4F3LA

Crystal structure of the heterodimeric clock:bmal1 transcriptional activator complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
343
structure length
319
Chain Sequence
SEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMAL1b
publication title Crystal structure of the heterodimeric CLOCK:BMAL1 transcriptional activator complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/activator
total genus 94
structure length 319
sequence length 343
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00010 HLH Helix-loop-helix DNA-binding domain
A PF00989 PAS PAS fold
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4f3lA03
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 4f3lA01
4M4XA 4I3JA 1DP6A 1AM9A 2WKQA 1D06A 2WKPA 5HWVA 1WA9A 3A0VA 1TS8A 3LIAA 3CAXA 4I5SA 4L9GA 3HJIA 2VLGA 1UWNX 3VE3A 3EWKA 4BBTA 2H28A 2PD8A 1N9OA 1XJ4A 1P0ZA 3NOPC 1NLWA 1S1YA 2PDRA 2MH3A 1GSXA 4L9EA 4K08A 2EA9A 2ZOHA 1TS0A 3VOLA 1ODVA 4HP4A 2LFHA 4EESA 4XT2B 4JGQA 2L1MA 3E4QA 1T1BA 4ATKA 3MUJA 1GSVA 2Z6CA 2INWA 4XT2A 3UB8A 2PD7A 3IS2B 3CWFA 4KUKA 2VV7A 3IS2A 1AN4A 3H9WA 4HI4A 3UB6A 2M1CA 3OLOA 2YPBB 2W0NA 5HWWA 3MJQA 3BY9A 1S4SA 1DP9A 4EW7A 1OJGA 4E04A 4H10B 5A8BA 3LYXA 4HH3A 1OTIA 3F1NB 3UMDA 3A0SA 1GSWA 4WUJA 4B9OA 3E4PA 1T1CA 4DJ2A 3BWLA 4HHDA 3FC7A 2QJ7A 4MN5A 5J7EA 1G28A 1XFNA 4GCZA 1T1AA 4JGOA 3NOUC 4HOIA 2B02A 1F98A 4GHIA 4HH2A 2V0UA 1N9NA 4WN5A 3NOTC 2PHYA 2PYPA 5HDCA 3F1PB 4MN6A 1VB6A 4PKYG 3F1OB 3F1PA 1TS6A 3F1OA 4HJ3A 4YWZA 3D72A 3MR0A 4NXGA 5I5LA 3MQQA 1LSXA 5HDSA 4H6JB 3UE6A 4R38A 1MDYB 4H6JA 1LSWA 4LPZA 3VE4A 4NXFA 1MDYA 2YKHA 3HJKA 4PKYA 1EW0A 2OWJA 5KIZA 5TBMB 1NLWB 2OWHA 5TBMA 2WKRA 4R70A 3K3DA 5F6AA 5I50A 5G4ZA 4I38A 5HD5A 2YPAB 4WF0A 2YPAA 4I3AA 1XFQA 1V9YA 2A24B 5HDDA 4BBUA 4KUOA 4BBVA 3K3CA 1UGUA 5F68A 2A24A 1X0OA 1OTBA 3P7NA 4HJ6A 1KOUA 4F3LB 1V9ZA 2J80A 5HSQA 2QWSA 4HP9A 4F3LA 5HD3A 3U5VA 2JN7A 2YKFA 1Y28A 2L0WA 3MFXA 1DP8A 1AN2A 2V0WA 4R6LA 1LL8A 2V1BA 2R78A 3H7WA 3GECA 5EYOA 4LRZE 4GS9A 4JGRA 4LRYC 1S66L 2QL2B 2HV1A 4I3IA 1S4RA 1JNUA 2QL2A 4LRXC 4GHIB 3LIBA 2BASA 3LIEA 2Z6DA 5J4EA 3LIFA 4ATIA 3IBRA 4EERA 1XJ6A 2PR6A 3NHQA 3FG8A 3LUQA 2KDKA 1DRMA 1D7EA 3MXQA 5HWTA 3SW1A 4EEPA 5DKLA 3LIDA 3LI8A 2GJ3A 2VV6A 3UB7A 2QJ5A 4NXEA 4EXOA 2PYRA 3LI9A 3UB9A 5DJUA 4ATHA 3ICYA 3H82B 5AVFA 1MZUA 2K7SA 1T18A 4KQDA 3EEHA 1T19A 3H82A 3KX0X 1LT0A 1S1ZA 3ZQ5A 2CMNA 2QKPA 3CLOA 1OJ5A 2VV8A 5DKKA 5IS1A 4R3AA 4DJ3A 4HY8A 1OTDA 2V1AA 3BY8A 5F5YA 3G6OA 3E4OA 4JGPA 5HZHA 1R05A 1HLOA 5F69A 3A0RA 3MQOA 3LICA 2JHEA 2D02A 2PR5A 4AYAA 4LLOB 1XJ3A 4HIAA 4NXBA 2OOLA 2I9VA 2V9AA 1N9LA 4GW9A 1OTEA 5DJTA 1BYWA 5IU1A 2L4RA 4RQ9A 1OT6A 4I39A 1F9IA 5J3WA 3ULFA 1TS7A 1UKLC 5AVEA 4EEUA 3PHYA 2QHKA 1S67L 3H7WB 3C8CA 4GS9B 3GDIA 2P7JA 4EQ1A 4WL9A 4L9FA 2W27A 4HNBA 2ZBBA 4HQAA 5G4YA 2YPBA 3PYPA 3RH8B 3RTYA 1LSVA 3C2WA 3B33A 4H10A 2KX6A 1A0AA 1NWZA 1NKPB 3F1NA 1P97A 5I4ZA 1UWPX 2D01A 3NJAA 1NKPA 3UMEA 1OTAA 2VEAA 1XJ2A 4HJ4A 1OT9A 4EETB 5EFWA 3T50A 4WLAA 2ZOIA
chains in the Genus database with same CATH superfamily
4OOLA 1BZAA 4M4XA 2WKHA 4I3JA 1K57A 1G6OA 2ACGA 4Y5FA 4OKPA 3BFEA 4IUKA 3DBAA 2EFXA 1DP6A 4ETZA 1AM9A 4LV0A 1FOFA 3BECA 3IX3A 5L09A 2HDQA 5HWVA 2Y2KA 3UE3A 4ESPA 3DW0A 5FQ9A 1FCMA 3V39A 1E3UD 3A0VA 4JPMA 1L2SA 2CC1A 2JBFA 1JTGA 4P6ZM 5L10A 3VSKA 3MKEA 2PD8A 3IXDA 2FZ0A 3NOPC 2HP9A 3M6HA 4BQMA 1NZOA 1KVLA 4K08A 2MJ6A 1IKIA 3PXPA 3T4TA 3BYDA 1HTZA 4LV3A 3ZCZA 1L3LA 4EESA 3HLGA 2L1MA 3E4QA 1T1BA 5CGXA 2Z6CA 4XT2A 1PW1A 1I2WA 2OLVA 3D3OA 3H9WA 1JVJA 2M1CA 3DWKA 2YPBB 3MJQA 3BY9A 3UE0A 1S4SA 1DP9A 3ZNTA 2IWBA 4EW7A 3A3IA 4ZJ1A 2G7UA 4HH3A 3F1NB 3N6IA 3P98A 3UMDA 4DE0A 1LI0A 2ZJ9A 4B93A 3SS3A 4DJ2A 4X1LA 3WS5A 3W4QA 3FC7A 4S2NC 4G3KA 5J7EA 4KZ5A 1XFNA 3QP4A 4MBKA 3U4LP 4NK3A 2EX9A 4HH2A 4ARZB 2WK0A 2E8IA 4N9LA 3UDIA 2B5RA 3TRCA 3TSGA 1MC0A 2Y2QA 1PWGA 1TS6A 2EXBA 4Y0OA 2WUQA 1C3BA 4QB8A 1XGJA 1LL9A 3EGDC 1HLUP 3G2ZA 3GTCA 3UE6A 1MDYB 4OONA 5A93A 1K25A 2YKHA 3LFVA 2ZQ7A 1TD5A 1EW0A 2JE5A 5AQ9A 5I94A 2OWJA 5GLCA 4QU3A 1L0DA 4KG6A 4RA7A 5CHUA 4S2PA 5TBMA 1F2KA 4FH4A 2VGLS 4WEKA 2ZM2A 2PU4A 4X56A 4I38A 4WF0A 3IWQA 5FATA 3ZG0A 1XFQA 2A24B 5DTKA 5HDDA 4BBVA 3K3CA 3TG9A 3C4OA 4JXGA 5FASA 2V1ZA 4X6TA 1BSGA 1V9ZA 5HSQA 4KG2A 4FOFA 5DFYA 5HD3A 2W1TA 4YFMA 1CI9A 4JKTA 1MWUA 3SH9A 1NLZA 5TGFA 1SCWA 1XPBA 4U0XA 3WRZA 1N4OA 5EE8A 2V0WA 2BG1A 4S2LA 2FH5A 2WKIA 2EXAA 2V8CA 4JGRA 3AGFA 2WZZA 1CK3A 3KYQA 3MKFA 3ZGAB 4MBFA 2QL2A 2BASA 1XKZA 3N8SA 3Q7VA 1Y4OA 3NULA 3IBRA 1LI9A 1J3WA 1XJ6A 2PR6A 3AGDA 1ALQA 3LUQA 2KDKA 3KO6A 1D7EA 1H8YA 2ZMVA 3SW1A 3D4FA 1GCEA 3BFCA 1W63Q 5JYPA 2K31A 5DKLA 4QHCA 1NZUA 2FFFB 2P74A 4OVDA 2VV6A 4GDBA 4S2MA 3UB7A 2QJ5A 2JC7A 4OLDA 3LI9A 4KZBA 2Y2JA 5DJUA 3W4PA 5CEDA 4AFIA 2Y4AA 1T19A 4II7A 3H82A 5IHVA 1S1ZA 1MXOA 1K54C 4KQQA 2B18A 5CHMA 2A49A 3MZFA 4RX2A 3PAGA 2HGVA 3QP5A 4LV1A 4HY8A 2XD5A 3FKVA 1MPLA 1YLJA 5F5YA 3G6OA 4NKPA 3GR2A 1K1FA 1HLOA 3TW8A 3FPWA 1YQSA 5L07A 1MY8A 1PWCA 4ME4A 5FQIA 4R0QA 3LICA 2PR5A 4AYAA 1LL5A 3S1YA 1F5MA 2I9VA 3LR3A 2V9AA 2ZC5B 1GHPA 1VEUA 2Y59A 2O9BA 1ES3A 1BYWA 1BT5A 5IU1A 5DTTA 3SS4A 2WYXA 3N7WA 3SS5A 4Z9QA 4K91A 4C3QA 5EV0A 4PM6A 5J3WA 3MXRA 1N9BA 5E43A 4KZ4A 2O9AA 2IA2A 1Q2PA 1ZKJA 3PHYA 1PYYA 4EQ1A 4LV2A 