3FNDA

Crystal structure of a chitinase from bacteroides thetaiotaomicron
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
SLKVVIGYLALDDWEFESLFPTIEWKYLTHINASFARVKADGTLNINPVRKRIESVRETAHKHNVKILISLAKNSPGEFTTAINDPKARKELIQQIIAFTKEYKLDGFDIDYEEYDNWDKNFPSLLVFARGLYLAKEKNMLMTCAVNSRWLNYGTEWEQYFDYINLMSYDRGAFTDKPVQHASYDDFVKDLKYWNEQCRASKSKIVGGLPFYGYSWEESLQGAVDDVRGIRYSGILKHLGNEAADKDNIGKTYYNGRPTIANKCKFIKENDYAGVMIWQLFQDAHNDNYDLKLINVVGREMMEEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase
publication title Crystal structure of a chitinase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2008-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fndA01
3.40.5.30 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 (Trans)glycosidases - domain 2 3fndA02
4E8CA 3MU7A 2GJRA 4UQDA 3ARVA 5BYWA 3CZLA 3W26A 1HIZA 3G6LA 1O6IA 1UYQA 4JFTA 3QHNA 2WB5A 4ZE5A 1UKSA 5E0FA 1UQZA 3QR3A 3DHPA 3A4XA 4FMVA 3MMDA 1ZU8A 2ZXQA 3OLIA 3WBEA 2D3NA 3GYCA 5A6SA 1V0MA 4HU0A 5KZ6A 3M7SA 2WHMA 1E70M 1MWOA 2CBUA 2CHNA 3THCA 4IPLA 3CBWA 1IT0A 2Y8KA 1C93A 2J7HA 4W88A 1UQYA 2FDMA 4W87A 3LPFA 3DYMA 1RH9A 3KWXA 2PWFA 3W37A 2DSWA 2ZUNA 3ARXA 1E6QM 3MV01 4NZCA 1JAKA 2CERA 2W62A 2NW0A 1WDQA 5ECUA 3VD4A 3VM7A 2Z1SA 4JFVA 3WEMA 4GO9A 5E0CA 1WZAA 2WXDM 1GQIA 4UFLA 5GNYA 3AHZA 5D9MA 5BXSA 5A6JA 3EDFA 5A8MA 4A4AA 5CSUA 1E5NA 3L4VA 1BTCA 3AICA 1JYVA 3AROA 2WVTA 1KFWA 3N11A 7TAAA 4KGJA 1NOWA 2EPMX 1U30A 3FY1A 2A3HA 2CHOA 3SIMA 2ZX6A 1UKPA 5BXRA 4ATDA 5ABFA 3VMPA 1NOFA 3HJEA 2J47A 2O9RA 3TTYA 2QV4A 2V38A 2V3FA 1MYRA 4F9JA 1AVAA 1PEZA 1R87A 1ECEA 3VGFA 3WSUA 3PTKA 1UD3A 5CPTA 2WVUA 4NRRA 1QHZA 2BY2A 4CD8A 3K46A 1HL9A 3W53A 3L4WA 5E70A 5CGMA 4RE2A 3GH4A 3ZJ8A 1HJQA 2YA1A 2A3BA 3ZJ6A 1E6ZA 2E9MA 1B0IA 2GJXB 1V3JA 3ZR5A 2D1ZA 4AEEA 3OG2A 2YOCA 3WD0A 3VIOA 1WPCA 4IM4A 2MANA 3BMVA 3WDRA 1UD8A 3LPPA 3FNDA 2YL8A 1C7TA 1CGXA 3A4WA 3W6LA 4CCEA 5JBEA 1E6NA 1W3HA 1NWTA 1UA3A 3BAWA 4W5UA 4QLJA 4KWUA 4K68A 1SFSA 3AIVA 2W61A 5D8WA 3N9KA 1MXDA 4RE4A 4LGXA 3WF1A 4Z2LA 4UZUA 3HMCA 3ARPA 1W3KA 3S2CA 2JF7A 2XVLA 3WF0A 1QI3A 2ZUMA 3KZSA 1VEPA 2ZUWA 2XIBA 4PMQA 1HT6A 4U5KA 4LYQA 1GJUA 3PTMA 1TVNA 4URIA 1VEMA 4J28A 4CGTA 1KQYA 4MB1A 4PMNA 8A3HA 1WE5A 4MDPA 3N18A 4HMDA 2HISA 2O92A 3WQ6A 4AW7A 3U7VA 2CNCA 1UKTA 1C8XA 1H09A 3PZOA 4AZCA 4Z2GA 4B3LA 4QP0A 4U3CA 1H5VA 1E4MM 1Q4NX 4WSKA 2EJ1A 5AC4A 1KBKA 1R7AA 2VOTA 1J18A 1R8LA 2OWWA 3OLGA 1FFRA 2QLYA 2ESCA 2EPOA 1VRXA 1NH6A 3A4AA 2QF8A 2ZUTA 3GH5A 1AMYA 4AD0A 5A6AA 1ISZA 5A6LA 2WC4A 5A2CA 1JZ3A 3OBAA 3WD2A 2UY3A 3K8LA 2PF0A 2JF6A 1O7AA 2BY0A 4PMZA 2WSPA 4J7RA 2X2YA 