3FNDA

Crystal structure of a chitinase from bacteroides thetaiotaomicron
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
SLKVVIGYLALDDWEFESLFPTIEWKYLTHINASFARVKADGTLNINPVRKRIESVRETAHKHNVKILISLAKNSPGEFTTAINDPKARKELIQQIIAFTKEYKLDGFDIDYEEYDNWDKNFPSLLVFARGLYLAKEKNMLMTCAVNSRWLNYGTEWEQYFDYINLMSYDRGAFTDKPVQHASYDDFVKDLKYWNEQCRASKSKIVGGLPFYGYSWEESLQGAVDDVRGIRYSGILKHLGNEAADKDNIGKTYYNGRPTIANKCKFIKENDYAGVMIWQLFQDAHNDNYDLKLINVVGREMMEEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitinase
publication title Crystal structure of a chitinase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fndA01
3.40.5.30 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 (Trans)glycosidases - domain 2 3fndA02
3UEQA 4ACZB 3AXIA 1X6NA 2DQXA 3KL3A 3EDEA 2J7CA 3N1AA 2AMGA 1OD8A 1E6PA 4N42A 4A4AA 1XC6A 3VIHA 1CXIA 1HKKA 3CUJA 1JYXA 1GCYA 1TVNA 3TP4A 1JGIA 4AY1A 4PMOA 3AIWA 3GXFA 1UWUA 1JZ8A 1VJZA 4NF7A 2J7GA 4U2YA 4LX4A 4TVCA 3WKZA 2W66A 2UY2A 2FHBA 2VZTA 3K4AA 2ZUWA 3VGFA 4P8WA 5EMYA 4D1JA 2WLYA 2GSJA 4GQQA 4S3KA 3ZSSA 4HMCA 3UR8A 3T0AA 2WMGA 1TUXA 4P7NA 1R8LA 5BXSA 8CGTA 2QMJA 2J4GA 1G0CA 4QLJA 4IISA 4ATLA 2VRJA 5E09A 4HOXA 2ZUNA 1E72M 4WKFA 5E0CA 1QOXA 1I1XA 1MYRA 2WCGA 6TAAA 3WQ5A 3AMLA 2CCRA 3N9KA 1MQRA 2DH2A 3LMYA 2E9LA 1GUVA 1ISXA 3BMVA 2GDVA 1W32A 3W81A 4S3JA 3W29A 1B3ZA 2V38A 2WHJA 2G3JA 3DYPA 2XGBA 3F5JA 2J7EA 4BCEA 4MNMA 4WSJA 5D9PA 1JZ6A 2WB5A 2XFRA 1HT6A 4CD5A 3RMEA 4B3LA 3CGTA 4CCCA 7A3HA 1MXGA 4QLLA 1E3ZA 2CBVA 2YOCA 3AS2A 4H8VA 5GNXA 1WDSA 1B3YA 1MQQA 2D20A 3AIQA 4TX8A 4PCSA 3ARRA 2CNCA 4PUDA 3PTKA 2W61A 4LQ1A 4U31A 5BRPA 5DT5A 2V5CA 4AZ5A 3PZQA 4YHEA 3WMCA 3WIJA 7CGTA 1LF1A 2W92A 1PBGA 1B1YA 1LG2A 2VL4A 1YQ2A 1UG6A 1V08A 3M46A 2JIEA 4CD4A 1UKQA 2YDSA 2GK1A 3TOPA 2VX7A 1C8QA 1EDQA 3ARUA 1XSJA 2WBGA 1XSKA 2QF8A 2V3FA 3BAKA 3OGVA 1MQPA 1JZ4A 1LL7A 3VIOA 4GZIA 1WDQA 2XG9A 1ZB5A 2WC3A 1B30A 2E0PA 1C7TA 5D9MA 1ISVA 1E71M 3PZNA 5D4YA 5BXRA 4CGTA 1NOFA 2VO5A 2WVTA 4JAWA 2XM2A 5A95A 1UH4A 1JYVA 4U5KA 1V0KA 2VCBA 4CVUA 2A3AA 2G3IA 2ZUSA 1E1FA 1KXQA 5KEZA 3CUFA 5JBEA 3MKKA 3WL0A 3S2CA 4D1IA 4PTWA 2NSXA 3F5KA 5AY7A 3UETA 4J3TA 4PBGA 4R5EA 2BHUA 2GJRA 3AS1A 1FOBA 1HKIA 4DWSA 1J0HA 3ZQ9A 1WDRA 1HL8A 2BY3A 2ZICA 1XCXA 5A69A 3WDIA 4H8UA 4CVWA 3WEZA 1QHOA 4IM4A 1GONA 1B2YA 3W37A 4HPHA 1WCGA 4TOQA 3W27A 3OLDA 4JFWA 1LG1A 3ZJKA 1RP8A 5GNYA 5ABFB 2ESCA 1CGXA 3BGAA 3WF1A 3ZT7A 1V0MA 4Z2LA 2DT0A 4DWSD 1V0LA 3BSHA 5DT7A 1J10A 3TTSA 4AZCA 2CKSA 2VQUA 1MVYA 3SIMA 1UD3A 3WH9A 1WB0A 1UWIA 3VGGA 2CKRA 1R7AA 5GPRA 5IDIA 1KXHA 2XFFA 5CPTA 1JAKA 2BV9A 1E4MM 5A94A 1WO2A 3RM8A 1QW8A 3ZJ7A 1E15A 1O7AA 2XM1A 3BSGA 2E8YA 3SCPA 4CD8A 1EDGA 1VEMA 4PMUA 1UOKA 1UWSA 1V3LA 2J47A 2J62A 4GO8A 1HN1A 3NDZA 5CPSA 3N11A 1QBBA 4TTUA 3EDJA 1H5VA 2RGLA 1X6LA 3FAXA 5CPQA 1IZJA 3MMWA 1E4IA 3WQ8A 3N04A 3VD3A 2OWWA 1BVZA 3RO8A 1G94A 1AQHA 4AMCA 2VCCA 3THCA 3UESA 4H7VA 4PSPA 5A3HA 5A6BA 3BAWA 1MFUA 1VB9A 3BXWA 4UFMA 2W5FA 4V2XA 4MNJA 5FKYA 3WNOA 5A1AA 3W0KA 2CBUA 2YL5A 2NT1A 3SURA 2XWDA 1UA3A 2BFGA 3CIVA 4Z2JA 4Q22A 1C91A 1GQIA 2WMIB 5KZ6A 1ZS2A 3K8KA 1ITCA 3VD4A 1PEZA 2OSYA 3CHEA 2C0HA 1CGTA 3WMSA 4DM1A 1XV8A 1MW1A 3AQUA 5GQBA 1DP0A 1E56A 3NSMA 3EBVA 1KR0A 2ZUUA 5A6BD 1FH8A 1ZU8A 4IUGA 1CXKA 3T0BA 3GNRA 4UOZA 2Y8VA 1BTCA 5HPOA 1DWJM 4OIFA 1FA2A 4BS0A 1EQCA 4F66A 3QOKA 4JZ5A 3BLPX 3AIEA 4QLKA 3EYPA 4W8BA 4QCEA 1CPUA 1J18A 5DFAA 3AIUA 3PTQA 1MW0A 1UKSA 1V3JA 3VGDA 1QNQA 1RH9A 1Q4NX 3EMCA 1KQZA 5LA2A 4BF7A 1UKOA 2VZUA 4PMQA 1CIUA 4D72A 1QPKA 3W25A 1VEPA 4U5IA 2OSXA 3L2MA 5A2CA 3MUIA 2OLHA 2F61A 3CH9A 4GI6A 1VEOA 4Z2GA 1E4LA 1FH9A 5A6KA 2ZWZA 5I6SA 1BFNA 1W9VA 3RILA 2EBNA 1M53A 2FHCA 1ZBCA 1E0XA 1SMDA 4GINA 3HU7A 1J0KA 2B31A 3HJEA 3PZGA 4LYRA 2YKKA 4QDMA 2BVTA 3A47A 3AYRA 3OLEA 1JD7A 4R27A 1QNSA 4WK9A 1FFRA 1C92A 2C7FA 1E4NA 4IPLA 2E8ZA 3NCOA 4P7LA 3N18A 4CUCA 1XHGA 4OZOA 4W7VA 1G1YA 1BSIA 1UKTA 4AZ7A 1WDPA 3WNMA 1DWIM 1MFVA 1GHSA 4MB1A 4GZJA 3I3DA 5I3DA 2EJ1A 4W93A 1V6XA 3WNPA 1ZL1A 4W5ZA 1XD1A 3N17A 4PTMA 2W91A 1VFFA 3VIMA 2Y8KA 2PBGA 5ABHA 2VZOA 2VCAA 1R86A 2WZIA 4H41A 2WSPA 1CXHA 4D6HA 1E55A 3VNYA 1L0PA 4UOQA 1KQYA 4GI9A 3T09A 1I75A 1HJQA 5D8WA 3VMNA 1LL6A 1K9EA 2YL6A 1IV8A 2OSWA 1E73M 1OM0A 4M82A 3SCOA 3O6AA 4AZHA 3TTQA 5HPCA 4JFVA 2CBIA 4JL2A 3CZEA 1CLVA 1XH2A 3VU2A 2EPNA 5A8OA 4J3SA 5GNZA 1JIBA 5HBFA 2JIWA 4P8UA 2PWGA 4HA4A 1OGSA 1J11A 4GPNA 1CGVA 1X1NA 3KEHA 4J3VA 1UH3A 2VRQA 3CLWA 2WZHA 1MXDA 3WF3A 7TAAA 5FIPA 3AMDA 3WFLA 1BQCA 1Q6FA 2A3BA 3WL1A 4KMQA 3FXYA 3CZLA 5CXPA 5JUVA 3VIPA 1TG7A 2WAGA 2XUCA 1QI4A 2G4FA 5EFFA 4HA1A 3MUY1 3CZJA 5FL0A 4W8AA 3SCTA 2PI6A 3A4XA 4EAMA 4MADA 3W4RA 1KXVA 2DSWA 3AHTA 5I0DA 2VVSA 3DYMA 1EXPA 3WQ6A 3PTMA 1CYGA 4MNLA 4ZXOA 5CGTA 5FCZA 2X8RA 2WLZA 1HL9A 3CO4A 1V0NA 3VPLA 2ZX5A 3AZTA 1PX4A 2O9PA 2XGIA 3CUGA 5EBAA 4D6GA 5CLTA 1C3FA 4AEEA 1SFSA 3K46A 2V3EA 3RM9A 4Y7EA 1KXTA 3ARVA 3PZOA 4E8CA 1QNOA 3OA5A 4PTXA 2YLLA 1R7OA 4PTVA 1BLIA 3LPFA 3WF4A 1HJWA 1J0YA 3IJ9A 2WVSA 4D6FA 5A6JA 4H8HA 3NSXA 3NSNA 9CGTA 1XSIA 3SUSA 3QOMA 2Y24A 1TR1A 3WUFA 3L4WA 2A3CA 1EHAA 3ZT5A 2X05A 3ARTA 