5HFOA 3KYEA 1I5QA 2HP6A 4D60A 4WM9A 2NUTC 4ETXA 2ZBBA 4P0MA 4WZ5A 3IHAA 5G4YA 3B42A 1SKOB 5EVIA 4KQOA 3PYPA 2J8YA 3C2WA 4H10A 3ZDJA 5IT5A 1NWZA 1NKPB 5CHJA 4WELA 5TR7A 3NCKA 3NJAA 4LGWA 5HL6A 1XJ2A 1EI5A 4HJ4A 3L9KA 1RCJA 3CJMA 1PW8A 2HP5A 4WLAA 2ZOIA 1SKFA 1K55A 2HDUA 1P9WA 3B3XA 4KZ6A 4K0XA 1HZOA 3NC8A 4EV4A 3IWIA 4S2JA 4QWOA 2M7UA 3A3JA 2VGJA 3PBOA 4YNRA 3CAXA 1ERMA 2DNSA 4I5SA 4L9GA 4IVIA 1UWNX 3RXXA 1GA9A 3EWKA 4BBTA 1H8MA 5FEFA 1EROA 1P0ZA 4Y13A 5BOHA 4BMWA 4IEDA 1S6RA 4WZ5C 2Y8HA 4R23A 4X69A 5EVIC 3LR4A 5FDHA 1JTDA 3HLFA 2XFTA 2ZOHA 3VOLA 1JWZA 1ODVA 5CTMA 2HZ5A 2LFHA 4MNRA 4L0LA 2WAEA 4JGQA 2J3TD 4Y0UA 4DE1A 2INWA 2C6WB 3UB8A 1JWPA 2V20A 2Y55A 5E2EA 4ZJ3A 2QYBA 2VV7A 2GNXA 3P09A 4RYEA 3O5YA 2OLUA 1K55C 2VX8A 4WBGA 3QP1A 1K4EA 3VFFA 5EVIB 5HWWA 5A92A 4O8GA 1PIOA 1OJGA 4H10B 3IHBA 2XA7S 5A8BA 4LCLA 2EWWA 2V2FF 1KVMA 4WUJA 4B9OA 1NRFA 3E4PA 1XP4A 1ES5A 1YSQA 3A3DA 1ES4A 3D9YA 5EM0A 4HHDA 2XK1A 2HDSA 2P9VA 1A0KA 3R4KA 4N1HA 3V67A 4JGOA 3NOUC 2Q9NA 2B02A 3UPOA 1ZTUA 4GHIA 3MS6A 1E3UA 3MF0A 5AQ7A 4WN5A 4KZAA 2H0TA 5HDCA 2PYPA 4ARZA 1VB6A 4PKYG 1IEMA 1DY6A 3MQ0A 2EFUA 3S7NA 1YAXA 4BL3A 2Y2OA 2OAQ1 3ITBA 3MQQA 1LSXA 2P04A 4H6JB 3LR5A 1GA0A 3V3SA 3WS0A 4S2NA 1SDNA 1VETA 1LSWA 3C7UA 4LPZA 3VE4A 1MDYA 1ZZAA 4EBPA 1K6RA 3ZG5A 2XROA 2PT7A 1GHIA 3FPVA 5FL3A 5F82A 1KGGA 2G2WA 3HVFA 1SHVA 4R70A 3BFGA 5I50A 1ESIA 5HD5A 2YPAB 1NYYA 2ZM0A 1IELA 5GL9A 2PRFA 4LCMA 3UY6A 1V9YA 4QPRA 4BBUA 3DTMA 2EX2A 3OZHA 2A24A 2VGLM 1LHYA 3BEBA 4E3LA 3OOVA 4F94A 2J80A 2QWSA 2Y79A 1NJ4A 2BTFP 2VK3A 2XRNA 1WE4A 2EWVA 4X68A 4ZDXA 3U5VA 4DE3A 3Q7ZA 4MN7A 3TE8A 5MC7A 2JKRM 1MWSA 2XSSA 3RJUA 2YKFA 3GV9A 2L0WA 5GHZA 5FQMA 1MKIA 4WMCD 2ZC4B 5FQKA 3Q82A 2HJ9C 2V1BA 1M40A 2WGWA 5GLAA 1IYPA 5FQQA 3DWZA 3G2YA 2P9VB 1S4RA 4X53A 4EQIA 3UPNA 4LRXC 4GHIB 5GHYA 2Z6DA 4GDNA 3EOIA 1I2SA 3GMWA 3NHQA 2Y2NA 3G32A 2A2LA 3FKWA 4GZBA 4EEPA 4JXVA 4PM9A 3MXSA 5EM1A 3KSFA 2Y2IA 5FAPA 1IOUA 3LI8A 4C75A 1OPXA 2R9XA 1VETB 2GDNA 1MKMA 2X02A 3HUOA 4O7DA 4EXOA 4DXBA 2Y2HA 3UB9A 2EX8A 3N8RA 4ATHA 5AVFA 5D3OA 1T18A 2Y2PA 2CMNA 2QKPA 4A5RA 3UE1A 3C7VA 5FAQA 5F83A 1S0WA 1FCOA 4DJ3A 1L0EA 3BY8A 3SH8A 5HZHA 1Z09A 4CQHA 4LENA 5F1GA 3JVUA 3ZHHA 2JHEA 2JKGA 5G18A 1FIKA 4BJPA 2A3UA 2ZD8A 2XDMA 4HIAA 1ERQA 4S2KA 3VV4A 1N9LA 2VZWA 4CJNA 4EBLA 2QMIA 4GW9A 2RCXA 2VJWA 1G5UA 4GD8A 1YLTA 3NIAA 2OSUA 1K54A 5DF9A 2PBYA 2XD1A 1ONHA 2L4RA 4ZAMA 1OT6A 4RVAA 3PR6A 5HX9A 1YKDA 4OQIA 1UKLC 1FQGA 3EQVA 2ZQDA 1HVBA 4MEZA 1BLPA 3HBRA 2UWXA 2WGWB 3LEQA 2Z2MB 2P7JA 3T12B 4WL9A 1ZG4A 2W27A 4E3OA 4CPKA 5HAIA 1YMXA 4NETA 5E2FA 2O0YA 2XEPA 4IUHA 3TJZC 1SKOA 3P01A 4OLGA 5FI7A 3QNBA 4N1XA 3MFDA 4KZ7A 2UV0E 1P97A 1UWPX 1NKPA 1OTAA 2VEAA 3HCYA 3VOZA 1W5DA 3T50A 4WYYA 3OCLA 3PBQA 3WS4A 3FZCA 4BLMA 4OQGA 4M3KA 1ESUA 3VP4A 1H8ZA 2JKRI 1DJCA 2WKQA 1D06A 2WKPA 3RXWA 5AQAA 5HAQA 4OQ0A 4BL2A 5HL1A 5EOEA 2M7VA 4ZTKA 4KZ9A 3LIAA 4LFUA 1MWTA 2HDRA 4BENA 4C6YA 3VE3A 1BULA 4DRTA 4B88A 3HUNA 5CERA 5FSRA 1NLWA 3U2AA 2MH3A 3LO7A 2XH9A 5CEBA 3ZYTA 4JXSA 3BLMA 2LB9A 4HP4A 3A3EA 5FDSA 4UQIS 3UDXA 3UPPA 1YMSA 3MUJA 5DFXA 4BD0A 3IS2B 3C38A 5M1AA 4UHUA 4JBFA 1G6AA 2ZLYA 4WEJA 3TOIA 3LR0A 2JKTM 4GOGA 1KGFA 4HI4A 3DAVA 2WKEA 3EGXC 5JYOA 2DMWA 3ZG8B 2Q0OA 5KSCA 2I72A 4UEYA 3GRJA 2Y91A 3W2ZA 2IWCA 3CITA 1O7EA 3LYXA 4P87A 3A0SA 1GSWA 2E8JA 3BQAA 4EBNA 2ZC6B 2WGIA 5HAPA 1T1CA 1W63M 3S7QA 3UDFA 3BWLA 1FR6A 1H3QA 3PTEA 1IYSA 4P85A 5J8XA 4GCZA 1T1AA 4DDYA 4HOIA 1F98A 4MDZA 2ZQCA 3WS1A 1K56D 2XA7M 3R7WB 1N9NA 1K38A 3PBRA 1K0KA 5EVEA 3F1PB 4MN6A 3HLWA 3F1OB 1XA7A 1YLWA 4N9KA 4HESA 3CHWP 5DF8A 4FCFA 2QZ6A 2G2UA 5CGWA 4DE2A 1QMEA 4H6JA 5C5KA 4CLCD 5E2HA 3KSIA 1Q2QA 3HJKA 4JF5A 1IFQA 4UA6A 4XUZA 1CI8A 3O87A 3KSGA 1CEGA 3G34A 2X01A 3CG5A 1NLWB 4ID4A 4PAUA 2OWHA 1NRJA 2ZM8A 3VOYA 3ZFZA 3SOIA 1FR1A 3FWLA 3M6BA 2YPAA 4I3AA 2C5WB 4XUXA 1YLYA 1QMFA 4KUOA 4O01A 1JWVA 4K0WA 2HPBA 2ZC7A 4NG2A 1X0OA 4PM7A 1YLZA 3BQ8A 3C4PA 1IKGA 3IX8A 1OTBA 3QNCA 3P7NA 3T1XA 4HJ6A 3DTIA 4F3LB 3T4OA 1PRQA 4HP9A 5KZHA 5CECA 4Y3IA 4CLCE 5GLBA 4DDSA 4OPZA 5CGSA 3T4KA 1MWRA 1FSWA 4R6LA 1LL8A 4Y17A 4MMNA 2GX5A 4E6XA 3VSLA 2R78A 1ZG6A 4B4XA 5EYOA 4GS9A 5AJGA 3GVBA 1STZA 2HV1A 2P08A 1FSYA 1JNUA 2OV5A 3NI9A 3BRMA 5F1FA 1LLBA 1GHMA 3T4QA 2ZL1A 2Y2LA 3FG8A 2Y2GA 2O99A 5HWTA 3AGEA 4EWFA 5LBRA 2J3TC 1XA1A 3OPPA 5L8MA 3ZVWA 2JKFA 2WAFA 4BD1A 3MZDA 3ITAA 1KE3A 5FQJA 3CZDA 3LIDA 3VFHA 2GJ3A 5K5BA 3Q07A 3S7PA 2JKTI 4QY6A 4NXEA 4KENB 5EUAA 4GN2A 1W8QA 3ICYA 4DMZA 1MZUA 4KQDA 1YSPA 3EEHA 5TFQA 3IF6A 3BW6A 3CLOA 2VV8A 3HREA 4Q8IA 5IS1A 2J7VA 3ISGA 3W8KA 4R3AA 1OTDA 1XXMA 2V1AA 3E4OA 3HLDA 4JGPA 5DTSA 2XR0A 1WYCA 4E3KA 4PPRA 1PI4A 5F69A 3UN7A 3IXGA 3SH7A 2X71A 4R4RA 3IH8A 1J9MA 4Q0JA 4LLOB 2OOLA 2ZQ9A 4Y2FA 4WMCA 1KE4A 5DJTA 5KMWA 4XXRA 3QHYA 1DJAA 2BLSA 1M6KA 1PFLA 2W3DA 2Z2LB 1KDSA 4RQ9A 1XX2A 1TEMA 2VKSA 3WWXA 4I39A 1W7FA 1SDEA 3ULFA 1VM1A 4O0PA 4EUVA 4MBHA 2WGVA 4EEUA 1ONGA 1SZVA 1NYMA 4E3IA 3C8CA 4H8RA 5FEGA 5U47A 4GS9B 5FA7A 3GDIA 3I7JA 1K57C 2W3FA 3VMAA 4FD8A 4QY5A 2ZL1B 2WADA 1EWZA 3RH8B 1O07A 2DCFA 1LSVA 3B33A 1G68A 3IH9A 1ES2A 1A0AA 3KYZA 4R3BA 3IF6C 1CEFA 1W79A 1ACFA 4OQHA 3O88A 3PBSA 5I4ZA 2WZXA 2AVXA 2R9WA 4Q0IA 3UMEA 4E6WA 1E25A 3VP3A 1OT9A 3LGOA 3A3FA 1XGIA 1NXYA 3NBLA 2H0YA 4HBTA 4FUWA 