4EZFA

The crystal structure of a human mitoneet mutant with an ala inserted between asp 67 and lys 68
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
FYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDAKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric control in a metalloprotein dramatically alters function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords CDGSH iron-sulfur domain-containing protein 1
total genus 13
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09360 zf-CDGSH Iron-binding zinc finger CDGSH type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.5.90 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 Ribosomal Protein L9; domain 1 4ezfA00
3LPQA 4F1EA 2R13A 4EZFA 3S2RA 3FNVA 3EW0A 2QD0A 4OOAA 4F2CA 3S2QA 4F28A 4OO7A 3TBNA 3TBOA 3REEA 2QH7A
chains in the Genus database with same CATH superfamily
2E9XD 4FR0A 3S2RA 4OOAA 2QD0A 2HVFA 5GHRB 2HBAA 2LSMA 4RSRA 4EZFA 2E9XB 3FNVA 4F2CA 2EHOC 2HBBA 1DIVA 2X4AA 2OUTA 3TBOA 3CO4A 4FSDA 2R13A 2Q9QA 5EG5A 4FS8A 3S2QA 4F28A 4OO7A 3TBNA 3REEA 1CQUA 2Q9QB 3LPQA 2HJQA 3FNDA 4F1EA 4KW7A 3J7ZH 2X49A 3EW0A 5GHSC 3ANWA 4UY8H 2QH7A
chains in the Genus database with same CATH topology
2E9XD 4FR0A 3S2RA 4OOAA 2QD0A 5GHRB 2LSMA 4RSRA 4EZFA 2E9XB 3FNVA 4F2CA 2EHOC 2X4AA 2OUTA 3TBOA 4FSDA 2R13A 2Q9QA 5EG5A 4FS8A 3S2QA 4F28A 4OO7A 3TBNA 3REEA 2Q9QB 3LPQA 4F1EA 4KW7A 2X49A 3EW0A 5GHSC 3ANWA 2QH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPQ A;  4F1E A;  2R13 A;  4EZF A;  3S2R A;  3FNV A;  3EW0 A;  2QD0 A;  4OOA A;  4F2C A;  3S2Q A;  4F28 A;  4OO7 A;  3TBN A;  3TBO A;  3REE A;  2QH7 A; 
#chains in the Genus database with same CATH topology
 2E9X D;  4FR0 A;  3S2R A;  4OOA A;  2QD0 A;  2HVF A;  5GHR B;  2HBA A;  2LSM A;  4RSR A;  4EZF A;  2E9X B;  3FNV A;  4F2C A;  2EHO C;  2HBB A;  1DIV A;  2X4A A;  2OUT A;  3TBO A;  3CO4 A;  4FSD A;  2R13 A;  2Q9Q A;  5EG5 A;  4FS8 A;  3S2Q A;  4F28 A;  4OO7 A;  3TBN A;  3REE A;  1CQU A;  2Q9Q B;  3LPQ A;  2HJQ A;  3FND A;  4F1E A;  4KW7 A;  3J7Z H;  2X49 A;  3EW0 A;  5GHS C;  3ANW A;  4UY8 H;  2QH7 A; 
#chains in the Genus database with same CATH homology
 2E9X D;  4FR0 A;  3S2R A;  4OOA A;  2QD0 A;  5GHR B;  2LSM A;  4RSR A;  4EZF A;  2E9X B;  3FNV A;  4F2C A;  2EHO C;  2X4A A;  2OUT A;  3TBO A;  4FSD A;  2R13 A;  2Q9Q A;  5EG5 A;  4FS8 A;  3S2Q A;  4F28 A;  4OO7 A;  3TBN A;  3REE A;  2Q9Q B;  3LPQ A;  4F1E A;  4KW7 A;  2X49 A;  3EW0 A;  5GHS C;  3ANW A;  2QH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...