3L4YA 4PMXA 4ZE5A 3W6MA 3ARPA 1KGXA 5CSYA 2VQTA 1V6VA 4AD5A 1ZBVA 1J0ZA 5M5DA 1Z32X 3U57A 3CHCA 3QHOA 5CQ1A 1GVIA 4EE9A 1WP6A 1H49A 4F9JA 4BQ5A 1E6NA 1OIFA 2TAAA 1CBGA 2BY2A 5A6AA 5M03A 3GBDA 2D1ZA 4OBSA 2GJXA 1JAEA 3GXIA 4CKQA 5LYRA 3DHUA 3HMCA 1V6WA 4MTVA 2J7HA 4KRUA 3FHQA 2XVLA 1B9ZA 2UWFA 1PIGA 4CN6A 1GJWA 1F4AA 1JYNA 2DT1A 1OCQA 4M1RA 3L4UA 4P8VA 1XGZA 3AI0A 1V6YA 4U2ZA 2HVMA 3RM4A 1UD8A 1E9LA 2MANA 3WD0A 1WAWA 4AYSA 2ZX6A 1BVNP 3B9AA 2VC9A 2WMJA 3N12A 3IANA 3SCSA 4W8LA 2DSVA 1V3IA 4J3XA 4MB4A 1C8XA 4QCFA 1W91A 2JEPA 4MPKA 1U2YA 4LXFA 1JNDA 2YA1A 1E3XA 2D2OA 3WELA 4J27A 3IAQA 2X0HA 1CWYA 1BF2A 1WZAA 3WDRA 1UZ4A 1ODZA 3L4ZA 1DHKA 3WN6A 5A8QA 3MMDA 4AIUA 1BYBA 5D9OA 1R87A 2V3DA 3LPPA 3WD2A 2WW5A 3VD7A 3SUUA 3GNPA 4XV0A 2E40A 1HF6A 2BXYA 4XB3A 1NP0A 2X2YA 2Y2WA 3WUGA 4FMVA 1C93A 4X0NA 2WK2A 2DT2A 4YHGA 4NSBA 3WF2A 4TVUA 2WANA 4UFIA 1ITXA 1LWJA 2WMFA 1JXJA 2WVVB 2D22A 1UWRA 2QLYA 2XIIA 3VIFA 2CYGA 1F4HA 2Z1KA 4AXNA 4JKLA 4TXEA 4HMEA 3AICA 2AAAA 2G3NA 3VDAA 3VKKA 1CGWA 1HIZA 2QMKA 4F79A 1QW9A 2WC4A 3PBGA 5AYIA 1UYQA 1GORA 4XZBA 3VM7A 5HOSA 2F2HA 3WH7A 1DWHM 3MV01 5I24A 1B3WA 4P7QA 4JFTA 2QPSA 4HZ7A 3AXHA 2UY5A 1UUQA 3EDKA 3OLIA 3VIGA 3BAIA 1GOMA 3CUHA 1JZ2A 2WMKA 6A3HA 1BYCA 3CBWA 5FOOA 1OT1A 3WEMA 1AMYA 4X9YA 1UR8A 4AD4A 3MUAA 3DECA 3VD5A 1UZ1A 4J28A 2XTKA 4ZFMA 3TA9A 1E40A 4DUXA 1BHGA 3UR7A 1UR0A 2WVUA 3CPUA 4A3HA 4EKJA 5LA0A 2XVKA 4M56A 1PX8A 1ISYA 3AHZA 1GOQA 2W67A 1GQKA 2VVNA 4K68A 3AIVA 1H11A 2J8FA 3MU7A 2ZXQA 4DUWA 1LJYA 1B90A 3CMGA 4ZE4A 3N15A 1TE1A 2CERA 1J9YA 1OINA 2CITA 2W63A 3W28A 2EPMX 3RCNA 5CZKA 3TONA 3MO4A 4TVDA 2GDUA 3VOCA 3CTTA 1Q6GA 2PBOA 1QI5A 5C8BB 1GOIA 2VT0A 3ZO9A 1PZ3A 5I23A 3I3EA 2DT3A 4PN2A 3I3BA 3CHDA 1OB0A 2WHKA 3WQVA 4FLSA 2OYMA 2JE8A 4H04A 1M03A 2J74A 4ACYA 4JKKA 2QPUA 4D6CA 4HMDA 3FW6A 1J01A 1E1EA 1IT0A 4FK9A 2RGMA 4P8XA 3AOFA 4C7DA 4MB3A 3GH5A 1CGYA 1DWGM 4UOJA 3VIJA 1EO7A 4WIWA 2XPKA 2WMHA 3AHVA 3CZ8A 4MB5A 1FP9A 3ZT6A 3VX1A 2GUYA 1K9FA 3WSUA 5BWFA 1EQPA 1PPIA 5IFTA 3VIIA 2ZXDA 1M7XA 1KWKA 1EO5A 2QV4A 4MNKA 3T2OA 2W4XA 5C71A 4Z2IA 2O9TA 3A3HA 1WPCA 4WJXA 2HISA 1KBKA 2GK1B 4GXPA 2F8QA 1W2VA 1Q6DA 2XIBA 2DEPA 1GOKA 2YA0A 1JG9A 1JNEA 2WKLA 3WNNA 1W3JA 5BROA 3BCFA 5A8PA 4EANA 5BCAA 2JF7A 1EOKA 3U7VA 1EIBA 1JI2A 3PZVA 2ZE0A 1KCKA 1AVAA 1ESWA 2OYLA 1ZBKA 4UTFA 1UD2A 2D3LA 2E9BA 2Q8XA 3ARZA 3W26A 1GJUA 1QVBA 1LLOA 3ECQA 4RE4A 3AIBA 3RJYA 4TX6A 3T2QA 3WMBA 2WNWA 3UG5A 1KWGA 3CUIA 3AZSA 4KWUA 3RJXA 1ZJAA 1BPLB 3GXDA 4OKDA 4DWSB 3AYSA 1JL8A 1KGUA 4DM2A 1K6AA 1HNYA 6CGTA 4CCDA 2WPGA 1HJVA 2XSBA 3VDHA 1BG4A 1UQYA 3AFBA 2D0HA 4WF7A 3A4WA 2EPOA 3MANA 1J0JA 3AJ7A 1KR1A 1XH1A 1V02E 3GBEA 3M6DA 4WSKA 1HKJA 3WDHA 4ACZA 4UQBA 4NZCA 5DEZA 4J3WA 2WSKA 2JEQA 1US2A 3WNKA 4YN5A 4C7GA 4NRRA 4UQDA 1LL4A 2FH6A 4B9ZA 4M80A 3ARSA 3K1DA 1H1NA 4AZCB 3VDBA 3HN3A 3VNZA 1EHNA 1CNVA 2D24A 2GJPA 1V6UA 5HNNA 1W9PA 1OD0A 3M07A 3WNLA 3GTNA 5IXEA 2NW0A 2XSAA 4NRSA 3VD9A 1GPFA 4Q7NA 1PZ2A 4ZXLA 2WBKA 1GQJA 3ARYA 3EDFA 5I77A 1KB3A 4CU7A 2X1IA 3WQ4A 3W53A 2PWEA 1UD4A 2A3HA 5ABEA 2BY1A 4RE3A 3GDBA 3QR3A 5JIWA 4HOWA 4X0VA 1GVYA 2J75A 3SCQA 3WFZA 3K8MA 3ZR6A 4HA3A 3POCA 3ZSTA 2Y4SA 1B3XA 3F5LA 4WKAA 4AD3A 1M01A 5ABGA 3UG4A 3N13A 4AD2A 1FFQA 1TA3B 4XUYA 5AC4A 1CDGA 1N82A 3SCUA 4JCMA 1NOWA 1I1WA 1BYDA 4M24A 2X09A 3GXMA 3SCNA 3TTYA 2BVYA 3L4TA 4PMVA 4W7UA 4UZUA 4UQEA 1W3LA 4KGLA 2ZUTA 2ZUMA 2DIJA 1C7SA 2CBJA 8A3HA 5CSUA 4JFUA 2WHLA 4ML4A 3POHA 4F9DA 2Z1SA 4CN4A 1OBAA 3ARXA 4W85A 2YA2A 4JHZA 4AIOA 5CGMA 1OWQA 1XD0A 1DWAM 2WWCA 5TD4A 4GIAA 3SUTA 2XVPA 3RDKA 1RD6A 2J7BA 4GZEA 4C7FA 3OG2A 4FF5A 3MSDA 4PYSA 4B16A 1QNRA 3ARQA 4GO9A 2WCSA 4M8UA 1JF5A 4W89A 1W2PA 1EDTA 2YIHA 3VTRA 1E6ZA 2DSUA 3NIYA 1HJUA 3KL5A 3PZ9A 2XVGA 2XJ7A 4LPCA 4N0RA 4CD7A 5M17A 5DF0A 3WDPP 4QP0A 3L4XA 1UD6A 3BMWA 1HVXA 1HJXA 3GNOA 3OGRA 4UFKA 4AISA 2C8NA 2GFTA 5DMYA 3OZOA 1VBRA 1HP5A 5AYBA 4FLQA 1DEDA 2CPUA 4D71A 1CECA 3GM8A 1UR9A 3K4DA 1E0WA 5E0FA 5E70A 1U33A 3GZAA 4H2CA 2BVDA 1GW1A 1HJSA 4V28A 1ISZA 2YDRA 1QHPA 3APGA 3U5YA 1W1VA 4D6EA 3GH4A 5I2UA 2WZEA 4B3KA 3BAXA 2O9RA 1UQZA 2VX6A 1WKYA 4HOZA 2OYKA 1KBBA 2XYLA 2BHZA 1GOOA 1W1YA 1QNPA 1UR1A 1QBAA 3DC0A 4GQRA 1S46A 5E9AA 1NP2A 2ZOXA 2Y5EA 3BH4A 2ZIDA 4W86A 4RE2A 1C8YA 1NWTA 3B9DA 4RL3A 2DPEA 1KGWA 1NH6A 2WYSA 4W84A 3WF0A 2G41A 3WBAA 1CXFA 3FNDA 4PMYA 3K8LA 2AOSA 3IJ7A 4AWEA 1E5NA 2UY4A 3NJ3A 3PN8A 2EPKX 3SUWA 3J7HA 1HP4A 3VINA 1K9DA 4OUEA 4D6JA 2WCAA 4HPGA 5C70A 2ZX7A 5HXMA 1FHDA 3WD4A 3WDJA 3L4VA 3AISA 5FD0A 1OGGA 3L2LA 5ABFA 3B9EA 3FN9A 1PIFA 3VILA 5M3WA 4AD1A 4UQAA 1PAMA 3BAJA 4MAVA 4UCFA 1UH2A 4M81A 2CESA 3KL0A 1RPKA 1LWHA 5F7UA 2PWFA 1VIWA 3A6OA 4PRWA 3PZIA 4IPNB 2QHAA 1W3HA 2IUZA 2PF0A 2PWHA 2O9OA 4MJ2A 5A2BA 3KE0A 3AMKA 5EB8A 1CENA 1V3HA 4AZ6A 2D3NA 4W87A 3W24A 1J12A 2WXDM 3W6LA 5I5RA 2J8GA 2GVYA 4BQ2A 2G3MA 3E1F1 4CD6A 1K9TA 3UCQA 3BC9A 1GZJA 2BS9A 2VMFA 2FGZA 1CXLA 1ECEA 3BAYA 4P7OA 2WKGA 3AHXA 3QHNA 3FY1A 1D2KA 3D3AA 4UNIA 3WEOA 3CZGA 1WZKA 1JF6A 2CHNA 2EPLX 2ZWYA 1XYZA 3ZIZA 3U5UA 1VENA 1JXKA 1UHVA 1G5AA 1QI2A 2IXVA 3PHAA 4AEFA 2WMIA 1VJSA 