1CQUA

Solution structure of the n-terminal domain of ribosomal protein l9
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of varying the local propensity to form secondary structure on the stability and folding kinetics of a rapid folding mixed alpha/beta protein: characterization of a truncation mutant of the N-terminal domain of the ribosomal protein L9.
pubmed doi rcsb
molecule keywords 50S RIBOSOMAL PROTEIN L9
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01281 Ribosomal_L9_N Ribosomal protein L9, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.5.10 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 Ribosomal protein L9, N-terminal domain 1cquA00
1CQUA 2HBBA 2HBAA 1DIVA 3J7ZH 4UY8H 2HVFA
chains in the Genus database with same CATH superfamily
2HBBA 2QD0A 2Q9QB 4OOAA 3ANWA 3FNVA 4RSRA 2X4AA 5GHSC 2LSMA 2Q9QA 4FR0A 2E9XB 2QH7A 2R13A 4KW7A 3J7ZH 5GHRB 4F1EA 2HVFA 5EG5A 4FS8A 4F2CA 4F28A 3S2QA 3S2RA 4OO7A 2X49A 4UY8H 1CQUA 2EHOC 3REEA 3TBNA 3FNDA 3LPQA 2HBAA 4FSDA 3TBOA 2E9XD 4EZFA 1DIVA 2HJQA 3CO4A 2OUTA 3EW0A
chains in the Genus database with same CATH topology
1CQUA 2HBBA 2HBAA 1DIVA 3J7ZH 4UY8H 2HVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQU A;  2HBB A;  2HBA A;  1DIV A;  3J7Z H;  4UY8 H;  2HVF A; 
#chains in the Genus database with same CATH topology
 2HBB A;  2QD0 A;  2Q9Q B;  4OOA A;  3ANW A;  3FNV A;  4RSR A;  2X4A A;  5GHS C;  2LSM A;  2Q9Q A;  4FR0 A;  2E9X B;  2QH7 A;  2R13 A;  4KW7 A;  3J7Z H;  5GHR B;  4F1E A;  2HVF A;  5EG5 A;  4FS8 A;  4F2C A;  4F28 A;  3S2Q A;  3S2R A;  4OO7 A;  2X49 A;  4UY8 H;  1CQU A;  2EHO C;  3REE A;  3TBN A;  3FND A;  3LPQ A;  2HBA A;  4FSD A;  3TBO A;  2E9X D;  4EZF A;  1DIV A;  2HJQ A;  3CO4 A;  2OUT A;  3EW0 A; 
#chains in the Genus database with same CATH homology
 1CQU A;  2HBB A;  2HBA A;  1DIV A;  3J7Z H;  4UY8 H;  2HVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...