4S A;  1G28 A;  1A0A A;  3EWK A;  5DFX A;  1R05 A;  4NKP A;  5HWT A;  2L0W A;  2KLI A;  3EQV A;  2M7V A;  3TRC A;  4KQO A;  4EU0 A;  1D06 A;  2P08 A;  2V9A A;  1DRM A;  3PR6 A;  4PKY G;  2VKS A;  3E4Q A;  2PHY A;  2J3T C;  1NKP B;  3BY8 A;  4HJ3 A;  3GEC A;  3P01 A;  3PBT A;  1JNU A;  2O0Y A;  1LL8 A;  4Y3I A;  2K31 A;  5I50 A;  1NWZ A;  2VV6 A;  4JGO A;  4Q0J A;  1DP9 A;  5LBR A;  5HWV A;  4AFI A;  2JKR I;  3EQU A;  2OAQ 1;  2ZOI A;  3F1N B;  2JHE A;  3E0Y A;  2O99 A;  3JVU A;  2BAS A;  2V0W A;  3D72 A;  1P97 A;  4MN7 A;  2FZ0 A;  4I3J A;  3MQQ A;  2OAP 1;  4NXG A;  4ETZ A;  2ZBB A;  5HZH A;  4XT2 B;  3ZYT A;  2XA7 S;  4OOM A;  3E4P A;  1ODV A;  3HJI A;  3R4K A;  1WA9 A;  2J3T D;  5HD5 A;  2OOL A;  3NJA A;  3MXQ A;  4B9O A;  5G4Z A;  2Z6D A;  4IUH A;  5FL3 A;  4I3I A;  4GCZ A;  2KOI A;  4ATK A;  4CLC C;  4HP4 A;  3UMD A;  2W3D A;  2XA7 M;  4LRY C;  2PYP A;  4ATI A;  4GLQ A;  4ATH A;  4O8G A;  5HDD A;  2EA9 A;  2J80 A;  5TJJ A;  3C2W A;  5F69 A;  3BJN A;  1MKM A;  2NUT C;  2QYB A;  3FPW A;  3VOL A;  2HJE A;  3BW6 A;  5HL6 A;  3LI9 A;  2MH3 A;  4G3K A;  3S7O A;  3IS2 A;  2HJ9 C;  2OWH A;  2WKQ A;  2PD8 A;  1OJG A;  3LID A;  2O9C A;  4FOF A;  2LB5 A;  3LR3 A;  4H6J A;  4LLO B;  2INW A;  5KIZ A;  3PBO A;  5DFY A;  3MUJ A;  3F1P A;  2QJ5 A;  4B93 A;  2R78 A;  2YKF A;  1GSX A;  3T4J A;  2JKR M;  3FG8 A;  2P04 A;  4CLC D;  1H8M A;  2ZOH A;  2YPA A;  3PBQ A;  2B02 A;  4H10 A;  4MN5 A;  1UWN X;  3P7N A;  2PR6 A;  4EEU A;  3MQ0 A;  2QJ7 A;  3SW1 A;  5I4Z A;  5DKL A;  5A8B A;  5HDC A;  3HCY A;  1KOU A;  2PD7 A;  3KYZ A;  4WLA A;  4L0L A;  1W63 M;  3R7W B;  3IS2 B;  3TW8 A;  1XJ2 A;  1TS6 A;  4HHD A;  3S7N A;  2L4R A;  2LFH A;  4ARZ B;  4I39 A;  4NXB A;  1AN2 A;  2OWJ A;  3KYQ A;  1S4R A;  2VV8 A;  1V9Y A;  3C30 A;  4I3A A;  3F1P B;  4JGP A;  2Z6C A;  4YWZ A;  4HQA A;  4WL9 A;  1F9I A;  3O5Y A;  5J3W A;  4JGQ A;  3T4O A;  3C38 A;  2LB9 A;  2YPB A;  3F1O A;  4M4X A;  2QHK A;  4L9F A;  1DP8 A;  2YPA B;  3E4O A;  3EGD C;  3RTY A;  2VV7 A;  4UEY A;  5MC7 A;  3LUQ A;  3B42 A;  3V67 A;  4KUK A;  5J4E A;  1S1Z A;  1EW0 A;  3KSI A;  4Z1W A;  4K08 A;  2D02 A;  5HD3 A;  3FC7 A;  4Y2F A;  4WEL A;  2IA2 A;  1OTB A;  2VX8 A;  3OCN A;  3T4L A;  4I5S A;  2VEA A;  2QL2 A;  2VZW A;  1TS7 A;  4Q0H A;  5L8M A;  1LSV A;  3EEA A;  1S67 L;  3K2N A;  4FSF A;  4EUV A;  3T50 A;  1TS8 A;  2W3E A;  4HI4 A;  3OC2 A;  1OTI A;  4LRX C;  2YPB B;  1H3Q A;  4O0P A;  1T1B A;  4NEE D;  3MMH A;  4CLC A;  4F3L A;  1F98 A;  1YKD A;  4DJ2 A;  4BWI A;  3B47 A;  3KSH A;  3CLO A;  3LYX A;  4DN0 A;  1NLY A;  1OTA A;  3BWL A;  3T4T A;  3KX0 X;  5HPI A;  3H9W A;  4HJ6 A;  3A0V A;  2QKP A;  4WUJ A;  1YAX A;  4R3A A;  5C5K A;  1HLO A;  1Y28 A;  4MMN A;  4L9G A;  4EET B;  4YNR A;  2KX6 A;  1IOU A;  3UME A;  2QL2 B;  2A2L A;  1AN4 A;  5HWW A;  1XFQ A;  3LIE A;  2I9V A;  5IU1 A;  3EGX C;  3CAX A;  4GS9 A;  4P6Z S;  3KO6 A;  1LT0 A;  3NOP C;  1NLW A;  3S7Q A;  3ICY A;  2K2N A;  1VB6 A;  4I38 A;  1UGU A;  4EXO A;  1V9Z A;  2GZA A;  4GJ4 A;  1STZ A;  3CI6 A;  4II7 A;  2EWV A;  4CLC B;  2V1B A;  3EOI A;  4F3L B;  2W0N A;  5KSH A;  3LR5 A;  4P6Z M;  1OPX A;  4R70 A;  3VV4 A;  4BMW A;  1TS0 A;  3U5V A;  1ZHH B;  2HF6 A;  3LFV A;  1LSX A;  3PXP A;  4LRZ E;  3LIC A;  1T19 A;  3MF0 A;  2L1M A;  1OT9 A;  3A0S A;  5TBM A;  4MN6 A;  4BBU A;  2W1R A;  2W3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...