2V5DA 2VR4A 4ZEPA 1D7FA 1BGGA 4YPJA 3IJ8A 3T08A 4PMNA 1NARA 4U3CA 3NDYA 2VZSA 3VX0A 1H2JA 1NWSA 3NUKA 1XCWA 1NWRA 4QAWA 5BXTA 1Q6CA 3WH8A 5D8ZA 4AZGA 1VAHA 3QHMA 5JBFA 1DWFM 1FH7A 4FLOA 3AXXA 1V03A 4J3UA 1W1TA 3UERA 1WE5A 1VFUA 2J7FA 4WLCA 4XX6A 1E43A 2ZXBA 4U33A 1WZLA 1MW2A 1PJ9A 3VDCA 1U30A 2YL8A 1UWQA 1VBUA 1B0IA 1VFMA 4DUVA 1CEOA 4EK7A 3TTOA 4GI8A 3EMQA 4U3AA 1V3KA 1JDDA 1TVPA 2VZVA 1JYWA 1J0IA 1CLXA 1OSEA 4PEEA 4CU6A 4LYQA 4HZ8A 2YBUA 3VUPA 2ZX8A 3G6MA 4ATWA 5CJ5A 2G8ZA 2VUYA 1P6WA 2YBTA 3CMJA 3OBAA 4URIA 3O9NA 2GJXB 2VNCA 3ALGA 4CCEA 3BCDA 1JDCA 3AMGA 2JF6A 1ODUA 5DO8A 3AZRA 3ZR5A 4JFSA 1Y7VA 4PCTA 3LPOA 3D5HA 1GNXA 1JFHA 4V27A 1ZBWA 3PZMA 2VX4A 3PZTA 2DSZA 4HP5A 1E6QM 1UR4A 2DSKA 4P7RA 4AIEA 2FH8A 1QI0A 1A3HA 1O6IA 4MJ4A 4HZ6A 3S6TA 2JFEX 4PMZA 1UKPA 3AIRA 4B9YA 1H4PA 1HVQA 4AW7A 3A4AA 1BG9A 3AS0A 1UA7A 4BA0A 4JHOA 3SCRA 4AZBA 5I78A 5LA1A 1KCLA 3VMPA 1TFVA 2V3GA 4MDPA 4E4PA 3SUVA 4UFHA 3T0DA 4E2OA 2J7DA 1TCMA 4AC1X 3AROA 2YDQA 1HX0A 2VOTA 1CXEA 1AQMA 1D3CA 1XH0A 2WWDA 4BQ3A 2VX5A 5IHSA 3DHPA 1H41A 2OWCA 5IFPA 1UR2A 1E6RA 1CTNA 4PMRA 4F8XA 1TMQA 2OWXA 1TA3A 4KRTA 4UQ9A 1E0VA 4W7WA 5I79A 1M04A 2PB1A 5BRQA 5ECUA 3SCWA 1V3MA 1JZ3A 1QI3A 1IZKA 2ZX9A 3EDDA 3LPGA 3M7SA 3WY1A 3WD3A 2EXOA 2BY0A 1UD5A 1BYAA 1LQ0A 5IHRA 4A3YA 3CZKA 3THDA 1H0IA 5A8MA 1JD9A 2DIEA 4UFJA 3OLGA 4UZSA 4CU8A 4UQCA 2XFYA 3VM5A 5FL1A 3MV11 1UWTA 3AHYA 4OBRA 2XWEA 3VVGA 3FHAA 3MSGA 4FLRA 5AC5A 1ISWA 4BQ4A 3NYDA 5CLWA 2DH3A 3OZPA 3SEPA 1WZMA 3QGVA 4MAZA 1GQLA 2EO7A 1XRVA 3U7BA 2X0YA 4JKMA 2FDMA 3WD1A 3T2PA 4PMDA 4Z2KA 4LGXA 4L4OA 3GH7A 4Z2HA 3DYOA 1YHTA 2EQDA 5A6SA 4BZYA 3RIKA 1JDAA 3VIKA 5HDRA 2CIPA 2CHOA 4J7RA 1E70M 4D6DA 3EMZA 3ZM8A 1KFWA 2J79A 4GKLA 1NWUA 3WH6A 1Q6EA 3ZJ8A 1TZ7A 1US3A 1NM9A 2UY3A 3UG3A 2A3EA 1H09A 1NQ6A 2BHYA 2YLAA 4W88A 3OIHA 2XHYA 1GHRA 3VO0A 4JIEA 1W9DM 4JL1A 1W9XA 3WBEA 4KH2A 3SCVA 1NOUA 3II1A 1VFOA 1VF8A 4LYPA 1FHLA 1EOMA 1GOWA 2FHFA 2O92A 1H3GA 2JALA 5D9NA 4TTGA 2WHMA 4W5UA 4UR9A 3VGEA 2J77A 1W9UA 2FGLA 4MDOA 2E9MA 1HXJA 3AMCA 4E8DA 1R85A 3MUZ1 1JFXA 3O2LA 1BAGA 3WDQA 4UFLA 4OJYA 3AS3A 3MS8A 3IAPA 2ZUVA 3KZSA 4PSRA 3VMOA 5A6MA 1HKMA 2D23A 2YL9A 1QHZA 3FAWA 1G9HA 3F4VA 2D0GA 3IK2A 2BNJA 4B15A 5A2AA 3BLKA 4OOZA 1W3KA 2VR5A 5EFDA 3CHFA 3RPMA 3WUEA 1ZJBA 2XVNA 4DWSC 3JUGA 4OOUA 3OB8A 1JZ5A 3GYCA 4L4PA 4D6IA 1MW3A 3VGHA 1E6XM 4TUFA 1SMAA 2YJQA 4XZWA 2WC7A 2J25A 2CEQA 2VJXA 1CZ1A 4AZIA 4HTYA 3ZMRA 2ZXAA 2VI0A 3ARWA 5BXPA 4AD0A 1EH9A 1CGUA 2E4TA 2CETA 2E3ZA 2D0FA 5E6YA 1RP9A 3WENA 3WUBA 1A47A 2DGAA 1PX3A 5CG0A 2BXZA 3MMUA 1AQ0A 2WM0A 1C90A 4HU8A 2NT0A 4QFUA 1OT2A 3PZUA 1E6SM 1VRXA 4HU0A 1JZ7A 2VTFA 5BYWA 1SR0A 4NI3A 1H0GA 2DDXA 2PC8A 1B31A 5A8NA 1EGZA 1BGAA 4PUEA 1OGBA 1W1PA 5JBDA 3W38A 1OIMA 2IXUA 3ZJ6A 1G01A 4JCLA 1XYFA 2VURA 1L8NA 1JI1A 5E6ZA 3WH5A 2CXGA 1MWOA 3OGSA 1EA9C 2EEXA 3WQWA 1WNOA 1B3VA 5A6LA 2J78A 1SYTA 3ZOAA 1FP8A 3ALFA 2WVVA 4KGJA 1W9BM 4WKHA 2VRKA 1E5JA 3KWXA 4CN1A 4ZENA 3G6LA 2PWDA 3B8SA 4ATDA 1V02A 1DTUA 4M29A 3VGBA 2W62A 5JIPA 3W82A
chains in the Genus database with same CATH superfamily
3UEQA 5TNVA 5TBOA 3G77A 1X6NA 2OO0A 2WO5A 3DAQA 2FB2A 3QBUA 4N42A 3NXFA 1XC6A 1RY0A 4FR1A 4Q7IA 4ZSUA 1BKHA 4QEHA 4W4QA 3O8AA 1ZFJA 5HQEA 1JZ8A 3WQEA 4A29A 4U2YA 4LX4A 4GVFA 1XR2A 3KP1A 2UY2A 4QE4A 4UNLA 4UTWC 3K4AA 2ZUWA 3VGFA 2G37A 3LHYA 4HCDA 1ZJHA 4D1JA 2WJFA 4YVXA 3A21A 1KM2A 3UR8A 3T0AA 2WMGA 1LLWA 1LLZA 5CH9A 4JIPA 3H23A 2ZYFA 4QLJA 2ZUNA 4NJKA 3GLCA 4WKFA 5E0CA 1I1XA 1X1OA 1R9XA 2G96A 4XAYA 3AMLA 4NG3A 3UPBA 1MQRA 2DH2A 3ABXA 2E9LA 1GUVA 3IIPA 5HMEA 3PR2A 5I3FA 4S3JA 4X61A 3KBNA 4I8YA 3CPGA 1B3ZA 1F73A 2ZRUA 4B5VA 1TQJA 1IXOA 4LJ3A 2J7EA 4BCEA 2EHHA 2WB5A 4CD5A 1YE4A 7A3HA 4CCCA 1GVFA 5DRCA 3URBA 4MG4A 1OC7A 3TFXA 5GNXA 2GQ8A 1WDSA 4RW5A 5H6HA 4TX8A 2CNCA 2OB3A 4R7OA 2NVDA 1TWDA 5HWMA 4HYVA 5M2FX 5DT5A 4N4PA 4AZ5A 3FVDA 3M5YA 3BVJA 3GFXA 4Q8WA 3RAOA 1LG2A 2VL4A 4DJDD 1YQ2A 3MCMA 4LT9A 3W88A 4CD4A 4FSAA 3W74A 1C8QA 4JQ1A 3W1LA 2WM1A 1FDJA 3H70A 2WBGA 2QF8A 1UBSA 2NLIA 3AYTA 2P50A 3LZ5A 2Z6JA 1MQPA 2PDLA 3W75A 3VIOA 3M0MA 4I9MA 2YCJA 1VP5A 1KM4A 4ZB2A 1C7TA 4GQ0A 1SSGA 1ISVA 1XLLA 4GUFA 4CGTA 3I6RA 1MZHA 1M7JA 2XM2A 5A95A 1UH4A 2EF9A 4PH6A 2A3AA 1MEIA 1E1FA 3NQBA 3CUFA 3BG5A 2PA6A 3MKKA 4ZTYA 4AEOA 4ADSA 3WL0A 3S5ZA 3UPMA 3S2CA 4PTWA 4KWVA 2R1KA 5C5YA 2GJRA 4UUIA 3S2RA 2ZE3A 4DWSA 1OY0A 1WDRA 1HL8A 1RVKA 4C91A 2BY3A 1ITUA 3HPSA 1FWSA 5A69A 3QC0A 4O10A 1TQXA 2HPMA 4H8UA 2VC5A 4AWUA 3W37A 5GJMA 2AKMA 2QJIA 4JHMA 4NJHA 1GOXA 1QO2A 4LYKA 3W3OA 1RP8A 5GNYA 5ABFB 1XP3A 1CGXA 4AG0A 3PY2A 2Z1XA 3WF1A 1QFEA 3EX2A 3UU0A 1XKJA 5XINA 1J10A 4AZCA 2CKSA 2VWSA 3SIMA 4XO6A 3WLJA 3WH9A 4X9SA 1H51A 1PXGA 3P0WA 4HMNA 5CJNA 5DELA 3BZGA 5CPTA 3EOOA 3A24A 3UR2A 3RM8A 1E15A 1POJA 3BSGA 4Z1BA 4JIRA 5AYZA 1VEMA 3HPFA 4PMUA 1X8CA 4NHVA 4X60A 1UJPA 6ENLA 4S2BA 3MW7A 1HN1A 3H7UA 4GKTA 4I9AA 1X6LA 3S2NA 4LV9A 2G4JA 4C60A 4JIHA 3VCNA 2HJPA 5CAHA 3LCIA 5LNUA 1PUDA 3H2OA 3M5ZA 3T81A 1BVWA 1R3TA 5AYXA 2W5FA 4F28A 3KRUA 3HPAA 5A1AA 4AUBA 4TU1A 4DXVA 5LZLA 3HGRA 3BARA 1UA3A 1J96A 3LNPA 