1PWDA 3UB5P 1E4DA 2ZC3B 3CMZA 4Y15A 3MZEA 3CUEA 2JCHA 5GHXA 3ZNYA 3LY3A 3BJNA 5EPHA 4HEFA 4P6ZS 3HLBA 1KDWA 1H5XA 1WYBA 1AWIA 5HW3A 3S7OA 3IX4A 3GQZA 3NY4A 2NUPC 3O86A 3IF6B 2ZQAA 3C30A 4R1GA 3PBTA 3T4LA 1BLCA 1WA9A 3E0YA 4FH2A 5CX7A 4R3JA 3GSGA 3VP1A 3T4SA 1TVFA 1TS8A 1RP5A 1TF1A 4OH0A 3HJIA 4GD6A 3BFFA 2VLGA 2IWDA 2V8FA 1CQAA 2H28A 1N9OA 3IBJA 1D1JA 1XJ4A 3MSHA 1K6SA 4G3WA 4P6BA 1S1YA 5CTNA 2PDRA 3Q81A 4OPYA 1GSXA 5FI2A 4L9EA 4X55A 4U0TA 2EA9A 3UNWA 3BFDA 3BLSA 1TS0A 2FFYA 1U60A 4XT2B 4ATKA 1GSVA 2J3WA 1VHMA 2PD7A 4KZ8A 3CWFA 4G3VA 4UA9A 1VQQA 4KUKA 3IS2A 1AN4A 1YLPA 4OP8A 3LCEA 1IYQA 3JVVA 3UB6A 5EECA 2PBDP 1RGZA 2RL3A 2EX6A 3OLOA 4NEED 2W0NA 3N8LA 3V50A 4PMAA 3CUEC 1PNEA 4UQIM 1PZPA 2HF6A 4E04A 1AXBA 1PI5A 3OPHA 1OTIA 4D2OA 3OPRA 1MBLA 1L0GA 3O3VA 4PHTA 4DN0A 4PM5A 3T4JA 3WRTA 1OMEA 2QJ7A 4MN5A 3DTKA 1RGYA 1G28A 3G35A 2PAVP 4Y0TA 4EUZA 2W3HA 2V0UA 2KLIA 3BM6A 3NOTC 2PHYA 2KOIA 3R7WA 3MMHA 3N4IA 1CF0A 3UO9A 3CPTA 1YT4A 3IF5A 3F1PA 3CI6A 3OBFA 4PM8A 3B47A 3NECA 3F1OA 3EQUA 4FSFA 4HJ3A 4YWZA 3D72A 3MR0A 3HLEA 4ZBEA 4NXGA 5I5LA 1FILA 1TDLA 3EEAA 4X1MA 5HDSA 4OP5A 1NLYA 3HUMA 2XF3A 4R38A 5M19A 3FV7A 3ZG9B 4NXFA 4PKYA 4KZ3A 3ZVTA 3QP8A 1PZOA 5KIZA 2XQZA 3M2JA 5TBMB 1YM1A 2XFSA 3S22A 4MLLA 2WKRA 3K3DA 5F6AA 1ZC2A 5G4ZA 2W3GA 4IBXA 3V3RA 4KG5A 3T1SA 4Y7PA 5TJJA 3OCNA 2J9PA 4B4ZA 5KSHA 3W4OA 4IJGA 1BLSA 4GB7A 3OPLA 5E2GA 5FI6A 1Z6FA 2XGNA 1UGUA 5F68A 3FYZA 3G30A 4U3TA 4E3MA 1KOUA 3WS2A 3C5AA 5HPIA 2W1TB 5DVAA 4F3LA 3VP2A 2XLNA 3NDEA 5EOOA 2JN7A 3ZG7B 5M18A 1Y28A 3IXBA 3MFXA 3IQAA 1DP8A 1AN2A 1K56A 4YINA 4EU0A 3JYIA 1Y54A 1W8YA 5FAOA 1L0FA 2W1RA 3H7WA 3GECA 4X25A 4LRZE 4LRYC 4GNUA 1S66L 3IXHA 2QL2B 4UAAA 1BTLA 4I3IA 2B95A 3Q7VB 2VA0A 3LIBA 2DRWA 3LIEA 3M2KA 4ZRRA 2GZAA 3NDGA 5J4EA 3LIFA 4DXCA 4ATIA 1KE0A 3PAEA 4EERA 1P9RA 4GLQA 4UA7A 4GKUA 4QD4A 3CPTB 3MBZA 4Q0HA 4Z1WA 2LB5A 1DRMA 3MXQA 4CLCA 2H5SA 3QP6A 2J9OA 1K4FA 2OAP1 4DF6A 4OPQA 4OOYA 4RX3A 5EVID 2K2NA 4OOMA 4QJGA 1KGEA 3SZTA 4N92A 1YPRA 2PYRA 5HARA 3KSHA 3DTEA 4S2IA 1ZHHB 2ZQ8A 3H82B 2K7SA 3S4XA 3G4PA 3KX0X 1LT0A 3ZQ5A 2VGKA 1OJ5A 5A91A 3E2LA 5DKKA 4GJ4A 1BLHA 1CJFA 4IVKA 2ZMFA 4YOFA 1IYOA 4E3JA 1R05A 5L2FA 3JPUA 4KQRA 3A0RA 1BUEA 5A90A 3MQOA 4S2OA 4DKIA 2D02A 3VP0A 2Y2MA 1XJ3A 2O9CA 1DJBA 4NXBA 2PU2A 4E3NA 1VEUB 3L7HA 3T1RA 4R4SA 1OTEA 1FCNA 3LEZA 3QP2A 2H10A 1HD8A 3HL9A 4JLFA 4BWIA 4FTXA 4ZJ2A 3Q1FA 1F9IA 4JXWA 3PBNA 4OPRA 4IBRA 4CLCC 1TS7A 4JF6A 3HLCA 5AVEA 2ZMAA 4JF4A 2QHKA 1S67L 3H7WB 2Q9MA 3LY4A 4HBUA 3V5MA 1TDGA 4L9FA 3OC2A 3IWOA 4HNBA 5HPFA 4HQAA 4MCWA 3E2KA 2QPNA 3E98A 2YPBA 4WZ4A 3RTYA 2KX6A 5AQBA 3T1QB 4CLCB 3G31A 3F1NA 5GLDA 5CXWA 2D01A 3IT9A 5CRFA 1NY0A 2HJEA 5EVLA 2W3EA 4EETB 5EFWA 3RFBA 1H0MA 4IHQA 5DF7A 3K2NA
chains in the Genus database with same CATH topology
4OOLA 3OCLA 3PBQA 4M4XA 4I3JA 1G6OA 4Y5FA 1P9WA 4IUKA 3CUEA 3DBAA 1DP6A 3BJNA 4ETZA 1AM9A 4P6ZS 2JKRI 2WKQA 1D06A 2WKPA 3S7OA 5HWVA 2NUPC 3UE3A 3C30A 3PBTA 3T4LA 1WA9A 3E0YA 5CX7A 2M7UA 3A0VA 3T4SA 2M7VA 1TS8A 1TF1A 3PBOA 4YNRA 3LIAA 3CAXA 4I5SA 4L9GA 3HJIA 4P6ZM 2VLGA 1UWNX 3VE3A 3EWKA 4BBTA 2H28A 2PD8A 1H8MA 1N9OA 3IBJA 1XJ4A 1P0ZA 2FZ0A 3NOPC 4BMWA 1NLWA 4G3WA 1S1YA 3U2AA 2PDRA 2MH3A 2Y8HA 1GSXA 3ZYTA 4L9EA 4K08A 3LR4A 2MJ6A 2EA9A 3PXPA 3T4TA 2ZOHA 1TS0A 3VOLA 1ODVA 2LB9A 4HP4A 2LFHA 4UQIS 4L0LA 4EESA 4XT2B 4JGQA 2L1MA 3E4QA 1T1BA 4ATKA 2J3TD 1GSVA 5DFXA 3MUJA 2J3WA 1VHMA 2INWA 2Z6CA 4XT2A 3UB8A 2PD7A 3IS2B 3C38A 3CWFA 4G3VA 2QYBA 4KUKA 2VV7A 2GNXA 3IS2A 3D3OA 1AN4A 3O5YA 3H9WA 4WEJA 2VX8A 2JKTM 3LR0A 4HI4A 3JVVA 3UB6A 2M1CA 4NEED 3EGXC 3OLOA 2DMWA 2YPBB 2W0NA 5HWWA 3MJQA 3BY9A 3CUEC 1S4SA 4UQIM 1DP9A 4O8GA 2HF6A 4EW7A 1OJGA 4E04A 4H10B 4UEYA 5A8BA 2XA7S 2G7UA 3W2ZA 3CITA 3LYXA 4HH3A 1OTIA 3F1NB 2EWWA 3UMDA 3A0SA 1GSWA 4WUJA 4B93A 4B9OA 3BQAA 3E4PA 4PHTA 1YSQA 4DN0A 1T1CA 4DJ2A 1W63M 3S7QA 3BWLA 4HHDA 3FC7A 3T4JA 2QJ7A 1H3QA 4G3KA 4MN5A 5J7EA 1G28A 1XFNA 3R4KA 3V67A 4GCZA 1T1AA 4JGOA 3NOUC 4HOIA 1F98A 2B02A 4MDZA 1ZTUA 4GHIA 4HH2A 2W3HA 4ARZB 2XA7M 2V0UA 2KLIA 3MF0A 1N9NA 3R7WB 4WN5A 3NOTC 2PHYA 2PYPA 3PBRA 5HDCA 2KOIA 4ARZA 3R7WA 3F1PB 3MMHA 4MN6A 3TRCA 1VB6A 4PKYG 1MC0A 3F1OB 3MQ0A 3S7NA 1YAXA 3F1PA 1TS6A 3CI6A 3OBFA 3B47A 3F1OA 3EQUA 4FSFA 4HJ3A 4YWZA 3D72A 3MR0A 2OAQ1 4NXGA 5I5LA 3MQQA 1LSXA 3EEAA 3EGDC 5HDSA 2P04A 4H6JB 1NLYA 3LR5A 3UE6A 4R38A 1MDYB 4H6JA 1LSWA 5C5KA 4CLCD 4LPZA 3VE4A 4NXFA 3KSIA 1MDYA 2YKHA 3HJKA 3LFVA 1IFQA 1TD5A 4PKYA 1EW0A 2OWJA 3KSGA 5KIZA 2XROA 2PT7A 5TBMB 3FPVA 5FL3A 1NLWB 4PAUA 2OWHA 5TBMA 2VGLS 2WKRA 4WEKA 4R70A 1NRJA 3K3DA 5F6AA 5I50A 5G4ZA 2W3GA 4I38A 5HD5A 2YPAB 5TJJA 3OCNA 4WF0A 5KSHA 4IJGA 2YPAA 4I3AA 1XFQA 1V9YA 2A24B 4QPRA 5HDDA 4BBUA 4KUOA 4O01A 4BBVA 3K3CA 1UGUA 5F68A 2A24A 1X0OA 3BQ8A 2VGLM 1OTBA 3P7NA 4HJ6A 1KOUA 4F3LB 1V9ZA 3OOVA 2J80A 3T4OA 5HPIA 5HSQA 2W1TB 2QWSA 2Y79A 2XRNA 4FOFA 4HP9A 5DFYA 4F3LA 5HD3A 2EWVA 2W1TA 3U5VA 2JN7A 4MN7A 4Y3IA 3TE8A 5MC7A 1NLZA 2JKRM 2XSSA 4CLCE 2YKFA 1Y28A 2L0WA 3MFXA 1DP8A 1AN2A 3T4KA 4EU0A 2V0WA 4R6LA 1LL8A 4MMNA 2GX5A 2HJ9C 2V1BA 2R78A 2W1RA 2FH5A 3H7WA 3GECA 5EYOA 4LRZE 4GS9A 4JGRA 4LRYC 5AJGA 1S66L 2QL2B 1STZA 2HV1A 2P08A 4I3IA 1S4RA 3KYQA 1JNUA 2QL2A 2VA0A 4LRXC 4GHIB 3LIBA 2BASA 3LIEA 2Z6DA 4ZRRA 2GZAA 5J4EA 3EOIA 