4F1EA

The crystal structure of a human mitoneet mutant with asp 67 replaced by a gly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
KAMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric control in a metalloprotein dramatically alters function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords CDGSH iron-sulfur domain-containing protein 1
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09360 zf-CDGSH Iron-binding zinc finger CDGSH type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.5.90 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 Ribosomal Protein L9; domain 1 4f1eA01
3TBNA 2QH7A 3REEA 3EW0A 3LPQA 4F2CA 4F1EA 4OOAA 3TBOA 4EZFA 3S2QA 3FNVA 4OO7A 4F28A 2R13A 3S2RA 2QD0A
chains in the Genus database with same CATH superfamily
2E9XB 2Q9QA 2QH7A 4FR0A 2HBBA 2E9XD 1DIVA 2HJQA 3S2QA 2LSMA 2HVFA 3S2RA 3TBNA 4F2CA 2X49A 2HBAA 3LPQA 2OUTA 4RSRA 3J7ZH 4OO7A 3FNDA 4FSDA 3REEA 3EW0A 5GHRB 4F1EA 5EG5A 2EHOC 4OOAA 3TBOA 4EZFA 4F28A 2R13A 5GHSC 3ANWA 2X4AA 3CO4A 4FS8A 1CQUA 4UY8H 4KW7A 3FNVA 2Q9QB 2QD0A
chains in the Genus database with same CATH topology
2E9XB 2Q9QA 2QH7A 4FR0A 2E9XD 3S2QA 2LSMA 3S2RA 3TBNA 4F2CA 2X49A 3LPQA 2OUTA 4RSRA 4OO7A 4FSDA 3REEA 3EW0A 5GHRB 4F1EA 5EG5A 2EHOC 4OOAA 3TBOA 4EZFA 4F28A 2R13A 5GHSC 3ANWA 2X4AA 4FS8A 4KW7A 3FNVA 2Q9QB 2QD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBN A;  2QH7 A;  3REE A;  3EW0 A;  3LPQ A;  4F2C A;  4F1E A;  4OOA A;  3TBO A;  4EZF A;  3S2Q A;  3FNV A;  4OO7 A;  4F28 A;  2R13 A;  3S2R A;  2QD0 A; 
#chains in the Genus database with same CATH topology
 2E9X B;  2Q9Q A;  2QH7 A;  4FR0 A;  2HBB A;  2E9X D;  1DIV A;  2HJQ A;  3S2Q A;  2LSM A;  2HVF A;  3S2R A;  3TBN A;  4F2C A;  2X49 A;  2HBA A;  3LPQ A;  2OUT A;  4RSR A;  3J7Z H;  4OO7 A;  3FND A;  4FSD A;  3REE A;  3EW0 A;  5GHR B;  4F1E A;  5EG5 A;  2EHO C;  4OOA A;  3TBO A;  4EZF A;  4F28 A;  2R13 A;  5GHS C;  3ANW A;  2X4A A;  3CO4 A;  4FS8 A;  1CQU A;  4UY8 H;  4KW7 A;  3FNV A;  2Q9Q B;  2QD0 A; 
#chains in the Genus database with same CATH homology
 2E9X B;  2Q9Q A;  2QH7 A;  4FR0 A;  2E9X D;  3S2Q A;  2LSM A;  3S2R A;  3TBN A;  4F2C A;  2X49 A;  3LPQ A;  2OUT A;  4RSR A;  4OO7 A;  4FSD A;  3REE A;  3EW0 A;  5GHR B;  4F1E A;  5EG5 A;  2EHO C;  4OOA A;  3TBO A;  4EZF A;  4F28 A;  2R13 A;  5GHS C;  3ANW A;  2X4A A;  4FS8 A;  4KW7 A;  3FNV A;  2Q9Q B;  2QD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...