3CIVA 4RXFA 3VNMA 3U2ZA 3SY1A 5KZ6A 1ZS2A 1YTDA 3LXCA 1M7OA 1ITCA 3VD4A 1PEZA 3OQ8A 2J66A 1AH0A 3UW6A 2C0HA 3SRDA 1VFHA 1XV8A 4A8RA 1MW1A 1E56A 1KR0A 3IVUA 1OFAA 5A6BD 4DJED 4YYFA 5HJYA 2PDYA 1FH8A 1ZU8A 2DY3A 4UOZA 3GNRA 1TO3A 1IEIA 4EWJA 5HA7A 5HPOA 4UTWA 1FA2A 3TBNA 4BS0A 1EQCA 1TV5A 2ONEA 4F66A 2QUTA 4RNFA 5XIMA 3AIEA 2HVOA 4JOMA 5BNKA 4QCEA 5DFAA 3TX9A 2HMCA 1MW0A 3VGDA 1F6KA 4WY0A 1RH9A 3LGGA 5K4XA 2EKGA 2PD5A 1E9IA 4GC4A 4QJ5B 2Y88A 3W85A 4KFPA 4GCXA 1I8JA 2DJLA 4B2DA 4LF1A 1VEPA 4K8EA 1TELA 2OSXA 2A0NA 5AOUA 3MUIA 4KESA 3CH9A 4GI6A 1QNVA 1VEOA 4ZB5A 2VDHA 3OQEA 3N2CA 4G1NA 1K8CA 3M4HA 3IVSA 5EY5A 1E0XA 4O17A 3LERA 4A8LA 3PZGA 4LYRA 4UTLA 4QDMA 3R8RA 1PSCA 1JD7A 2O56A 1FFRA 4O50A 1C92A 3I6EA 4CQ9A 3SECA 1E4NA 1QK0A 2WJDA 3C8FA 3N18A 2RJGA 4MMWA 3IPWA 1G1YA 1LORA 1UKTA 3WNMA 2BOEX 3I3DA 4PUNA 1V6XA 1ZL1A 4GIRA 2XN1A 4DB7A 5BWAA 3CM4A 4AYGA 2Y8KA 3O6CA 4E2BA 2VCAA 1ME9A 3E2QA 1SUXA 2WZIA 1CXHA 1FUYA 1E55A 3C61A 3MHUA 1L0PA 4GI9A 1I75A 4F0MA 1S39A 3HIJA 3VMNA 2YL6A 3SR7A 3TCSA 1SO3A 3QM3A 3UNTA 4HHHA 4R85A 4M82A 1XWYA 3IGXA 4DYJA 1CLVA 2QJHA 4J3SA 1DVJA 5HBFA 1KRBC 4DNHA 2PF8A 2DUAA 3GR4A 1EP1A 2ZDRA 3NQGA 3QEZA 4DPPA 1CGVA 1X1NA 4J3VA 4QSHA 4GJIA 4GYPC 4FEZA 4H7ZA 4NX0A 7TAAA 4UTKA 3UCDA 4ZQMA 3KTXA 3FXYA 5JUVA 4DUOA 1US0A 2XUCA 5E0KA 2G4FA 1EUNA 5FL0A 4W8AA 3SCTA 1NF0A 3W4RA 3AHTA 5HJLA 2VVSA 3SIZA 3TOYA 3EXTA 1EXPA 2FZMA 4BY3A 2QULA 1QR7A 2QUUA 4ZXOA 5CGTA 2GDQA 5FCZA 2QUVA 3H2CA 4H19A 2X42A 3NQCA 4I3GA 3AZTA 2O9PA 2XGIA 4KS0A 3CUGA 4FXSA 4D6GA 5JH2A 1FKXA 3NEVA 4O53A 1EGVA 3EA2A 2V3EA 4Z1AA 3KRSA 1A53A 2GZXA 2REQB 4REQA 4EPEC 3R25A 3A13A 1CCWB 2HVFA 3N6QA 4E8CA 2I1OA 2Y62A 3OA5A 4UCGA 2BZNA 3MA8A 1SJCA 3O15A 6REQA 5C9UA 3LPFA 3WF4A 1I9CB 1J0YA 1XIDA 4Q4MA 1TRIA 3CHVA 4JPGA 2A79A 4JTHA 1ME7A 3LCXA 3NSNA 3WLPA 4LB4A 4OWGA 3USZA 4C90A 1P6CA 3SUSA 3GHSA 4QE5A 3QXBA 4YTQA 2Y24A 2A3CA 5C0QA 3ARTA 4ZE5A 1XKYA 3ARPA 3RRAA 4AD5A 2GJNA 1ZBVA 3OVPA 5M5DA 1J6PA 4GCAA 4GQBA 2INZA 5BOEA 3IUIA 2OMAA 4F9JA 4BQ5A 1OIFA 2TAAA 4QITA 2ADAA 3GYEA 3GBDA 4IX0A 2GJXA 2XSXA 5LYRA 3L5MA 5CBIA 3HMCA 2PDQA 1R2RA 2J7HA 5LGZA 5SWUA 3BSMA 1GJWA 2DT1A 1OCQA 5J5DA 3L4UA 1XGZA 3RM4A 1Z69A 2MANA 3LCGA 4QSFA 1WAWA 2VEFA 1M68A 3WJYA 3B04A 3FGCA 3L12A 1F6YA 3QTGA 5AZ0A 5J04A 3CJPA 2JEPA 1U2YA 2V2HA 4LXFA 1JNDA 1VQTA 2BMBA 2GUUA 1E3XA 2YA1A 5HMSA 4J27A 3H26A 3KTSA 4LRTA 1CWYA 1BF2A 5EU9A 1OFQA 1P0KA 4ZSTA 4RW3A 1ZPTA 1HG3A 1TWSA 1AJZA 2Z28A 5L9FA 5A8QA 3DZ1A 3OA3A 1R87A 1EP3A 4JQ2A 3KBMA 4XB3A 5AVNA 1S5VA 1NP0A 5A5WA 5CPOA 1H7NA 2AQVA 3WUGA 3GG7A 2WK2A 3N2OA 4UTIA 4ZB0A 4QJ1A 4EOUA 4NSBA 3WF2A 3OVQA 3V5CA 2WANA 5C54A 1ITXA 3FJ6A 2MUCA 2P3ZA 1LWJA 1K8YA 1JXJA 3APYA 2XIIA 2Z7KA 4HHPA 1QPNA 3G1FA 1F4HA 2Z1KA 2YXGA 4AXNA 5CPLA 4JTTA 3H2MA 2AAAA 1VPXA 5DCBA 3RUBL 3SRFA 2YPIA 4F79A 1GK8A 1GORA 3QY8A 4XZBA 4EAYA 3IUHA 2A7PA 3PSVA 4NAFB 4CNTA 4K8HA 3MV01 4R33A 5FAJA 1B3WA 4JFTA 1RHCA 4HZ7A 1WAUA 3P0XA 4FHAA 3W7QA 2DZSA 4YNGA 2UY5A 1E0UA 4WCJA 3OLIA 3D47A 3BAIA 1GOMA 3CUHA 3FYYA 1JZ2A 5I09A 1A5CA 1SO4A 4QDWA 1P43A 3CBWA 4EXQA 3C0JA 3RK8A 3OVGA 2A2IA 4IFKB 4NZJA 1OVDA 4U28A 3TA9A 3N2MA 5CC7A 1YBQB 1UR0A 3CPUA 3W1PA 1PZ0A 5LA0A 3OYZA 4B5WA 3GAYA 1GOQA 3WQFA 1LUCB 3R1ZA 2ALDA 2VVNA 1V51A 4MFDA 3DEQA 1IWBA 3AIVA 3MWCA 3BG3A 1L6YA 4GYPA 2ZXQA 5D33A 1SU5A 4RK8A 2QF7A 3ZLFA 1J5TA 2QJMA 3RCNA 4Q4RA 2ASHA 2XZ7A 3KCJA 3CV2A 1QOPA 3CTTA 1AL8A 3ZO9A 1UMYA 5I23A 2I5QA 4QG8A 1WXJA 3G1VA 3ZLHA 3NQEA 4IMAA 4IJRA 1OB0A 1LRQA 3WQVA 4GFSA 4JICA 2E6YA 4H04A 1M03A 3HM7A 2H90A 4JKKA 2PDPA 1L6WA 1P1XA 4P8XA 4O1CA 2J27A 4C7DA 3H53A 4KIRA 1DWGM 2Q71A 2OZ8A 4O0KA 3CYJA 4L1GA 1O1HA 1TCDA 2XPKA 1FP9A 2GL5A 1OZMA 2GUYA 3ZLGA 1VPYA 2NQJA 5IFTA 1W3NA 4LS0A 3KVMA 1EO5A 1Z41A 3T2OA 2W4XA 1VKFA 3CV1A 4C6QA 4Z2IA 4L56A 1WPCA 2PU1A 3LTYA 3MI2A 2PE4A 1RALA 4R7WA 1J6OA 1XPGA 4QXIA 2XIBA 1UROA 2B7NA 1M65A 1GOKA 3F2CA 2YA0A 2WSRA 3AJXA 1JNEA 3WNNA 5BROA 5A8PA 3CU2A 2JF7A 2ZA3A 4TMBA 4HSOA 3RMJA 1PS9A 3OIXA 1ESWA 4EXAA 1AK5A 1XIFA 3W23A 4Z17A 4JTQA 4CQ8A 1UD2A 1F05A 2Q8XA 3ARZA 4R9XA 2V69A 1LLOA 2ACSA 4UTUA 3RJYA 3GDMA 5IM51 3S46A 3WMBA 4H9MA 2PGEA 3A5FA 3CAVA 4FNUA 3CUIA 4KWUA 2E5DA 1ZJAA 3RXZA 1NVMA 4KIEA 4OKDA 3V1HA 1KGUA 3OTRA 3PM6A 4JDYA 3EW0A 1T40A 1HNYA 4CCDA 2WPGA 1GGOA 1S5TA 2XSBA 1UQYA 3UA3A 2D0HA 5EMJA 1EBGA 5HJXA 3G2GA 2OT1A 1QUMA 3MANA 1J0JA 3S9IA 4H6EA 5A8GA 1XH1A 4DZHA 1EXBA 3GBEA 3H54A 4O18A 2IPJA 3W72A 2CLFA 1SM9A 4FOKA 1RXOB 4Q33A 3ARSA 3K1DA 1JCLA 2CZ5A 1DPMA 3TJXA 3HN3A 5D03A 3WQCA 3F1QA 2NVCA 2OLSA 2Q9QB 1OD0A 3C4UA 1OABA 1QO5A 2H9AA 2J24A 4B5XA 3VD9A 3L9CA 3FEMA 2CZDA 2OELA 4C6EA 2WBKA 4GY1A 3BGGA 4DPQA 5KZMA 1KB3A 3V0UA 1UD4A 4GZ7A 1GPWA 2Y63A 4PEKA 2X7VA 3TMLA 4DVOA 2A3HA 3KBVA 1QMLA 3BGJA 3QR3A 2OZ0A 2XIQA 4UTHA 1GVYA 5CZ0A 4BK9A 4DBSA 2H3DA 1O12A 1UCWA 1TTPA 4AD3A 2FJKA 3VXGA 4NUWA 3WBXA 4AD2A 1FFQA 3NL6A 3DBPA 4XUYA 1T8QA 1BYDA 4Y9PA 2CC0A 4A8IA 1UP2A 3TNBA 2Z1VA 4UZUA 2F2KA 1JULA 1W3LA 2E6DA 1Q7ZA 1XLBA 5FSDC 2O0TA 1OYBA 3BOXA 5BMWA 4ERIA 2WJZA 5AC7A 4JFUA 1G4EA 3M0JA 2C6QA 2SFPA 1A5KC 4GUGA 3ARXA 