3LIFA 4ATIA 3IBRA 3T4QA 4EERA 1P9RA 1XJ6A 2PR6A 4GLQA 3NHQA 3FG8A 3LUQA 2A2LA 2KDKA 4Q0HA 2O99A 2LB5A 3KO6A 4Z1WA 1DRMA 1D7EA 3MXQA 5HWTA 4CLCA 2ZMVA 3SW1A 5LBRA 2J3TC 5L8MA 2OAP1 4EEPA 1W63Q 2K31A 5DKLA 2K2NA 3KSFA 3LIDA 1IOUA 3LI8A 4OOMA 2GJ3A 1OPXA 5K5BA 2VV6A 1MKMA 3UB7A 3S7PA 2JKTI 2QJ5A 4NXEA 4EXOA 2PYRA 3LI9A 3KSHA 3UB9A 5DJUA 1ZHHB 4ATHA 3ICYA 3H82B 5AVFA 4DMZA 1MZUA 2K7SA 1T18A 4KQDA 1YSPA 3EEHA 4AFIA 1T19A 4II7A 3H82A 3KX0X 1LT0A 1S1ZA 3ZQ5A 2CMNA 2QKPA 3BW6A 3CLOA 1OJ5A 2B18A 2VV8A 5DKKA 5IS1A 4GJ4A 2HGVA 4R3AA 4DJ3A 4HY8A 1OTDA 2V1AA 3BY8A 5F5YA 3G6OA 3E4OA 4NKPA 4JGPA 5HZHA 2ZMFA 4YOFA 4CQHA 1R05A 1HLOA 3TW8A 3FPWA 5F69A 3JVUA 3A0RA 4ME4A 3MQOA 3LICA 2JHEA 2D02A 4BJPA 4Q0JA 2PR5A 4AYAA 4LLOB 1XJ3A 1F5MA 2O9CA 4HIAA 4NXBA 2OOLA 2I9VA 3LR3A 2V9AA 4Y2FA 3VV4A 1N9LA 2VZWA 4GW9A 2VJWA 1OTEA 5DJTA 2O9BA 1BYWA 2W3DA 5DF9A 5IU1A 2L4RA 4RQ9A 4BWIA 1OT6A 2VKSA 4I39A 1F9IA 5J3WA 3PBNA 2O9AA 2IA2A 4CLCC 3ULFA 4O0PA 4EUVA 1TS7A 3PR6A 1YKDA 1UKLC 5AVEA 4EEUA 3EQVA 3PHYA 2QHKA 1S67L 3H7WB 3C8CA 4GS9B 3GDIA 2P7JA 4EQ1A 4WL9A 4L9FA 2W27A 3OC2A 2W3FA 2NUTC 4HNBA 4ETXA 5HPFA 2ZBBA 4HQAA 4MCWA 3E98A 5G4YA 2YPBA 3B42A 2O0YA 4KQOA 3PYPA 3RH8B 4IUHA 3RTYA 1LSVA 3C2WA 3TJZC 3B33A 3P01A 4H10A 5IT5A 2KX6A 1A0AA 1NWZA 3KYZA 4CLCB 1NKPB 3F1NA 1P97A 4WELA 3PBSA 1UWPX 5I4ZA 2D01A 3NJAA 1NKPA 4Q0IA 2HJEA 5HL6A 1OTAA 2VEAA 3UMEA 3HCYA 2W3EA 1XJ2A 4HJ4A 1OT9A 4EETB 5EFWA 3T50A 3RFBA 4IHQA 4WLAA 3K2NA 2ZOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4X A;  4I3J A;  1DP6 A;  1AM9 A;  2WKQ A;  1D06 A;  2WKP A;  5HWV A;  1WA9 A;  3A0V A;  1TS8 A;  3LIA A;  3CAX A;  4I5S A;  4L9G A;  3HJI A;  2VLG A;  1UWN X;  3VE3 A;  3EWK A;  4BBT A;  2H28 A;  2PD8 A;  1N9O A;  1XJ4 A;  1P0Z A;  3NOP C;  1NLW A;  1S1Y A;  2PDR A;  2MH3 A;  1GSX A;  4L9E A;  4K08 A;  2EA9 A;  2ZOH A;  1TS0 A;  3VOL A;  1ODV A;  4HP4 A;  2LFH A;  4EES A;  4XT2 B;  4JGQ A;  2L1M A;  3E4Q A;  1T1B A;  4ATK A;  3MUJ A;  1GSV A;  2Z6C A;  2INW A;  4XT2 A;  3UB8 A;  2PD7 A;  3IS2 B;  3CWF A;  4KUK A;  2VV7 A;  3IS2 A;  1AN4 A;  3H9W A;  4HI4 A;  3UB6 A;  2M1C A;  3OLO A;  2YPB B;  2W0N A;  5HWW A;  3MJQ A;  3BY9 A;  1S4S A;  1DP9 A;  4EW7 A;  1OJG A;  4E04 A;  4H10 B;  5A8B A;  3LYX A;  4HH3 A;  1OTI A;  3F1N B;  3UMD A;  3A0S A;  1GSW A;  4WUJ A;  4B9O A;  3E4P A;  1T1C A;  4DJ2 A;  3BWL A;  4HHD A;  3FC7 A;  2QJ7 A;  4MN5 A;  5J7E A;  1G28 A;  1XFN A;  4GCZ A;  1T1A A;  4JGO A;  3NOU C;  4HOI A;  2B02 A;  1F98 A;  4GHI A;  4HH2 A;  2V0U A;  1N9N A;  4WN5 A;  3NOT C;  2PHY A;  2PYP A;  5HDC A;  3F1P B;  4MN6 A;  1VB6 A;  4PKY G;  3F1O B;  3F1P A;  1TS6 A;  3F1O A;  4HJ3 A;  4YWZ A;  3D72 A;  3MR0 A;  4NXG A;  5I5L A;  3MQQ A;  1LSX A;  5HDS A;  4H6J B;  3UE6 A;  4R38 A;  1MDY B;  4H6J A;  1LSW A;  4LPZ A;  3VE4 A;  4NXF A;  1MDY A;  2YKH A;  3HJK A;  4PKY A;  1EW0 A;  2OWJ A;  5KIZ A;  5TBM B;  1NLW B;  2OWH A;  5TBM A;  2WKR A;  4R70 A;  3K3D A;  5F6A A;  5I50 A;  5G4Z A;  4I38 A;  5HD5 A;  2YPA B;  4WF0 A;  2YPA A;  4I3A A;  1XFQ A;  1V9Y A;  2A24 B;  5HDD A;  4BBU A;  4KUO A;  4BBV A;  3K3C A;  1UGU A;  5F68 A;  2A24 A;  1X0O A;  1OTB A;  3P7N A;  4HJ6 A;  1KOU A;  4F3L B;  1V9Z A;  2J80 A;  5HSQ A;  2QWS A;  4HP9 A;  4F3L A;  5HD3 A;  3U5V A;  2JN7 A;  2YKF A;  1Y28 A;  2L0W A;  3MFX A;  1DP8 A;  1AN2 A;  2V0W A;  4R6L A;  1LL8 A;  2V1B A;  2R78 A;  3H7W A;  3GEC A;  5EYO A;  4LRZ E;  4GS9 A;  4JGR A;  4LRY C;  1S66 L;  2QL2 B;  2HV1 A;  4I3I A;  1S4R A;  1JNU A;  2QL2 A;  4LRX C;  4GHI B;  3LIB A;  2BAS A;  3LIE A;  2Z6D A;  5J4E A;  3LIF A;  4ATI A;  3IBR A;  4EER A;  1XJ6 A;  2PR6 A;  3NHQ A;  3FG8 A;  3LUQ A;  2KDK A;  1DRM A;  1D7E A;  3MXQ A;  5HWT A;  3SW1 A;  4EEP A;  5DKL A;  3LID A;  3LI8 A;  2GJ3 A;  2VV6 A;  3UB7 A;  2QJ5 A;  4NXE A;  4EXO A;  2PYR A;  3LI9 A;  3UB9 A;  5DJU A;  4ATH A;  3ICY A;  3H82 B;  5AVF A;  1MZU A;  2K7S A;  1T18 A;  4KQD A;  3EEH A;  1T19 A;  3H82 A;  3KX0 X;  1LT0 A;  1S1Z A;  3ZQ5 A;  2CMN A;  2QKP A;  3CLO A;  1OJ5 A;  2VV8 A;  5DKK A;  5IS1 A;  4R3A A;  4DJ3 A;  4HY8 A;  1OTD A;  2V1A A;  3BY8 A;  5F5Y A;  3G6O A;  3E4O A;  4JGP A;  5HZH A;  1R05 A;  1HLO A;  5F69 A;  3A0R A;  3MQO A;  3LIC A;  2JHE A;  2D02 A;  2PR5 A;  4AYA A;  4LLO B;  1XJ3 A;  4HIA A;  4NXB A;  2OOL A;  2I9V A;  2V9A A;  1N9L A;  4GW9 A;  1OTE A;  5DJT A;  1BYW A;  5IU1 A;  2L4R A;  4RQ9 A;  1OT6 A;  4I39 A;  1F9I A;  5J3W A;  3ULF A;  1TS7 A;  1UKL C;  5AVE A;  4EEU A;  3PHY A;  2QHK A;  1S67 L;  3H7W B;  3C8C A;  4GS9 B;  3GDI A;  2P7J A;  4EQ1 A;  4WL9 A;  4L9F A;  2W27 A;  4HNB A;  2ZBB A;  4HQA A;  5G4Y A;  2YPB A;  3PYP A;  3RH8 B;  3RTY A;  1LSV A;  3C2W A;  3B33 A;  4H10 A;  2KX6 A;  1A0A A;  1NWZ A;  1NKP B;  3F1N A;  1P97 A;  5I4Z A;  1UWP X;  2D01 A;  3NJA A;  1NKP A;  3UME A;  1OTA A;  2VEA A;  1XJ2 A;  4HJ4 A;  1OT9 A;  4EET B;  5EFW A;  3T50 A;  4WLA A;  2ZOI A; 
#chains in the Genus database with same CATH topology