4FO4A 2YA2A 4QS6A 3F4CA 4JHZA 4O16A 4ROPA 1KTNA 3R6IA 1JPDX 3DGBA 1XS2A 3SUTA 2XVPA 3P84A 5LNVA 4LY4A 2J7BA 4GZEA 4GHRA 4PYSA 1DORA 3DX5A 4YTTA 1HL2A 5C7HA 4AIBA 2O7SA 4K1GA 1H63A 1EA0A 3QFWA 1JF5A 4M8UA 5C2GA 5JH1A 2YIHA 5FJRA 4X22A 1Y8BA 3FKKA 3DFNA 3WZ0E 3C2OA 4CD7A 4LS2A 4PB5A 3UPWA 2PDBA 3REEA 1EJXC 1TZ9A 2PDMA 4ZOBA 4XKMA 4NZ4A 2I7GA 1HP5A 5AYBA 4FLQA 1DEDA 4N9BA 4RE0A 2BVDA 1HJSA 1RSCA 3U5YA 3LBMA 2WZEA 3BAXA 4FNTA 3P62A 1OFRA 5DXXA 4GMEA 3V0SA 3TW9A 2OYKA 4POCA 1E9ZB 2XYLA 1W1YA 1QNPA 5D09A 1ZCOA 1UR1A 1XPYA 3O6YX 1W5PA 3W7NA 5FJIA 3DC0A 4GQRA 2L5HA 4FNSA 1NP2A 3KCOA 1XIJA 3BH4A 2ZIDA 4RL3A 1NH6A 1ICQA 2WYSA 4W84A 2XN0A 4B5UA 2GVJA 1PKLA 4H9VA 3WBAA 1CXFA 3UZYA 1Z6KA 5D32A 5BOFA 3KS5A 3IJ7A 4JYFA 2UY4A 4RPPA 3KCLA 2FFCA 3VINA 2BX7A 2VHLA 3EWCA 4J2MA 1T6MA 1YBQA 2WCAA 2V9DA 3W87A 2OEMA 2OXNA 1FHDA 4DX3A 3WDJA 1NU5A 4LUSA 5EA9A 3AISA 3CASA 2ZRVA 1GWJA 1OGGA 5DBTA 4H9XA 3VILA 4UQAA 2UZ9A 1PAMA 3E5PA 3LNMA 2AQOA 3N4EA 1TMHA 2G3FA 4L5ZA 1ADOA 1LWHA 1IZCA 1UBPC 1I2RA 4GE8A 4PRWA 1WDDA 1NSJA 3XIMA 4IGHA 5EB8A 4AZ6A 1DIVA 2D3NA 3P5YA 2NQHA 1XW8A 1I6NA 2R14A 2YXOA 3S2QA 1XLFA 4RUBA 3KOWA 3TZNA 1GZJA 5D04C 1ECEA 2IQDA 4YMZA 2V8ZA 4D8LA 4G9PA 3FY1A 3BICA 3CUXA 3P80A 2FVMA 4GX8A 4NP7A 2CHNA 2EPLX 3GDKA 1KCZA 1RCQA 4IH3A 1JPKA 3U5UA 2OVLA 1AUSL 3WQOA 2HSAA 4ZTXA 3OU8A 1LDCA 1QI2A 2A4AA 5D38A 3PHAA 2V5DA 1ENUA 2WZTA 4ZEPA 4XKYA 3TQ0A 4YPJA 4HTBA 2R1MA 4PMNA 4U3CA 4Z08A 4Y2WA 3QV6A 4HNUA 3STEA 1NWRA 3TC3A 3NOEA 1HKVA 2VD9A 4AZGA 5JBFA 1DWFM 3GVVA 3VUSA 4B3ZA 2HXUA 1WE5A 3BURA 3ZVHA 2WNZA 4V15A 1GZGA 3K1GA 2BTMA 1U30A 2YL8A 5IOBA 2QW5A 1UWQA 3LUTA 1CEOA 4EK7A 3EMQA 3GRIA 1V3KA 1J0IA 2BOFX 4PEEA 4B5TA 1U5VA 4HZ8A 4JS3A 2QCDB 1LP6A 2YBUA 3WLIA 3KDOA 4ZR8A 2VR2A 4GNJA 2VNCA 3ALGA 4I8DA 1QPQA 3BWWA 3T07A 3RRXA 3GVWA 3TYBA 4EXBA 4JFSA 1S2WA 3LPOA 4JNYA 4KPLA 4WDWA 1A3WA 4N6FA 2VX4A 2E09A 3W2UA 1S2VA 1QI0A 3UWWA 1ZRQA 5HWNA 3TQKA 3AIRA 1YRRA 4ZOEA 3UY8A 2DUZA 2OGYA 1Q63A 2WKJA 3QFEA 3WJSA 4L1XA 4L9ZA 4BA0A 1XIGA 4AZBA 5U4NA 3TYZA 3VMPA 1TFVA 2HJQA 1MUWA 3T44A 4MWAD 3HGSA 3TYEA 3SUVA 1F9CA 1LWIA 3P6LA 4FOUA 4UFHA 3TYUA 4F2TA 4EWND 3AROA 3WFAA 2R1PA 1AQMA 3A64A 1XH0A 2CLPA 2VX5A 4FXJA 5CZSA 3TH6A 1H41A 2RDWA 4ZOAA 1XF0A 3DHFA 1GKQA 4PMRA 3UT0A 1TMQA 2OWXA 2H8ZA 5ECUA 1JZ3A 1I0DA 2Y6ZA 1UP0A 1TVLA 2QCMA 4GC3A 4J35A 2EXOA 2BY0A 3RX3A 1LQ0A 5H8PA 1S3HA 3CZKA 1JUEA 3THAA 4IICA 1JD9A 2HZGA 5HMDA 3USBA 4Y9OA 1P0EA 1Z8AA 3W1MA 4ZL1A 2GWGA 1LQAA 1IE7C 2D2GA 3U4AA 1AJ2A 3MSGA 2CXEA 1WZMA 3GVGA 2PZNA 3B0UX 3DFSA 1NDVA 1U5HA 3HGOA 4XIAA 3GC5A 4DJDC 1XRVA 3L68A 2X0YA 4BFAA 3GIQA 1RBLA 4FX6M 2XU2A 3CQIA 4L7ZA 3N19B 1LYXA 3VNKA 1YHTA 1SZGA 3W7PA 2VKZG 3D46A 3RIKA 2GYIA 1UMLA 1FWFC 1E70M 1VBGA 1B3OA 3ZM8A 1KFWA 2P76A 3W7HA 2E25A 2UY3A 2HTMA 4N9DA 3GU1A 2A3EA 4C6PA 3OIHA 1XRFA 1W9DM 3WBEA 2CZEA 1NOUA 3CQ0A 4FOJA 5I3HA 1VF8A 4XZMX 3DFYA 4XZHA 3TXVA 4E8GA 1FHLA 1EOMA 2PURA 4Y9MA 2QCGA 5LXXA 2JALA 1VJIA 1TWWA 1LTDA 4NAEA 4KT2A 1F3TA 5K9XA 4B5NA 1U1HA 5GVJA 1KBJA 3MUZ1 4UFLA 5ENLA 5LXEA 3ANWA 4PFHA 3DFTA 2KZHA 3MCNA 4PULA 2HBAA 1XIEA 4PSRA 3B4YA 3U4FA 3F4VA 2D0GA 1RA5A 2Q02A 3GDRA 5A2AA 4OOZA 2WOQA 4GIYA 4L61A 2VR5A 5EFDA 3CQHA 4FX8A 4LUYA 2O4MA 3JUGA 3OB8A 4XD5A 1JZ5A 2XH7A 1V7YA 3VGHA 1FWCC 2Q8LA 4PUWA 2J25A 1D9EA 1F8IA 4LF2A 4XISA 4Y96A 3LCWA 4AZIA 4AY7A 3VCRA 5BXPA 3E74A 4NJGA 3WENA 1S5WA 1V6TA 5CG0A 2BXZA 2WM0A 3G22A 4HU8A 1Q85A 4FR6A 1BRLB 1OT2A 6XIMA 4NKCA 1S3TC 2DQWA 4P61A 4CNNA 5BYWA 3LHZA 1J79A 1SR0A 4W9TA 4K36A 4RNJA 2PC8A 1B31A 1EGZA 1IIHA 5HUPA 3O16A 3WLQA 3FDGA 4PUEA 1WOBA 1W1PA 2IXUA 3T7VA 5AVHA 4DJFD 1XYFA 1EWEA 2E1DA 1P48A 2HK0A 1IYXA 3CTLA 4PBEA 1WNOA 2IKJA 3ZWSA 4GQGA 1M41A 1ZGDA 2PDJA 1FP8A 3UYCA 4IJBA 1W9BM 5T9BG 4RDYA 3KWXA 2OQYA 5AHNA 4K37A 3LRMA 1F3WA 4XTDA 4ATDA 1DTUA 1LBLA 3I65A 3KM8A 4DJEC 4NYUA 4HHMA 1VR6A 2IS7A 5CZTA 2Q01A 4M6UA 2J7CA 4YTSA 3N1AA 3SN0A 4CQAA 2Y7DA 3DU0A 1O94A 4NZ5A 3DFQA 3TQVA 5FF2A 3OJGA 2A21A 4FIRA 3TP4A 3N3MA 3ERPA 2P53A 1AD1A 2HROA 4RSRA 3NR0A 3H2EA 3M64A 2J7GA 3HQNA 3IGUA 2VZTA 4ZO8A 5EMYA 1RD5A 3T78A 1BEUA 3ZSSA 2QCDA 3A3XA 4QNEA 1S1PA 8CGTA 4KETA 2HNHA 2QMJA 1G0CA 1X7IA 3H12A 4IFRA 4IISA 4ATLA 4HOXA 3TK7A 1E72M 1NF7A 2WCGA 4PTNA 3BQ6A 3W81A 3BL3A 1G4SA 2RAGA 3S8HA 3G0UA 2V38A 4US5A 3V3WA 4DJDA 4MNMA 4K2SA 1V77A 2EPHA 3EKLA 2F6KA 2XFRA 3B0YA 1HT6A 4E2VA 5KZEA 3RMEA 3OBKA 2NSOA 4JTLA 2AGTA 3AS2A 4JN6A 1B3YA 2XIOA 2D20A 3AIQA 3W7CA 2GGHA 4PCSA 2R13A 2J6VA 4OQVA 5T8GA 4GY0A 2P0IA 3OZYA 3RFAA 3PUEA 2Z1WA 3WIJA 4CLMA 5REQA 1B1YA 5ECVA 3UWUA 3IIXA 1EP2A 1TJ2A 1UG6A 1V08A 5C55A 1W1IE 1UKQA 4DF2A 3CL8A 4RZ4A 1JCMP 2RUSA 2GK1A 2YDSA 3TOPA 2VX7A 3ARUA 4LRSA 1FTXA 4FZIA 4NU7A 1OFOA 1JZ4A 4EZFA 1F7BA 2ISVA 2CLOA 4AF0B 1ZB5A 3NYZA 5F4SA 1B30A 2E68A 1KTCA 2X40A 1VYSX 1D8CA 1Z3NA 4IIFA 2ZC1A 3CLMA 2WVTA 4JAWA 3WMLA 4U5KA 2VCBA 4CVUA 2HCVA 1KXQA 5KEZA 4GIEA 5JBEA 4LBSA 3TSMA 2VFIA 2BGNE 2NSXA 2FLIA 4KW7A 1SPQA 4UB9A 5AY7A 4R5EA 3AS1A 3BUVA 1FOBA 3MVTA 2DP3A 1QATA 3SDOA 3S83A 1YTKA 3T8QA 4WEVX 4PRRA 3W2NA 4GUJA 1A5SA 3A4JA 4Q6JA 4CVWA 4LY8A 1QHOA 3DCPA 1GONA 1XYAA 1YXDA 3BG9A 1WCGA 2F6XA 2YB4A 3QF0A 4O1FA 3OLDA 3UNDA 4JFWA 5LIUX 2I5GA 1LG1A 5J5RA 3ZJKA 4O1EA 2FFIA 4H1ZA 4QG6A 3BGAA 3L0NA 1Y5XA 1V0LA 4FAMA 1MVYA 4JGDA 4M3PA 4CNUA 1WB0A 4YCOA 1UWIA 3ME3A 5GPRA 4Q4KA 3TA6A 3RN6A 4FALA 1WBJA 3S47A 1JAKA 1E4MM 3ZJ7A 3VDGA 2XM1A 3PNUA 3MKVA 3AO0A 2FIQA 4J9JA 4ADUA 2J62A 4H4IA 4O12A 3NL2A 3N11A 1QBBA 4TTUA 4CQCA 1ZAJA 2RGLA 3FA5A 1XRTA 3FAXA 3HG2A 2ZTKA 1E4IA 3WQ8A 3T05A 2O4QA 1S2CA 1BVZA 4UBPC 3NGJA 1AQHA 4JEJA 4H7VA 3LHUA 4A3UA 5A6BA 3BAWA 4DJEA 3BXWA 1KA9F 3VKCA 1WDWA 3DESA 1PKYA 3GU2A 1XUZA 3BLDA 3WNOA 3RGTA 1XYBA 3VK5A 4LUIA 2CBUA 1TRDA 2YL5A 4LH8A 1KM1A 1LT8A 3QY7A 4GH1A 2WMIB 1WQ5A 2OSYA 3CHEA 1CGTA 4DM1A 1NIUA 3NSMA 3EBVA 3UCCA 1AW1A 1EJTC 4NILA 2E6FA 1BTCA 3UFYA 4R34A 1DWJM 4OIFA 3QVQA 4Q8PA 4JZ5A 3EYPA 4X63A 4W8BA 1CPUA 3YPIA 3LGDA 1UWAA 3I4EA 3SN1A 3PTQA 3HTWA 4UMAA 1V3JA 4HYRA 3MTWA 2V0TA 2FTPA 1KQZA 5PTDA 3M0LA 1B4KA 2P0OA 1R3YA 5F4XA 1XGDA 3NVTA 1IHIA 2CHRA 2XISA 1E4LA 3B05A 4FNPA 3IRDA 2POTA 4GH3A 2QPXA 5A6KA 5I6SA 1BFNA 2EBNA 1FWNA 1ZBCA 3PB0A 1OK4A 4S1FA 3A23A 2YZ5A 1ONXA 2QH7A 1SFTA 4Q3MA 4JTAA 1ZAHA 3OLEA 4H6QA 4R27A 4WK9A 1HUVA 2I9UA 2EKCA 5TIMA 3LCHA 1UOZA 4IPLA 1SZEA 1J2BA 1ZENA 4CUCA 2BWGA 1XHGA 4W7VA 2WNQA 4OBTA 1WDPA 3U3HA 1JVNA 1GHSA 4GZJA 2EJ1A 1WOAA 5CZJA 3SY5A 1XD1A 1TYGA 3MQTA 2E77A 1EPXA 4G8TA 3VIMA 2PBGA 3Q94A 2VZOA 4C6JA 5KZDA 3NQMA 1PDYA 2WSPA 4QHRA 2ACUA 3KZPA 3C2YA 1X98A 4GABA 1S2AA 3T09A 1LL6A 5LKYA 1IV8A 1E73M 3C3UA 4JD4A 2VENA 1W17A 3TTQA 5HPCA 2VFDA 2VD8A 3S9YA 1NFPA 3VKBA 3VU2A 2EG7A 4QQUA 3UG8A 1JIBA 4B4HA 2JIWA 3N4AA 1G6CA 1R3RA 1WXYA 4DBDA 2PWGA 4EIVA 4NYYA 2YCLB 3LYEA 2DZBA 2ZQ0A 3KEHA 5CSRA 2W27A 1MEWA 2VRQA 4JTDA 4PBFA 3WF3A 5FIPA 3AMDA 1O66A 1HQTA 3AALA 1VFSA 1Q6FA 1OADA 3R79A 5CXPA 4C5ZA 5F2MA 1TG7A 3EA1A 3RNDA 3ICJA 1QI4A 1YNPA 2PS2A 3WYZA 4Q4OA 3CZJA 1QCWA 3HJZA 4HK6A 2O7QA 2TSYA 4LALA 4L65A 2QZRA 3DYMA 4Q8TA 1OQFA 1OC5A 1FX6A 3WQ6A 3PTMA 3STPA 5CCZA 1EWDA 1D7KA 3GHUA 4WSHA 2X8RA 2WLZA 3W2JA 2OOGA 4RR4A 3H4GA 1A5AA 2VFHA 2VGIA 4IGSA 1C3FA 1K7XA 3QW3A 1T96A 3HGJA 1SFJA 3GKFA 3PZOA 4AF0A 1MNZA 2C15A 1OCJA 4PTVA 3WLOA 1BLIA 1EKOA 2YW4A 2GQ3A 4QR6A 3IJ9A 2WVSA 3PJTA 4D6FA 4X2RA 5I03A 4ZO6A 5A6JA 4H8HA 3NSXA 3DXIA 1S5NA 1DJNA 3L4WA 1OK6A 3O6DA 3L4YA 2VEMA 1KGXA 2I9EA 4LNCA 2VQTA 5TF0A 1V6VA 3FFSA 4C1NA 1M6JA 1XIBA 3QHOA 1GVIA 3Q65A 4EE9A 1WP6A 1H49A 2VC7A 5LGXA 1CBGA 2BY2A 5A6AA 1PKMA 3Q37A 1RBAA 4X2PA 3DHUA 2HE5A 3PAJA 4S3BA 3FHQA 2UWFA 3F2BA 2A3LA 4CN6A 4DIAA 1JYNA 3N29A 4PUUA 4HU3A 1TKKA 4P8VA 2QGYA 3AI0A 1ZLPA 4LVBA 2Q3RA 3NDOA 2PGRA 2E5CA 3DH7A 1UD8A 9XIMA 5BZAA 1QAPA 2PGWA 1TV7A 3WD0A 4AYSA 2ZX6A 1BVNP 3N6JA 3P82A 2VC9A 4W8LA 3GDTA 4H9YA 4J3XA 3ELFA 3EWDA 4JX4A 4S3CA 3OBEA 2P5NA 1C8XA 4QCFA 4UR8A 4MPKA 3NFUA 3LHVA 3UVIA 2J6XA 2D2OA 3WELA 1XIMA 3WDRA 1DJQA 3S5YA 3WN6A 4AIUA 4NNAA 3LPPA 2WW5A 3SUUA 2E40A 3QMSA 1W3IA 1FWGC 1I2QA 5LSMA 4WR3A 1KTBA 2Y2WA 4FMVA 2DT2A 3B40A 4GACA 4YHGA 4M0XA 5DY3A 1IGSA 2D22A 1UWRA 2QLYA 2CYGA 4RNIA 2NWRA 4AFYA 4GJJA 2Y61A 3FK4A 4E4UA 4YVPA 3T9PA 3BLOA 2G3NA 1G4TA 1BWKA 1QW9A 5H8UA 3SI9A 5AYIA 3VM7A 4JQ3A 3STGA 4QRNA 3WH7A 1DWHM 1X96A 3KDNA 4Z1DA 1Z89A 2XIJA 2A85A 4M1BA 1EEPA 1DJWA 9RUBA 4X3ZA 6A3HA 1AZ1A 2X41A 5FSEC 1BYCA 1Z42A 5FOOA 2C16A 1R3QA 3WEMA 1AMYA 4X9YA 3S1UA 2PLKA 4XVEA 3MUAA 2YFNA 4J28A 2XTKA 4M7SA 4TQTA 3TSDA 1E40A 4DUXA 2I16A 3UR7A 1Q6OA 4CCZA 2WVUA 3PJWA 4HSNA 1A4LA 4K68A 3PTDA 1GW9A 1WV2A 2LLEA 4IQJA 4YXGA 5EMMA 1H60A 2J8FA 5U7SA 2DVXA 1IR2A 1B90A 2PDXA 3N15A 1XG4A 2CERA 3PPGA 2CITA 3OP2A 2W63A 3T42A 2EPMX 2AL2A 3TONA 2QGHA 3COTA 1XFCA 3R94A 3MO4A 3NQ8A 4TVDA 4MKNA 3N9SA 1Q6GA 4H9TA 1PZ3A 4N9EA 3I3EA 2ZZ3A 2DZPA 3S0CA 2DT3A 4PN2A 3B8TA 3NQVA 2FYMA 3CHDA 1XLKA 2JE8A 1DL3A 3RR4A 4ACYA 4EF8A 3BV4A 3DKLA 4IQDA 1XBVA 1A5UA 1IT0A 1GQNA 1A0EA 3GH5A 1CGYA 4UOJA 3VIJA 4WIWA 1XDLA 2WMHA 1H7OA 4MB5A 4OVXA 1K9FA 5BWFA 1EQPA 1KLYA 1FY6A 1FXQA 2ZXDA 1M7XA 1KWKA 4MNKA 4D8ZA 5C71A 5JU6A 1JEZA 5KITA 4MYXA 4WJXA 2HISA 2PLCA 1Q6DA 2DEPA 1M1BA 2TPSA 4PL1A 2FMOA 3BCFA 2OUTA 2YCEA 5LNRA 1EOKA 5FJUA 3UGVA 4EX4A 3U7VA 1JI2A 1MI3A 2HK1A 4I5XA 4F48A 2RDXA 4LUTB 2IW0A 4HNTA 1IEQA 1AVAA 3GX9A 5K3VA 1NDZA 2OYLA 4RDWA 4IMEA 2D3LA 2E9BA 3LOTA 1GZ1A 4HHLA 4QDPA 3PVFA 1QT1A 1Q13A 4D9PA 2X49A 3EOSA 3ECQA 4YVVA 4PRTA 3STFA 3T2QA 3QH2A 1YX1A 1R30A 2F38A 4XAFA 3VCCA 1UW9A 2IQTA 3HMJG 1KWGA 3W00A 3NGFA 3MHFA 1BPLB 1O1ZA 4ICNA 4DWSB 4Y6GA 1JL8A 4JYDA 2BBFA 1Q6QA 5G2HA 3C0LA 6CGTA 4B90A 3F4WA 3VDHA 1XQKA 1BG4A 1K7EA 4WF7A 2G97A 1F2JA 1KR1A 3TBOA 3V5FA 3OPSA 3BOFA 3M6DA 1HKJA 3WDHA 4ACZA 4NZCA 5DEZA 3S6DA 4J3WA 2JEQA 1US2A 4C7GA 2CU0A 1LL4A 2FH6A 1QOQA 1B57A 3A12A 1A49A 4EVZA 4B9ZA 4LAKA 1GTHA 3IGSA 4AZCB 4O14A 3KS6A 3V36A 1HTIA 1AFSA 4BJHA 1RVGA 2GJPA 4US6A 1RCOB 3FCPA 1C29A 2FZNA 3O07A 2PDNA 1XLCA 1W9PA 3T55A 3B06A 2Q6ZA 1F3EA 1HGWA 1W1B1 4NRSA 1NDYA 4ZXLA 3UJSA 4F0LA 2GSHA 3UJRA 3EDFA 2INEA 3TC7A 4AMAA 2X1IA 3O7UA 3WQ4A 2PWEA 3B9NA 4TIMA 2DZVA 1A5NC 4GFIA 4HQVA 1N2VA 2BY1A 1XLJA 2G0WA 1EZ2A 3GDBA 4HOWA 3GTFA 2GOUA 2J75A 1XFBA 1W54A 1S5MA 3LD5A 3ZR6A 