 4OOL A;  1BZA A;  4M4X A;  2WKH A;  4I3J A;  1K57 A;  1G6O A;  2ACG A;  4Y5F A;  4OKP A;  3BFE A;  4IUK A;  3DBA A;  2EFX A;  1DP6 A;  4ETZ A;  1AM9 A;  4LV0 A;  1FOF A;  3BEC A;  3IX3 A;  5L09 A;  2HDQ A;  5HWV A;  2Y2K A;  3UE3 A;  4ESP A;  3DW0 A;  5FQ9 A;  1FCM A;  3V39 A;  1E3U D;  3A0V A;  4JPM A;  1L2S A;  2CC1 A;  2JBF A;  1JTG A;  4P6Z M;  5L10 A;  3VSK A;  3MKE A;  2PD8 A;  3IXD A;  2FZ0 A;  3NOP C;  2HP9 A;  3M6H A;  4BQM A;  1NZO A;  1KVL A;  4K08 A;  2MJ6 A;  1IKI A;  3PXP A;  3T4T A;  3BYD A;  1HTZ A;  4LV3 A;  3ZCZ A;  1L3L A;  4EES A;  3HLG A;  2L1M A;  3E4Q A;  1T1B A;  5CGX A;  2Z6C A;  4XT2 A;  1PW1 A;  1I2W A;  2OLV A;  3D3O A;  3H9W A;  1JVJ A;  2M1C A;  3DWK A;  2YPB B;  3MJQ A;  3BY9 A;  3UE0 A;  1S4S A;  1DP9 A;  3ZNT A;  2IWB A;  4EW7 A;  3A3I A;  4ZJ1 A;  2G7U A;  4HH3 A;  3F1N B;  3N6I A;  3P98 A;  3UMD A;  4DE0 A;  1LI0 A;  2ZJ9 A;  4B93 A;  3SS3 A;  4DJ2 A;  4X1L A;  3WS5 A;  3W4Q A;  3FC7 A;  4S2N C;  4G3K A;  5J7E A;  4KZ5 A;  1XFN A;  3QP4 A;  4MBK A;  3U4L P;  4NK3 A;  2EX9 A;  4HH2 A;  4ARZ B;  2WK0 A;  2E8I A;  4N9L A;  3UDI A;  2B5R A;  3TRC A;  3TSG A;  1MC0 A;  2Y2Q A;  1PWG A;  1TS6 A;  2EXB A;  4Y0O A;  2WUQ A;  1C3B A;  4QB8 A;  1XGJ A;  1LL9 A;  3EGD C;  1HLU P;  3G2Z A;  3GTC A;  3UE6 A;  1MDY B;  4OON A;  5A93 A;  1K25 A;  2YKH A;  3LFV A;  2ZQ7 A;  1TD5 A;  1EW0 A;  2JE5 A;  5AQ9 A;  5I94 A;  2OWJ A;  5GLC A;  4QU3 A;  1L0D A;  4KG6 A;  4RA7 A;  5CHU A;  4S2P A;  5TBM A;  1F2K A;  4FH4 A;  2VGL S;  4WEK A;  2ZM2 A;  2PU4 A;  4X56 A;  4I38 A;  4WF0 A;  3IWQ A;  5FAT A;  3ZG0 A;  1XFQ A;  2A24 B;  5DTK A;  5HDD A;  4BBV A;  3K3C A;  3TG9 A;  3C4O A;  4JXG A;  5FAS A;  2V1Z A;  4X6T A;  1BSG A;  1V9Z A;  5HSQ A;  4KG2 A;  4FOF A;  5DFY A;  5HD3 A;  2W1T A;  4YFM A;  1CI9 A;  4JKT A;  1MWU A;  3SH9 A;  1NLZ A;  5TGF A;  1SCW A;  1XPB A;  4U0X A;  3WRZ A;  1N4O A;  5EE8 A;  2V0W A;  2BG1 A;  4S2L A;  2FH5 A;  2WKI A;  2EXA A;  2V8C A;  4JGR A;  3AGF A;  2WZZ A;  1CK3 A;  3KYQ A;  3MKF A;  3ZGA B;  4MBF A;  2QL2 A;  2BAS A;  1XKZ A;  3N8S A;  3Q7V A;  1Y4O A;  3NUL A;  3IBR A;  1LI9 A;  1J3W A;  1XJ6 A;  2PR6 A;  3AGD A;  1ALQ A;  3LUQ A;  2KDK A;  3KO6 A;  1D7E A;  1H8Y A;  2ZMV A;  3SW1 A;  3D4F A;  1GCE A;  3BFC A;  1W63 Q;  5JYP A;  2K31 A;  5DKL A;  4QHC A;  1NZU A;  2FFF B;  2P74 A;  4OVD A;  2VV6 A;  4GDB A;  4S2M A;  3UB7 A;  2QJ5 A;  2JC7 A;  4OLD A;  3LI9 A;  4KZB A;  2Y2J A;  5DJU A;  3W4P A;  5CED A;  4AFI A;  2Y4A A;  1T19 A;  4II7 A;  3H82 A;  5IHV A;  1S1Z A;  1MXO A;  1K54 C;  4KQQ A;  2B18 A;  5CHM A;  2A49 A;  3MZF A;  4RX2 A;  3PAG A;  2HGV A;  3QP5 A;  4LV1 A;  4HY8 A;  2XD5 A;  3FKV A;  1MPL A;  1YLJ A;  5F5Y A;  3G6O A;  4NKP A;  3GR2 A;  1K1F A;  1HLO A;  3TW8 A;  3FPW A;  1YQS A;  5L07 A;  1MY8 A;  1PWC A;  4ME4 A;  5FQI A;  4R0Q A;  3LIC A;  2PR5 A;  4AYA A;  1LL5 A;  3S1Y A;  1F5M A;  2I9V A;  3LR3 A;  2V9A A;  2ZC5 B;  1GHP A;  1VEU A;  2Y59 A;  2O9B A;  1ES3 A;  1BYW A;  1BT5 A;  5IU1 A;  5DTT A;  3SS4 A;  2WYX A;  3N7W A;  3SS5 A;  4Z9Q A;  4K91 A;  4C3Q A;  5EV0 A;  4PM6 A;  5J3W A;  3MXR A;  1N9B A;  5E43 A;  4KZ4 A;  2O9A A;  2IA2 A;  1Q2P A;  1ZKJ A;  3PHY A;  1PYY A;  4EQ1 A;  4LV2 A;  5HFO A;  3KYE A;  1I5Q A;  2HP6 A;  4D60 A;  4WM9 A;  2NUT C;  4ETX A;  2ZBB A;  4P0M A;  4WZ5 A;  3IHA A;  5G4Y A;  3B42 A;  1SKO B;  5EVI A;  4KQO A;  3PYP A;  2J8Y A;  3C2W A;  4H10 A;  3ZDJ A;  5IT5 A;  1NWZ A;  1NKP B;  5CHJ A;  4WEL A;  5TR7 A;  3NCK A;  3NJA A;  4LGW A;  5HL6 A;  1XJ2 A;  1EI5 A;  4HJ4 A;  3L9K A;  1RCJ A;  3CJM A;  1PW8 A;  2HP5 A;  4WLA A;  2ZOI A;  1SKF A;  1K55 A;  2HDU A;  1P9W A;  3B3X A;  4KZ6 A;  4K0X A;  1HZO A;  3NC8 A;  4EV4 A;  3IWI A;  4S2J A;  4QWO A;  2M7U A;  3A3J A;  2VGJ A;  3PBO A;  4YNR A;  3CAX A;  1ERM A;  2DNS A;  4I5S A;  4L9G A;  4IVI A;  1UWN X;  3RXX A;  1GA9 A;  3EWK A;  4BBT A;  1H8M A;  5FEF A;  1ERO A;  1P0Z A;  4Y13 A;  5BOH A;  4BMW A;  4IED A;  1S6R A;  4WZ5 C;  2Y8H A;  4R23 A;  4X69 A;  5EVI C;  3LR4 A;  5FDH A;  1JTD A;  3HLF A;  2XFT A;  2ZOH A;  3VOL A;  1JWZ A;  1ODV A;  5CTM A;  2HZ5 A;  2LFH A;  4MNR A;  4L0L A;  2WAE A;  4JGQ A;  2J3T D;  4Y0U A;  4DE1 A;  2INW A;  2C6W B;  3UB8 A;  1JWP A;  2V20 A;  2Y55 A;  5E2E A;  4ZJ3 A;  2QYB A;  2VV7 A;  2GNX A;  3P09 A;  4RYE A;  3O5Y A;  2OLU A;  1K55 C;  2VX8 A;  4WBG A;  3QP1 A;  1K4E A;  3VFF A;  5EVI B;  5HWW A;  5A92 A;  4O8G A;  1PIO A;  1OJG A;  4H10 B;  3IHB A;  2XA7 S;  5A8B A;  4LCL A;  2EWW A;  2V2F F;  1KVM A;  4WUJ A;  4B9O A;  1NRF A;  3E4P A;  1XP4 A;  1ES5 A;  1YSQ A;  3A3D A;  1ES4 A;  3D9Y A;  5EM0 A;  4HHD A;  2XK1 A;  2HDS A;  2P9V A;  1A0K A;  3R4K A;  4N1H A;  3V67 A;  4JGO A;  3NOU C;  2Q9N A;  2B02 A;  3UPO A;  1ZTU A;  4GHI A;  3MS6 A;  1E3U A;  3MF0 A;  5AQ7 A;  4WN5 A;  4KZA A;  2H0T A;  5HDC A;  2PYP A;  4ARZ A;  1VB6 A;  4PKY G;  1IEM A;  1DY6 A;  3MQ0 A;  2EFU A;  3S7N A;  1YAX A;  4BL3 A;  2Y2O A;  2OAQ 1;  3ITB A;  3MQQ A;  1LSX A;  2P04 A;  4H6J B;  3LR5 A;  1GA0 A;  3V3S A;  3WS0 A;  4S2N A;  1SDN A;  1VET A;  1LSW A;  3C7U A;  4LPZ A;  3VE4 A;  1MDY A;  1ZZA A;  4EBP A;  1K6R A;  3ZG5 A;  2XRO A;  2PT7 A;  1GHI A;  3FPV A;  5FL3 A;  5F82 A;  1KGG A;  2G2W A;  3HVF A;  1SHV A;  4R70 A;  3BFG A;  5I50 A;  1ESI A;  5HD5 A;  2YPA B;  1NYY A;  2ZM0 A;  1IEL A;  5GL9 A;  2PRF A;  4LCM A;  3UY6 A;  1V9Y A;  4QPR A;  4BBU A;  3DTM A;  2EX2 A;  3OZH A;  2A24 A;  2VGL