3ZSTA 1B3XA 2E1WA 4E38A 3SADA 1M01A 4WJ8A 3KTCA 5XIAA 1TA3B 1CDGA 3LTSA 3W83A 1N82A 4K3ZA 3SCUA 1NOWA 1I1WA 4M24A 4F0KA 3ITOA 4IP4A 3SCNA 3NQAA 1LRTA 3L4TA 4PMVA 3CWHA 4JEQA 4UQEA 3MMTA 2QUNA 4NXSA 3GQYA 1A50A 1UPPA 3K4WA 4KGLA 2ZUTA 2ZUMA 1C7SA 2OX1A 2R1NA 8A3HA 2EJAA 5CSUA 4LC8A 4F9DA 4MWAC 7ODCA 4MF4A 4CN4A 2R24A 4YL2A 1OBAA 4AIOA 2Z1BA 4H8NA 1TREA 5CGMA 3SN4A 3W7KA 2NVAA 1XYMA 4FIQA 1DWAM 3UQNA 3H7RA 2ZC8A 2WWCA 4GIAA 4F2UA 1W5MA 5TQLA 3W7JA 3RDKA 3QZ6A 4C7FA 3MSDA 4B16A 5B7YA 1AH4A 4Q8QA 1JDEA 4GO9A 1ECQA 4WY0B 1W2PA 3VE9A 3VKDA 4ZQPA 1HJUA 3G1DA 3PZ9A 2XJ7A 4N0RA 1V79A 5M17A 3B8IA 3W7OA 4AISA 3OGRA 3LI1A 4UFKA 2C8NA 2GFTA 5DMYA 3WLSA 3CV7A 3BLLA 3GM8A 3L2IA 2DJXA 4IOTA 1O4UA 3QN3A 1QHPA 2O9RA 2R1LA 3RHGA 4S38A 1RJPA 1VYRA 1WKYA 3REQA 4GBUA 4MLRA 4OTKA 4FNRA 1WBHA 2NWSA 1S46A 5C9XA 3S9ZA 4JTUA 4HKPA 1YYAA 4WUIA 2DPEA 1KGWA 4B92A 2PTZA 1PIIA 2X7WA 2PU0A 3FNDA 2AOSA 1CQUA 2NXGA 1P0NA 3PBMA 3HZ3A 1E5NA 1RQEA 4DI9A 3W73A 3MI3A 1G7VA 1K9DA 3VZYA 4OUEA 3WLRA 4D6JA 3GC4A 4HPGA 4RV8A 5C70A 2Z2BA 3HF3A 2ZX7A 2V5BA 1R9ZA 4AY8A 1ZQ5A 4OFCA 3BJSA 3L2LA 2R82A 1PIFA 3HQ1A 4I7UA 3P74A 1UUOA 4LU0A 3SGUA 4MAVA 1UH2A 4G7EA 3GFYA 4M81A 2CESA 4UMCA 4IL2A 3A6OA 1NTHA 3PZIA 2Q8ZA 4IPNB 1W3HA 4WGHA 3WK2A 3AMKA 2XDFA 3IJ6A 5LIYX 4W87A 4AX6A 1J12A 1W5QA 4O0QA 3W6LA 2ACRA 5FJTA 1GVEA 3W01A 2Z0IA 3UCQA 1K70A 4HD5A 4L80A 3ATZA 1CXLA 2OTDA 5D2VA 4KEVA 4P7OA 1XG3A 2WKGA 3CV6A 1K6WA 1POKA 4C6KA 1QWGA 4NJIA 3D3AA 3CZGA 1WZKA 3UZ5A 1S1RA 2C71A 3W1QA 3GXPA 4I7WA 2DZTA 4OE7A 1I45A 1JPHA 4US5D 4WXZA 1BXNA 4IP7A 1FWIC 1Q4WA 4AEFA 1VJSA 1R2SA 1BGGA 4Y8EA 1W3TA 3WQPA 3E9AA 2ZVRA 3IJ8A 4ZOCA 3T08A 2Z4GA 3W7LA 3NDYA 3G24A 2EG6A 4REQB 1R46A 3NQ7A 1H2JA 3MPGA 3UZWA 3IVTA 1XCWA 4QAWA 3TR2A 3KRBA 4LUTA 7REQA 1I2NA 3QHMA 4FX7A 3PUDA 2HDJA 6REQB 1FH7A 4FLOA 1K8XA 1W1TA 1ELSA 7PTDA 5FJJA 3E38A 2PDFA 3BV7A 1QPOA 4DJFC 1WZLA 3VDCA 2PSNA 3E6EA 2PRLA 1SJDA 1VFMA 1U83A 1FQ0A 3TTOA 5G1TA 4C6BA 2H8XA 3MBFA 1JDDA 1TVPA 2VZVA 1NFBA 3ANYA 1CLXA 1OSEA 3LI0A 5IBXA 3VUPA 2GGJA 4R3UA 4LBRA 2G8ZA 4M7TA 3TV8A 1BXBA 1TPFA 2VUYA 4URIA 2GJXB 4CCEA 3VA8A 2OKOA 3AMGA 2E9XD 3EOLA 2A5HA 2NUWA 3SJ3A 1TZZA 2QR6A 1HO4A 4MWAA 4WZHA 3ZR5A 5FF0A 3D5HA 1XQLA 3BQ5A 4V27A 4A3RA 2DSZA 1UR4A 3GG8A 4P7RA 1A3HA 1O6IA 2ICSA 4HZ6A 3S6TA 3DBNA 4DF0A 1UKPA 1W1ZA 4NNBA 1RK5A 2BVWA 3P2VA 4O8AA 3RR1A 4C6IA 1NQKA 1JRCA 3FGCB 1J5SA 5I78A 5LA1A 1KCLA 4MYAA 1DIOA 1YTEA 4E4PA 2HBBA 2GQAA 2X1TA 3T0DA 4E2OA 3I68A 3LG3A 4AC1X 3DERA 3M0ZA 2VGBA 4A3QA 1CXEA 2HBXA 2HPIA 4FP1A 5L6UA 3GZ3A 1E6RA 3NOYA 2ABAA 3BK0A 1TA3A 1M9HA 3GVQA 4FR0A 1M04A 2PB1A 2Q3OA 5BRQA 4RX0A 3SCWA 4A2RA 1V3MA 4DELA 4HNVA 3FJLA 3FV9A 3QKZA 3LPGA 2OPJA 3VZZA 1DXFA 3WD3A 1UD5A 1BYAA 2J9YA 3PG9A 5CGQA 3THDA 5A8MA 4UZSA 4UFJA 5E5CA 1YNQA 4H3DA 4UQCA 4MKVA 5FL1A 3MV11 1YXYA 3C2VA 3AHYA 3NZQA 3EWXA 3SGZA 3QGAC 4FLRA 4BQ4A 1X38A 3NYDA 1REQA 5CLWA 4M6VA 3BDKA 4HGXA 4MAZA 4TMCA 1EGMA 2ZCGA 3NPUA 4NASA 2ZTJA 2EO7A 3T2PA 4G56A 4PMDA 4LGXA 4L4OA 3HQOA 2EQDA 1I2PA 3TW7A 3NZGA 3L5AA 1G7UA 1ZUAX 2BSLA 3QGKC 1JGMA 2V82A 4XSMA 5HDRA 2CHOA 1JCTA 3A9BA 3EMZA 3N9RA 2OCZA 1A4MA 3WH6A 1TZ7A 4N02A 4O57A 3UG3A 3W2MA 1YDNA 4PGLA 5EG5A 2XHYA 1GHRA 3VO0A 3D0CA 4JIEA 9XIAA 3SCVA 1RR2A 1TPUA 1FCQA 2O92A 3BCJA 5D9NA 3NZPA 4IIDA 3MCOA 3GNDA 4IIBA 2FTWA 1W9UA 2FGLA 3B97A 1NFGA 4MDOA 1P6BA 3O0FA 1HW6A 3KOZA 3KOXA 4MZYA 1HXJA 1TJRA 5CPNA 5HQMA 2I5IA 1BAGA 4LCRA 2PDIA 3JRKA 2ZUVA 1VZWA 1U5JA 3KZSA 5CJMA 3VMOA 1D3HA 4QROA 1PTAA 2JBMA 2D23A 4Q8MA 1QHZA 3FAWA 3GWQA 4HB7A 3FVMA 1XDJA 1TV4A 3CHFA 5GJPA 3IIVA 1ZJBA 2XVNA 3ONBA 3MZ2A 3HG4A 2B7QA 4O4VA 4TUFA 4IIEA 3G1XA 3PP7A 4S2CA 2WC7A 5EMLA 1LBFA 3LQLA 2VJXA 4J5NA 2ZXAA 2VI0A 1EH9A 1CGUA 3JS3A 1RQHA 2CETA 3VOIA 4DJFA 3WUBA 2DGAA 2PDGA 4HN8A 4BI6A 1C90A 2NT0A 3PPFA 3PZUA 1E6SM 1BXCA 4HU0A 2VTFA 3EPOA 4FA3A 5EKYA 4NI3A 1H0GA 3Q45A 2J9ZA 1KM5A 3H8AA 2HQAA 3W38A 3ZJ6A 1G01A 2YSWA 3R0KA 3NTYA 4JCLA 2VURA 4L9XA 1PL9A 1YDYA 1W8SA 1KFLA 1MWOA 2MNRA 3P60A 4NQ1A 1B3VA 3SAZA 2J78A 3CAQA 3LRKA 3ZOAA 2WVVA 4WKHA 2PEVA 3CEUA 3ZXWA 2VRKA 1F5ZA 1E5JA 5H2ZA 4CN1A 4ZENA 1V02A 5CBJA 4M29A 4YJ5A 3VGBA 3GHRA 5D2XA 2C18A 4LB3A 2C79A 3MP5A 3OO2A 3EDEA 3UWEA 1LOLA 4A4AA 4NXKA 4A21A 4IG2A 4WHBA 1CXIA 3CUJA 4PA8A 1GCYA 3FIGA 3QYQA 1YPFA 4Y90A 4AY1A 4PMOA 2FGBA 3AIWA 3JZEA 2JGQA 3WK1A 5D05A 3GXFA 3CNYA 2I17A 2H9AB 4NF7A 3S6OA 3LHTA 2W66A 4UNKA 2FHBA 4KKXA 2EHOC 3R10A 5K2ZA 2W79A 1YPXA 2WLYA 2GSJA 4GQQA 3G0XA 4QG9A 4WJEA 4A22A 1TUXA 4P7NA 4LCSA 2VEPA 2BDQA 4I9TA 1UUMA 1QU4A 2NQ9A 5DY2A 4Q32A 5HNTA 5GHSC 3G0SA 5E09A 4Q8VA 1QOXA 5F1UA 6TAAA 4LW7A 1UP3A 3R11A 4QTGA 3GUGA 2GUBA 3LMYA 1OG6A 4K7YA 2DZUA 3G1SA 3W29A 1R9YA 3IRSA 1ZTVA 1C8VA 4HNCA 2NV9A 3THUA 2WHJA 3DYPA 1IIGA 2XGBA 4ERGA 5D9PA 3TNOA 3W86A 1XBYA 5BW6A 3M47A 3CGTA 4S39A 1MXGA 1E3ZA 3P14A 4BHYA 1UIPA 5DMNA 2CBVA 1P0BA 4H8VA 2G5WA 4YTRA 1L6GA 1MEHA 1MQQA 4ZODA 1O5XA 5AB3A 3VE7A 3N2XA 2WV8A 4PUDA 3PTKA 3SRKA 2W61A 4IPIA 4LQ1A 4U31A 5BRPA 3PZQA 1RZMA 7CGTA 1PBGA 3RYSA 3EOUA 1VFLA 2JIEA 4O11A 4L4LA 1KRMA 1EDQA 4I5RA 3EKZA 4OV4A 2PD9A 