M;  1LHY A;  3BEB A;  4E3L A;  3OOV A;  4F94 A;  2J80 A;  2QWS A;  2Y79 A;  1NJ4 A;  2BTF P;  2VK3 A;  2XRN A;  1WE4 A;  2EWV A;  4X68 A;  4ZDX A;  3U5V A;  4DE3 A;  3Q7Z A;  4MN7 A;  3TE8 A;  5MC7 A;  2JKR M;  1MWS A;  2XSS A;  3RJU A;  2YKF A;  3GV9 A;  2L0W A;  5GHZ A;  5FQM A;  1MKI A;  4WMC D;  2ZC4 B;  5FQK A;  3Q82 A;  2HJ9 C;  2V1B A;  1M40 A;  2WGW A;  5GLA A;  1IYP A;  5FQQ A;  3DWZ A;  3G2Y A;  2P9V B;  1S4R A;  4X53 A;  4EQI A;  3UPN A;  4LRX C;  4GHI B;  5GHY A;  2Z6D A;  4GDN A;  3EOI A;  1I2S A;  3GMW A;  3NHQ A;  2Y2N A;  3G32 A;  2A2L A;  3FKW A;  4GZB A;  4EEP A;  4JXV A;  4PM9 A;  3MXS A;  5EM1 A;  3KSF A;  2Y2I A;  5FAP A;  1IOU A;  3LI8 A;  4C75 A;  1OPX A;  2R9X A;  1VET B;  2GDN A;  1MKM A;  2X02 A;  3HUO A;  4O7D A;  4EXO A;  4DXB A;  2Y2H A;  3UB9 A;  2EX8 A;  3N8R A;  4ATH A;  5AVF A;  5D3O A;  1T18 A;  2Y2P A;  2CMN A;  2QKP A;  4A5R A;  3UE1 A;  3C7V A;  5FAQ A;  5F83 A;  1S0W A;  1FCO A;  4DJ3 A;  1L0E A;  3BY8 A;  3SH8 A;  5HZH A;  1Z09 A;  4CQH A;  4LEN A;  5F1G A;  3JVU A;  3ZHH A;  2JHE A;  2JKG A;  5G18 A;  1FIK A;  4BJP A;  2A3U A;  2ZD8 A;  2XDM A;  4HIA A;  1ERQ A;  4S2K A;  3VV4 A;  1N9L A;  2VZW A;  4CJN A;  4EBL A;  2QMI A;  4GW9 A;  2RCX A;  2VJW A;  1G5U A;  4GD8 A;  1YLT A;  3NIA A;  2OSU A;  1K54 A;  5DF9 A;  2PBY A;  2XD1 A;  1ONH A;  2L4R A;  4ZAM A;  1OT6 A;  4RVA A;  3PR6 A;  5HX9 A;  1YKD A;  4OQI A;  1UKL C;  1FQG A;  3EQV A;  2ZQD A;  1HVB A;  4MEZ A;  1BLP A;  3HBR A;  2UWX A;  2WGW B;  3LEQ A;  2Z2M B;  2P7J A;  3T12 B;  4WL9 A;  1ZG4 A;  2W27 A;  4E3O A;  4CPK A;  5HAI A;  1YMX A;  4NET A;  5E2F A;  2O0Y A;  2XEP A;  4IUH A;  3TJZ C;  1SKO A;  3P01 A;  4OLG A;  5FI7 A;  3QNB A;  4N1X A;  3MFD A;  4KZ7 A;  2UV0 E;  1P97 A;  1UWP X;  1NKP A;  1OTA A;  2VEA A;  3HCY A;  3VOZ A;  1W5D A;  3T50 A;  4WYY A;  3OCL A;  3PBQ A;  3WS4 A;  3FZC A;  4BLM A;  4OQG A;  4M3K A;  1ESU A;  3VP4 A;  1H8Z A;  2JKR I;  1DJC A;  2WKQ A;  1D06 A;  2WKP A;  3RXW A;  5AQA A;  5HAQ A;  4OQ0 A;  4BL2 A;  5HL1 A;  5EOE A;  2M7V A;  4ZTK A;  4KZ9 A;  3LIA A;  4LFU A;  1MWT A;  2HDR A;  4BEN A;  4C6Y A;  3VE3 A;  1BUL A;  4DRT A;  4B88 A;  3HUN A;  5CER A;  5FSR A;  1NLW A;  3U2A A;  2MH3 A;  3LO7 A;  2XH9 A;  5CEB A;  3ZYT A;  4JXS A;  3BLM A;  2LB9 A;  4HP4 A;  3A3E A;  5FDS A;  4UQI S;  3UDX A;  3UPP A;  1YMS A;  3MUJ A;  5DFX A;  4BD0 A;  3IS2 B;  3C38 A;  5M1A A;  4UHU A;  4JBF A;  1G6A A;  2ZLY A;  4WEJ A;  3TOI A;  3LR0 A;  2JKT M;  4GOG A;  1KGF A;  4HI4 A;  3DAV A;  2WKE A;  3EGX C;  5JYO A;  2DMW A;  3ZG8 B;  2Q0O A;  5KSC A;  2I72 A;  4UEY A;  3GRJ A;  2Y91 A;  3W2Z A;  2IWC A;  3CIT A;  1O7E A;  3LYX A;  4P87 A;  3A0S A;  1GSW A;  2E8J A;  3BQA A;  4EBN A;  2ZC6 B;  2WGI A;  5HAP A;  1T1C A;  1W63 M;  3S7Q A;  3UDF A;  3BWL A;  1FR6 A;  1H3Q A;  3PTE A;  1IYS A;  4P85 A;  5J8X A;  4GCZ A;  1T1A A;  4DDY A;  4HOI A;  1F98 A;  4MDZ A;  2ZQC A;  3WS1 A;  1K56 D;  2XA7 M;  3R7W B;  1N9N A;  1K38 A;  3PBR A;  1K0K A;  5EVE A;  3F1P B;  4MN6 A;  3HLW A;  3F1O B;  1XA7 A;  1YLW A;  4N9K A;  4HES A;  3CHW P;  5DF8 A;  4FCF A;  2QZ6 A;  2G2U A;  5CGW A;  4DE2 A;  1QME A;  4H6J A;  5C5K A;  4CLC D;  5E2H A;  3KSI A;  1Q2Q A;  3HJK A;  4JF5 A;  1IFQ A;  4UA6 A;  4XUZ A;  1CI8 A;  3O87 A;  3KSG A;  1CEG A;  3G34 A;  2X01 A;  3CG5 A;  1NLW B;  4ID4 A;  4PAU A;  2OWH A;  1NRJ A;  2ZM8 A;  3VOY A;  3ZFZ A;  3SOI A;  1FR1 A;  3FWL A;  3M6B A;  2YPA A;  4I3A A;  2C5W B;  4XUX A;  1YLY A;  1QMF A;  4KUO A;  4O01 A;  1JWV A;  4K0W A;  2HPB A;  2ZC7 A;  4NG2 A;  1X0O A;  4PM7 A;  1YLZ A;  3BQ8 A;  3C4P A;  1IKG A;  3IX8 A;  1OTB A;  3QNC A;  3P7N A;  3T1X A;  4HJ6 A;  3DTI A;  4F3L B;  3T4O A;  1PRQ A;  4HP9 A;  5KZH A;  5CEC A;  4Y3I A;  4CLC E;  5GLB A;  4DDS A;  4OPZ A;  5CGS A;  3T4K A;  1MWR A;  1FSW A;  4R6L A;  1LL8 A;  4Y17 A;  4MMN A;  2GX5 A;  4E6X A;  3VSL A;  2R78 A;  1ZG6 A;  4B4X A;  5EYO A;  4GS9 A;  5AJG A;  3GVB A;  1STZ A;  2HV1 A;  2P08 A;  1FSY A;  1JNU A;  2OV5 A;  3NI9 A;  3BRM A;  5F1F A;  1LLB A;  1GHM A;  3T4Q A;  2ZL1 A;  2Y2L A;  3FG8 A;  2Y2G A;  2O99 A;  5HWT A;  3AGE A;  4EWF A;  5LBR A;  2J3T C;  1XA1 A;  3OPP A;  5L8M A;  3ZVW A;  2JKF A;  2WAF A;  4BD1 A;  3MZD A;  3ITA A;  1KE3 A;  5FQJ A;  3CZD A;  3LID A;  3VFH A;  2GJ3 A;  5K5B A;  3Q07 A;  3S7P A;  2JKT I;  4QY6 A;  4NXE A;  4KEN B;  5EUA A;  4GN2 A;  1W8Q A;  3ICY A;  4DMZ A;  1MZU A;  4KQD A;  1YSP A;  3EEH A;  5TFQ A;  3IF6 A;  3BW6 A;  3CLO A;  2VV8 A;  3HRE A;  4Q8I A;  5IS1 A;  2J7V A;  3ISG A;  3W8K A;  4R3A A;  1OTD A;  1XXM A;  2V1A A;  3E4O A;  3HLD A;  4JGP A;  5DTS A;  2XR0 A;  1WYC A;  4E3K A;  4PPR A;  1PI4 A;  5F69 A;  3UN7 A;  3IXG A;  3SH7 A;  2X71 A;  4R4R A;  3IH8 A;  1J9M A;  4Q0J A;  4LLO B;  2OOL A;  2ZQ9 A;  4Y2F A;  4WMC A;  1KE4 A;  5DJT A;  5KMW A;  4XXR A;  3QHY A;  1DJA A;  2BLS A;  1M6K A;  1PFL A;  2W3D A;  2Z2L B;  1KDS A;  4RQ9 A;  1XX2 A;  1TEM A;  2VKS A;  3WWX A;  4I39 A;  1W7F A;  1SDE A;  3ULF A;  1VM1 A;  4O0P A;  4EUV A;  4MBH A;  2WGV A;  4EEU A;  1ONG A;  1SZV A;  1NYM A;  4E3I A;  3C8C A;  4H8R A;  5FEG A;  5U47 A;  4GS9 B;  5FA7 A;  3GDI A;  3I7J A;  1K57 C;  2W3F A;  3VMA A;  4FD8 A;  4QY5 A;  2ZL1 B;  2WAD A;  1EWZ A;  3RH8 B;  1O07 A;  2DCF A;  1LSV A;  3B33 A;  1G68 A;  3IH9 A;  1ES2 A;  1A0A A;  3KYZ A;  4R3B A;  3IF6 C;  1CEF A;  1W79 A;  1ACF A;  4OQH A;  3O88 A;  3PBS A;  5I4Z A;  2WZX A;  2AVX A;  2R9W A;  4Q0I A;  3UME A;  4E6W A;  1E25 A;  3VP3 A;  1OT9 A;  3LGO A;  3A3F A;  1XGI A;  1NXY A;  3NBL A;  2H0Y A;  4HBT A;  4FUW A;  1PWD A;  3UB5 P;  1E4D A;  2ZC3 B;  3CMZ A;  4Y15 A;  3MZE A;  3CUE A;  2JCH A;  5GHX A;  3ZNY A;  3LY3 A;  3BJN A;  5EPH A;  4HEF A;  4P6Z S;  3HLB A;  1KDW A;  1H5X A;  1WYB A;  1AWI A;  5HW3 A;  3S7O A;  3IX4 A;  3GQZ A;  3NY4 A;  2NUP C;  3O86 A;  3IF6 B;  2ZQA A;  3C30 A;  4R1G A;  3PBT A;  3T4L A;  1BLC A;  1WA9 A;  3E0Y A;  4FH2 A;  5CX7 A;  4R3J A;  3GSG A;  3VP1 A;  3T4S A;  1TVF A;  1TS8 A;  1RP5 A;  1TF1 A;  4OH0 A;  3HJI A;  4GD6 A;  3BFF A;  2VLG A;  2IWD A;  2V8F A;  1CQA A;  2H28 A;  1N9O A;  3IBJ A;  1D1J A;  1XJ4 A;  3MSH A;  1K6S A;  4G3W A;  4P6B A;  1S1Y A;  5CTN A;  2PDR A;  3Q81 A;  4OPY A;  1GSX A;  5FI2 A;  4L9E A;  4X55 A;  4U0T A;  2EA9 A;  3UNW A;  3BFD A;  3BLS A;  1TS0 A;  2FFY A;  1U60 A;  4XT2 B;  4ATK A;  1GSV A;  2J3W A;  1VHM A;  2PD7 A;  4KZ8 A;  3CWF A;  4G3V A;  4UA9 A;  1VQQ A;  4KUK A;  3IS2 A;  1AN4 A;  1YLP A;  4OP8 A;  3LCE A;  1IYQ A;  3JVV A;  3UB6 A;  5EEC A;  2PBD P;  1RGZ A;  2RL3 A;  2EX6 A;  3OLO A;  4NEE D;  2W0N A;  3N8L A;  3V50 A;  4PMA A;  3CUE C;  1PNE A;  4UQI M;  1PZP A;  2HF6 A;  4E04 A;  1AXB A;  1PI5 A;  3OPH A;  1OTI A;  4D2O A;  3OPR A;  1MBL A;  1L0G A;  3O3V A;  4PHT A;  4DN0 A;  4PM5 A;  3T4J A;  3WRT A;  1OME A;  2QJ7 A;  4MN5 A;  3DTK A;  1RGY A;  1G28 A;  3G35 A;  2PAV P;  4Y0T A;  4EUZ A;  2W3H A;  2V0U A;  2KLI A;  3BM6 A;  3NOT C;  2PHY A;  2KOI A;  3R7W A;  3MMH A;  3N4I A;  1CF0 A;  3UO9 A;  3CPT A;  1YT4 A;  3IF5 A;  3F1P A;  3CI6 A;  3OBF A;  4PM8 A;  3B47 A;  3NEC A;  3F1O A;  3EQU A;  4FSF A;  4HJ3 A;  4YWZ A;  3D72 A;  3MR0 A;  3HLE A;  4ZBE A;  4NXG A;  5I5L A;  1FIL A;  1TDL A;  3EEA A;  4X1M A;  5HDS A;  4OP5 A;  1NLY A;  3HUM A;  2XF3 A;  4R38 A;  5M19 A;  3FV7 A;  3ZG9 B;  4NXF A;  4PKY A;  4KZ3 A;  3ZVT A;  3QP8 A;  1PZO A;  5KIZ A;  2XQZ A;  3M2J A;  5TBM B;  1YM1 A;  2XFS A;  3S22 A;  4MLL A;  2WKR A;  3K3D A;  5F6A A;  1ZC2 A;  5G4Z A;  2W3G A;  4IBX A;  3V3R A;  4KG5 A;  3T1S A;  4Y7P A;  5TJJ A;  3OCN A;  2J9P A;  4B4Z A;  5KSH A;  3W4O A;  4IJG A;  1BLS A;  4GB7 A;  3OPL A;  5E2G A;  5FI6 A;  1Z6F A;  2XGN A;  1UGU A;  5F68 A;  3FYZ A;  3G30 A;  4U3T A;  4E3M A;  1KOU A;  3WS2 A;  3C5A A;  5HPI A;  2W1T B;  5DVA A;  4F3L A;  3VP2 A;  2XLN A;  3NDE A;  5EOO A;  2JN7 A;  3ZG7 B;  5M18 A;  1Y28 A;  3IXB A;  3MFX A;  3IQA A;  1DP8 A;  1AN2 A;  1K56 A;  4YIN A;  4EU0 A;  3JYI A;  1Y54 A;  1W8Y A;  5FAO A;  1L0F A;  2W1R A;  3H7W A;  3GEC A;  4X25 A;  4LRZ E;  4LRY C;  4GNU A;  1S66 L;  3IXH A;  2QL2 B;  4UAA A;  1BTL A;  4I3I A;  2B95 A;  3Q7V B;  2VA0 A;  3LIB A;  2DRW A;  3LIE A;  3M2K A;  4ZRR A;  2GZA A;  3NDG A;  5J4E A;  3LIF A;  4DXC A;  4ATI A;  1KE0 A;  3PAE A;  4EER A;  1P9R A;  4GLQ A;  4UA7 A;  4GKU A;  4QD4 A;  3CPT B;  3MBZ A;  4Q0H A;  4Z1W A;  2LB5 A;  1DRM A;  3MXQ A;  4CLC A;  2H5S A;  3QP6 A;  2J9O A;  1K4F A;  2OAP 1;  4DF6 A;  4OPQ A;  4OOY A;  4RX3 A;  5EVI D;  2K2N A;  4OOM A;  4QJG A;  1KGE A;  3SZT A;  4N92 A;  1YPR A;  2PYR A;  5HAR A;  3KSH A;  3DTE A;  4S2I A;  1ZHH B;  2ZQ8 A;  3H82 B;  2K7S A;  3S4X A;  3G4P A;  3KX0 X;  1LT0 A;  3ZQ5 A;  2VGK A;  1OJ5 A;  5A91 A;  3E2L A;  5DKK A;  4GJ4 A;  1BLH A;  1CJF A;  4IVK A;  2ZMF A;  4YOF A;  1IYO A;  4E3J A;  1R05 A;  5L2F A;  3JPU A;  4KQR A;  3A0R A;  1BUE A;  5A90 A;  3MQO A;  4S2O A;  4DKI A;  2D02 A;  3VP0 A;  2Y2M A;  1XJ3 A;  2O9C A;  1DJB A;  4NXB A;  2PU2 A;  4E3N A;  1VEU B;  3L7H A;  3T1R A;  4R4S A;  1OTE A;  1FCN A;  3LEZ A;  3QP2 A;  2H10 A;  1HD8 A;  3HL9 A;  4JLF A;  4BWI A;  4FTX A;  4ZJ2 A;  3Q1F A;  1F9I A;  4JXW A;  3PBN A;  4OPR A;  4IBR A;  4CLC C;  1TS7 A;  4JF6 A;  3HLC A;  5AVE A;  2ZMA A;  4JF4 A;  2QHK A;  1S67 L;  3H7W B;  2Q9M A;  3LY4 A;  4HBU A;  3V5M A;  1TDG A;  4L9F A;  3OC2 A;  3IWO A;  4HNB A;  5HPF A;  4HQA A;  4MCW A;  3E2K A;  2QPN A;  3E98 A;  2YPB A;  4WZ4 A;  3RTY A;  2KX6 A;  5AQB A;  3T1Q B;  4CLC B;  3G31 A;  3F1N A;  5GLD A;  5CXW A;  2D01 A;  3IT9 A;  5CRF A;  1NY0 A;  2HJE A;  5EVL A;  2W3E A;  4EET B;  5EFW A;  3RFB A;  1H0M A;  4IHQ A;  5DF7 A;  3K2N A; 
#chains in the Genus database with same CATH homology