1DQUA 1XSKA 4LVDA 5DCDA 2V3FA 4Q6XA 2E7FA 3BAKA 3OGVA 6TIMA 1EIXA 3O06A 3R89A 1OC6A 4ZQNA 4GZIA 1WDQA 2BG5A 2E0PA 5D9MA 1P5BA 3PZNA 1E71M 5BXRA 2YBVA 4NIRA 2V67A 3XINA 2VO5A 3R7MA 4Q7BA 4Q8UA 4PC8A 6PTDA 4AHQA 1THFD 1V0KA 2G3IA 3QLDA 1FWHC 2ZUSA 1G4PA 5CAKA 2JKEA 2POZA 3AUOA 1GG1A 4M51A 4MY9A 2DORA 4D1IA 1VIZA 4H7CA 3F5KA 4QBXA 4J3TA 3L5LA 3WLKX 1E0TA 3UXIA 2XH4A 1HKIA 2Z2AA 2R9RA 1J0HA 3ISIX 5EYWA 3TN4A 2QVNA 3IWPA 3QPEA 1XCXA 3WDIA 3T6CA 3KOYA 3C0SA 1H7XA 4IIGA 4IM4A 4G7FA 4C1LA 1EYWA 2BASA 1P1MA 4EPBC 2FDSA 2NX1A 4AVOA 3C56A 2OQLA 3W27A 3LU2A 2F9RA 4WQ6A 1W5OA 1Y65A 4LUSB 1LT7A 1IQ8A 3KX6A 2Y8UA 3ZT7A 1V0MA 2RDTA 4ENLA 3BSHA 3R8HA 3DDMA 4Q4SA 1PCKA 2VQUA 3ZZ1A 2ZZ4A 1UD3A 2JK2A 3GFZA 3VGGA 2CKRA 4J40A 1L6SA 2PPGA 1EX1A 2XFFA 3ENLA 1H7PA 1KV5A 4KWSA 3H6OA 1WO2A 3LPQA 1QW8A 1O7AA 1LBMA 2E8YA 3SCPA 1PTGA 3IV8A 4CD8A 1KCXA 1EDGA 1IWPA 3C3NA 1T5AA 3W2LA 1UOKA 3PSWA 1UWSA 1V3LA 3NM3A 5CC6A 1JJKA 4GO8A 3TTEA 3NDZA 5CPSA 2A7NA 3NPVA 5CPQA 3MMWA 3F2DA 1JPMA 1TWZA 3N04A 3VD3A 2WQPA 3H2NA 2OWWA 3RO8A 3RU6A 3W71A 3M0KA 4FS9A 1G94A 4M6QA 3CUZA 2VCCA 2LSMA 4CQDA 3THCA 3UESA 3BLEA 1MFUA 3KP0A 1VB9A 5J8LA 3C86A 3TLLA 7XIMA 2GQ9A 1NY1A 4MNJA 3UJEA 5FKYA 4HPXA 4BF5A 3IV3A 6XIAA 1E1CA 1QASA 2GGIA 2BP1A 1RAKA 1HFBA 4LVFA 3SURA 2XWDA 2BFGA 3ES8A 3NO3A 5HINA 2I57A 3MHGA 4Q22A 3LK6A 4KQNA 4XKYB 3K30A 3LSCA 4CNPA 1WKDA 3PJXA 4E3VA 1KFJA 5FACA 3AQUA 5GQBA 1YMYA 3W1AA 5MKGA 4IUGA 5F1VA 1CXKA 3T0BA 2Y8VA 1H7WA 3TXZA 3QOKA 5F2IA 4PE8A 3BLPX 3CEPA 4C1KA 4JNZA 4PUJA 4ONVA 1J18A 4ORIA 3AIUA 1FWDC 3ZVHB 3R12A 4WDXA 2DVUA 4IMFA 2RHGA 3AU6A 3EMCA 4BF7A 1UKOA 4HT3A 3LM3A 4PMQA 1CIUA 4XUGA 1FCBA 1OX4A 1QPKA 2EG8A 3AC0A 1TJPA 4U5IA 4DBEA 3NZ1A 2DU2A 1A80A 2QCEA 4JTIA 1TUFA 2RKXA 2PC4A 1WUEA 5AYYA 2IPWA 4XG1A 4Z2GA 4XD4A 5LIWX 3EPNA 1M53A 3RPTA 1DOSA 1SMDA 4MPQA 4GINA 1O68A 1J0KA 2B31A 2YYUA 3HJEA 2PP0A 4DF1A 1FCVA 1ML1A 1QNSA 2C7FA 3WLHA 1TJ1A 7TIMA 4XVDA 3TC6A 3LX9A 2HBVA 1JQVA 4EF9A 1ZAIA 5DMLA 3MSRA 4UC5A 1BSIA 4AZ7A 1YDVA 1QXLA 4HZMA 3VNIA 2VGFA 5TAOA 1DJGA 2I14A 1ADDA 3TZFA 2Z27A 3GTHA 3WNPA 2QQ6A 4PMJA 1XBXA 3CH0A 3N17A 3VOHA 2W91A 3ONCA 1OX5A 3GU9A 1UASA 2ATSA 2JQXA 4QIUA 3W07A 1R86A 4H41A 4D6HA 2P3EA 4MJMA 5FEZA 5HWJA 3QTPA 5D8WA 3URAA 2JGYA 1U22A 4B5SA 4H01A 1EC9A 4L64A 2AKZA 2Z25A 1IT7A 2CBIA 3R58A 1XH2A 3WCZA 1Q6LA 5A8OA 2QVHA 3P93A 4P8UA 3UXAA 3NQFA 1ADSA 3WQDA 4UTTC 3LA4A 3CAKA 1J11A 3CB8A 3H4XA 4GPNA 4GY7A 1PWMA 2R8WA 4IQEA 1SVDA 3CLWA 1V7AA 2W3ZA 2WZHA 2X2GA 3W7EA 2QIIA 1X97A 5HMFA 1BF6A 3PG8A 1MSSA 4DZIA 1BQCA 2A3BA 1KFCA 4KMQA 2FJUB 3A5VA 3TVAA 4I6KA 3VIPA 1EBHA 3I7RA 3HG3A 3ZFHA 4JTKA 1JDFA 3ANUA 2C3ZA 3NQ2A 3TYCA 5EFFA 4HA1A 3CQKA 4NZ3A 2PI6A 2INFA 4EAMA 3B8DA 2YW3A 4MADA 1MUCA 4O54A 2DSWA 5I0DA 1ZHAA 4XD3A 5C9WA 2DW7A 3P67A 1CYGA 4MNLA 4DNMA 2QDGA 1F61A 1UJQA 3VPLA 2VYOA 1PX4A 5EBAA 5CLTA 4FXFA 2Q09A 4AEEA 1SFSA 1XICA 4DXKA 3FX4A 2XFWA 1V5XA 2V2DA 3W02A 4A8NA 1G67A 1QNOA 2PDHA 4R7JA 2YLLA 4WDTA 5DMMA 4V1XA 3URNA 2KAUC 1GG0A 4NAEB 3ZR4A 1GEQA 4MVAA 9CGTA 1XSIA 1L8PA 1KNWA 1EZWA 2DVTA 3QOMA 1PHQA 4D8AA 1TR1A 3WUFA 1EHAA 3B03A 3ZT5A 2ZDSA 3GW3A 1Z9AA 3W6MA 1H61A 1X6UA 3PUGA 1J0ZA 1AZ2A 3CHCA 3LQGA 5CQ1A 2DFAA 2W6RA 3T8LA 5M03A 1ONWA 3S42A 2Z00A 2D1ZA 4GNVA 4RPQA 4CKQA 4DLFA 3FYPA 3SY8A 3P5ZA 4MTVA 2GVEA 2Z6IA 4PODA 2XVLA 4QISA 3UD6A 1PIGA 4JQ4A 4E4FA 3M43A 5EL1A 2VEIA 1V6YA 4U2ZA 2HVMA 3S2JA 3L0KA 4ML9A 3QQ1A 3H2FA 4BI7A 3PF3A 4JTRA 2UV8G 3OG3A 1E9LA 4P5UA 1TPB1 3B9AA 3S5OA 3N12A 3IANA 4P2VA 3SCSA 2DSVA 4DYKA 5LNWA 4MB4A 3GXNA 2QYGA 1T0OA 1UZDA 3GDLA 1AQFA 5G2WA 4L6HA 3QMTA 3IAQA 4MY8A 1H50A 4MHBA 4GUIA 2X0HA 1WZAA 5I06A 3L4ZA 3HOJA 1IR1A 1EJRC 2UBPC 4ZQCA 2V3DA 3WD2A 4NI8A 1BWLA 2BXYA 3RCMA 2PDKA 1Z48A 2X2YA 4M19A 3TW6A 1U1JA 1DJHA 3MDUA 1OF8A 1C93A 4X0NA 4O13A 1KRAC 2YCIX 4IHCA 4O1BA 4TVUA 4XBKA 1AL7A 1S2TA 1DXEA 4LANA 5D37A 1AJ0A 1KBIA 2WMFA 1WYIA 3T0CA 3V4BA 3AICA 3VDAA 3R0DA 5EMUA 1CGWA 1HIZA 2QMKA 3PBGA 5HOSA 4I6VA 3NWRA 5I24A 2QPSA 2E5BA 3B8WA 4MIMA 4J1OA 3RX4A 2PCQA 4XZNX 3GR7A 3BW2A 2CLIA 1UUQA 3VIGA 2VEGA 3GW0A 3STCA 2WMKA 3LZ3A 3GB6A 4DAFA 5H91A 1JQXA 3N6HA 2C0AA 3M41A 3GUWA 1OT1A 4TV6A 2XH2A 4AU0A 4AD4A 1XYLA 2D73A 3OEXA 3DECA 3VD5A 1UZ1A 3SFKA 1VCFA 4JN8A 3JW7A 5AHEA 5D2YA 3V18A 2QNEA 4CEUC 1P0DA 4A3HA 3GTIA 2XVKA 2AQWA 1PX8A 4M56A 3W6YA 3U2EA 1FDYA 3I10A 2W67A 4UTTA 1FWRA 3N34A 5FEXA 3T0TA 4AHPA 4ZO7A 1I4NA 4HN4A 3MU7A 1CT5A 3ITGA 3G1YA 3NVDA 3FJ4A 3EX6A 3CMGA 4ZE4A 1K03A 4PCNA 3WK0A 2GSEA 1OINA 4KFOA 4N6EA 3VKJA 3W28A 4XAPA 2NX3A 3FKRA 3IEBA 3M0IA 2GDUA 3VOCA 1ZALA 2PBOA 1GOIA 2VT0A 4F4RA 4INFA 2OR2A 1OJXA 2P8BA 4IGMA 2WHKA 3VC5A 4FLSA 4GLEA 3LLXA 4A35A 4I5UA 3LN3A 5HUOA 2PUZA 2J74A 3H24A 1UC5A 1J2WA 1EF2A 2QDDA 4MFEA 3W22A 3FW6A 1J01A 4O4WA 5EGRA 3OZMA 5C6MA 5DANA 2RGMA 3FSTA 3AOFA 4MB3A 4LAOA 1W31A 2Z26A 3GO2A 1T99A 1IXNA 1GVRA 3DHDA 3DGRA 1EO7A 4K38A 3AHVA 3AUJA 3CZ8A 5DQPA 3ZT6A 2OODA 3VX1A 5D2TA 5REQB 3VNDA 5DXYA 2HNEA 4DBUA 1SZFA 4MKSA 2QV4A 2Y5SA 2W9MA 2O9TA 3W1UA 4FF7A 1W0MA 1KBKA 2GK1B 1GYNA 3GS6A 3C52A 1CW2A 1VLWA 4WRHA 3K5XA 2IQ0A 3MBDA 3UY7A