 4OOL A;  3OCL A;  3PBQ A;  4M4X A;  4I3J A;  1G6O A;  4Y5F A;  1P9W A;  4IUK A;  3CUE A;  3DBA A;  1DP6 A;  3BJN A;  4ETZ A;  1AM9 A;  4P6Z S;  2JKR I;  2WKQ A;  1D06 A;  2WKP A;  3S7O A;  5HWV A;  2NUP C;  3UE3 A;  3C30 A;  3PBT A;  3T4L A;  1WA9 A;  3E0Y A;  5CX7 A;  2M7U A;  3A0V A;  3T4S A;  2M7V A;  1TS8 A;  1TF1 A;  3PBO A;  4YNR A;  3LIA A;  3CAX A;  4I5S A;  4L9G A;  3HJI A;  4P6Z M;  2VLG A;  1UWN X;  3VE3 A;  3EWK A;  4BBT A;  2H28 A;  2PD8 A;  1H8M A;  1N9O A;  3IBJ A;  1XJ4 A;  1P0Z A;  2FZ0 A;  3NOP C;  4BMW A;  1NLW A;  4G3W A;  1S1Y A;  3U2A A;  2PDR A;  2MH3 A;  2Y8H A;  1GSX A;  3ZYT A;  4L9E A;  4K08 A;  3LR4 A;  2MJ6 A;  2EA9 A;  3PXP A;  3T4T A;  2ZOH A;  1TS0 A;  3VOL A;  1ODV A;  2LB9 A;  4HP4 A;  2LFH A;  4UQI S;  4L0L A;  4EES A;  4XT2 B;  4JGQ A;  2L1M A;  3E4Q A;  1T1B A;  4ATK A;  2J3T D;  1GSV A;  5DFX A;  3MUJ A;  2J3W A;  1VHM A;  2INW A;  2Z6C A;  4XT2 A;  3UB8 A;  2PD7 A;  3IS2 B;  3C38 A;  3CWF A;  4G3V A;  2QYB A;  4KUK A;  2VV7 A;  2GNX A;  3IS2 A;  3D3O A;  1AN4 A;  3O5Y A;  3H9W A;  4WEJ A;  2VX8 A;  2JKT M;  3LR0 A;  4HI4 A;  3JVV A;  3UB6 A;  2M1C A;  4NEE D;  3EGX C;  3OLO A;  2DMW A;  2YPB B;  2W0N A;  5HWW A;  3MJQ A;  3BY9 A;  3CUE C;  1S4S A;  4UQI M;  1DP9 A;  4O8G A;  2HF6 A;  4EW7 A;  1OJG A;  4E04 A;  4H10 B;  4UEY A;  5A8B A;  2XA7 S;  2G7U A;  3W2Z A;  3CIT A;  3LYX A;  4HH3 A;  1OTI A;  3F1N B;  2EWW A;  3UMD A;  3A0S A;  1GSW A;  4WUJ A;  4B93 A;  4B9O A;  3BQA A;  3E4P A;  4PHT A;  1YSQ A;  4DN0 A;  1T1C A;  4DJ2 A;  1W63 M;  3S7Q A;  3BWL A;  4HHD A;  3FC7 A;  3T4J A;  2QJ7 A;  1H3Q A;  4G3K A;  4MN5 A;  5J7E A;  1G28 A;  1XFN A;  3R4K A;  3V67 A;  4GCZ A;  1T1A A;  4JGO A;  3NOU C;  4HOI A;  1F98 A;  2B02 A;  4MDZ A;  1ZTU A;  4GHI A;  4HH2 A;  2W3H A;  4ARZ B;  2XA7 M;  2V0U A;  2KLI A;  3MF0 A;  1N9N A;  3R7W B;  4WN5 A;  3NOT C;  2PHY A;  2PYP A;  3PBR A;  5HDC A;  2KOI A;  4ARZ A;  3R7W A;  3F1P B;  3MMH A;  4MN6 A;  3TRC A;  1VB6 A;  4PKY G;  1MC0 A;  3F1O B;  3MQ0 A;  3S7N A;  1YAX A;  3F1P A;  1TS6 A;  3CI6 A;  3OBF A;  3B47 A;  3F1O A;  3EQU A;  4FSF A;  4HJ3 A;  4YWZ A;  3D72 A;  3MR0 A;  2OAQ 1;  4NXG A;  5I5L A;  3MQQ A;  1LSX A;  3EEA A;  3EGD C;  5HDS A;  2P04 A;  4H6J B;  1NLY A;  3LR5 A;  3UE6 A;  4R38 A;  1MDY B;  4H6J A;  1LSW A;  5C5K A;  4CLC D;  4LPZ A;  3VE4 A;  4NXF A;  3KSI A;  1MDY A;  2YKH A;  3HJK A;  3LFV A;  1IFQ A;  1TD5 A;  4PKY A;  1EW0 A;  2OWJ A;  3KSG A;  5KIZ A;  2XRO A;  2PT7 A;  5TBM B;  3FPV A;  5FL3 A;  1NLW B;  4PAU A;  2OWH A;  5TBM A;  2VGL S;  2WKR A;  4WEK A;  4R70 A;  1NRJ A;  3K3D A;  5F6A A;  5I50 A;  5G4Z A;  2W3G A;  4I38 A;  5HD5 A;  2YPA B;  5TJJ A;  3OCN A;  4WF0 A;  5KSH A;  4IJG A;  2YPA A;  4I3A A;  1XFQ A;  1V9Y A;  2A24 B;  4QPR A;  5HDD A;  4BBU A;  4KUO A;  4O01 A;  4BBV A;  3K3C A;  1UGU A;  5F68 A;  2A24 A;  1X0O A;  3BQ8 A;  2VGL M;  1OTB A;  3P7N A;  4HJ6 A;  1KOU A;  4F3L B;  1V9Z A;  3OOV A;  2J80 A;  3T4O A;  5HPI A;  5HSQ A;  2W1T B;  2QWS A;  2Y79 A;  2XRN A;  4FOF A;  4HP9 A;  5DFY A;  4F3L A;  5HD3 A;  2EWV A;  2W1T A;  3U5V A;  2JN7 A;  4MN7 A;  4Y3I A;  3TE8 A;  5MC7 A;  1NLZ A;  2JKR M;  2XSS A;  4CLC E;  2YKF A;  1Y28 A;  2L0W A;  3MFX A;  1DP8 A;  1AN2 A;  3T4K A;  4EU0 A;  2V0W A;  4R6L A;  1LL8 A;  4MMN A;  2GX5 A;  2HJ9 C;  2V1B A;  2R78 A;  2W1R A;  2FH5 A;  3H7W A;  3GEC A;  5EYO A;  4LRZ E;  4GS9 A;  4JGR A;  4LRY C;  5AJG A;  1S66 L;  2QL2 B;  1STZ A;  2HV1 A;  2P08 A;  4I3I A;  1S4R A;  3KYQ A;  1JNU A;  2QL2 A;  2VA0 A;  4LRX C;  4GHI B;  3LIB A;  2BAS A;  3LIE A;  2Z6D A;  4ZRR A;  2GZA A;  5J4E A;  3EOI A;  3LIF A;  4ATI A;  3IBR A;  3T4Q A;  4EER A;  1P9R A;  1XJ6 A;  2PR6 A;  4GLQ A;  3NHQ A;  3FG8 A;  3LUQ A;  2A2L A;  2KDK A;  4Q0H A;  2O99 A;  2LB5 A;  3KO6 A;  4Z1W A;  1DRM A;  1D7E A;  3MXQ A;  5HWT A;  4CLC A;  2ZMV A;  3SW1 A;  5LBR A;  2J3T C;  5L8M A;  2OAP 1;  4EEP A;  1W63 Q;  2K31 A;  5DKL A;  2K2N A;  3KSF A;  3LID A;  1IOU A;  3LI8 A;  4OOM A;  2GJ3 A;  1OPX A;  5K5B A;  2VV6 A;  1MKM A;  3UB7 A;  3S7P A;  2JKT I;  2QJ5 A;  4NXE A;  4EXO A;  2PYR A;  3LI9 A;  3KSH A;  3UB9 A;  5DJU A;  1ZHH B;  4ATH A;  3ICY A;  3H82 B;  5AVF A;  4DMZ A;  1MZU A;  2K7S A;  1T18 A;  4KQD A;  1YSP A;  3EEH A;  4AFI A;  1T19 A;  4II7 A;  3H82 A;  3KX0 X;  1LT0 A;  1S1Z A;  3ZQ5 A;  2CMN A;  2QKP A;  3BW6 A;  3CLO A;  1OJ5 A;  2B18 A;  2VV8 A;  5DKK A;  5IS1 A;  4GJ4 A;  2HGV A;  4R3A A;  4DJ3 A;  4HY8 A;  1OTD A;  2V1A A;  3BY8 A;  5F5Y A;  3G6O A;  3E4O A;  4NKP A;  4JGP A;  5HZH A;  2ZMF A;  4YOF A;  4CQH A;  1R05 A;  1HLO A;  3TW8 A;  3FPW A;  5F69 A;  3JVU A;  3A0R A;  4ME4 A;  3MQO A;  3LIC A;  2JHE A;  2D02 A;  4BJP A;  4Q0J A;  2PR5 A;  4AYA A;  4LLO B;  1XJ3 A;  1F5M A;  2O9C A;  4HIA A;  4NXB A;  2OOL A;  2I9V A;  3LR3 A;  2V9A A;  4Y2F A;  3VV4 A;  1N9L A;  2VZW A;  4GW9 A;  2VJW A;  1OTE A;  5DJT A;  2O9B A;  1BYW A;  2W3D A;  5DF9 A;  5IU1 A;  2L4R A;  4RQ9 A;  4BWI A;  1OT6 A;  2VKS A;  4I39 A;  1F9I A;  5J3W A;  3PBN A;  2O9A A;  2IA2 A;  4CLC C;  3ULF A;  4O0P A;  4EUV A;  1TS7 A;  3PR6 A;  1YKD A;  1UKL C;  5AVE A;  4EEU A;  3EQV A;  3PHY A;  2QHK A;  1S67 L;  3H7W B;  3C8C A;  4GS9 B;  3GDI A;  2P7J A;  4EQ1 A;  4WL9 A;  4L9F A;  2W27 A;  3OC2 A;  2W3F A;  2NUT C;  4HNB A;  4ETX A;  5HPF A;  2ZBB A;  4HQA A;  4MCW A;  3E98 A;  5G4Y A;  2YPB A;  3B42 A;  2O0Y A;  4KQO A;  3PYP A;  3RH8 B;  4IUH A;  3RTY A;  1LSV A;  3C2W A;  3TJZ C;  3B33 A;  3P01 A;  4H10 A;  5IT5 A;  2KX6 A;  1A0A A;  1NWZ A;  3KYZ A;  4CLC B;  1NKP B;  3F1N A;  1P97 A;  4WEL A;  3PBS A;  1UWP X;  5I4Z A;  2D01 A;  3NJA A;  1NKP A;  4Q0I A;  2HJE A;  5HL6 A;  1OTA A;  2VEA A;  3UME A;  3HCY A;  2W3E A;  1XJ2 A;  4HJ4 A;  1OT9 A;  4EET B;  5EFW A;  3T50 A;  3RFB A;  4IHQ A;  4WLA A;  3K2N A;  2ZOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...