3OIHA 4J27A 1E43A 1JZ7A 5BXPA 2DPEA 1GQLA 4JCMA 4JL1A 2BY1A 4BZYA 4CD7A 3W82A 5FL1A 1LG1A 2VJXA 2FH8A 2VQTA 4MAZA 4QCEA 3WF4A 2WZIA 2FH6A 1NM9A 3UR7A 1EGZA 5E6ZA 3VGBA 1BSIA 3VD7A 1B30A 2G3JA 1JZ5A 4NSBA 4TX6A 3SCOA 2ZX9A 1PZ2A 1J0HA 1MXGA 1TZ7A 3BAXA 1C92A 3AHYA 5HOSA 4UOQA 1VBRA 1E55A 4GPNA 4DWSA 2GSJA 1LLOA 2BV9A 1VFUA 3AS3A 3NUKA 4FK9A 3RM9A 4HOZA 2XYLA 4MNJA 2ZE0A 1BFNA 4LYPA 1MVYA 4M80A 4W5ZA 1XC6A 3W28A 3B9EA 2XVNA 2XGIA 1E71M 1IV8A 4TOQA 2WMIA 1G0CA 5DT5A 4EKJA 2HVMA 3WQVA 4JKLA 3VNZA 4A3YA 4J3XA 4F9DA 3NJ3A 1UHVA 5EBAA 4UQAA 5A2BA 1UWSA 3CUHA 1K9DA 3CUIA 3IJ7A 1AQ0A 4AZGA 4TVUA 3KL5A 5A69A 3MO4A 1QHOA 3KL3A 4GI8A 3SCSA 2Y2WA 1EQPA 4NRSA 4L4OA 1YQ2A 1XGZA 2J77A 1JD9A 3F5KA 5CZKA 1E6XM 1JI1A 1ITCA 3FAWA 3D5HA 1J12A 3GXFA 1GVIA 3W81A 3WQ5A 4LQ1A 5DEZA 4D6FA 3PZ9A 4J3WA 4HPHA 5M17A 4ZXLA 4OOZA 4CD6A 1JF5A 2G41A 1VAHA 1BAGA 1TUXA 2WMHA 2YA2A 3RILA 2J7BA 2VL4A 4QCFA 4F79A 3WNNA 3F5JA 2JIWA 2VX5A 1CXIA 2BXYA 3WDIA 1TR1A 3M6DA 2DIEA 2D0HA 4V2XA 1FH7A 3AYSA 3VIFA 3WENA 4M82A 5IFTA 1CXFA 1H41A 3EDDA 1ISWA 1JGIA 2FGZA 2VVNA 3EMQA 5I0DA 4KMQA 1UD6A 1B9ZA 2CBJA 2OLHA 1EOMA 3D3AA 1QW8A 1JZ6A 1E0XA 4LX4A 2VCBA 1PAMA 1B3VA 1CXHA 3OGRA 4PMYA 2EEXA 1UD4A 1JYWA 1W9VA 1GPFA 3T0BA 1XYFA 3WELA 4PUEA 1UWTA 5BROA 4HA3A 3SUVA 3MV11 4E4PA 1J0KA 4P7QA 5C70A 3WMSA 4AIUA 4FLQA 3ALFA 4DM1A 4PMXA 1C8QA 3WUGA 4DUWA 2BVTA 1UOKA 3PZQA 4D1JA 3A3HA 1EA9C 3L4YA 4X9YA 2WVVA 4LYRA 2X09A 4W85A 1Y7VA 2WBGA 4W8AA 1HVQA 1KXHA 5BRPA 4CN1A 3BAIA 1JXKA 4UQBA 1NWSA 4BCEA 1JFXA 2VX7A 3EMCA 2PI6A 1LWHA 3TP4A 1DWIM 4Q7NA 3VIPA 1J0ZA 1BYCA 1BGGA 4XV0A 5CLWA 1E0VA 1WZMA 4ZFMA 3AMLA 2G3IA 1OD0A 1OSEA 1MW3A 3GBDA 1WO2A 2W63A 1BVNP 5CPSA 4M8UA 3SCVA 2AAAA 2GJXA 4WKFA 2J7GA 1MQQA 4Y7EA 3DC0A 1NWRA 1JXJA 5I3DA 2RGMA 1HL8A 2XFFA 1PIGA 5FOOA 3OZPA 2XSBA 1UR4A 1V6WA 5D9OA 3WH9A 2CKSA 4D6GA 1FA2A 4TVCA 2PWEA 3U7BA 4OUEA 4CN4A 2G3NA 3L2LA 2VZOA 4U2YA 1UZ4A 5HPCA 2WMKA 1CNVA 2XHYA 4GIAA 5BWFA 1EXPA 4GI6A 4M24A 4XUYA 4AD2A 4W86A 2VR4A 5D9NA 1N82A 3K4AA 1DEDA 4W84A 5IHSA 4B9YA 2XG9A 2D0FA 1BLIA 1B90A 2GDUA 3T2QA 1XYZA 3EYPA 4JHZA 3W6MA 3U5UA 1LF1A 1W32A 5EB8A 5FCZA 2EQDA 4XZWA 4QLKA 1KQZA 1RP9A 4IISA 1CXKA 2ZUSA 1PJ9A 3VDHA 3WQ8A 4H7VA 3PZMA 1UR2A 1CDGA 4JFUA 1HKJA 1H49A 1QNRA 5A94A 2CITA 2WMFA 4TUFA 4D6CA 4H8VA 2WCGA 2WC3A 1VJZA 2XVKA 2OWCA 1ESWA 1X6LA 1FH8A 1S46A 5ABGA 3UG4A 1HKKA 3VOCA 3ARRA 4JZ5A 4RE3A 1UH2A 4TVDA 1W2VA 2A3CA 2YL5A 4BA0A 7A3HA 1FP8A 3T2OA 1OWQA 2Y4SA 4U33A 1Z32X 1GCYA 1C8YA 3CHCA 1HVXA 1MFUA 2WW5A 4H04A 3WUEA 1CPUA 3U57A 1VFOA 1OIFA 5AYBA 1SMDA 1L8NA 3ZM8A 2ZOXA 3AIEA 4UOZA 3BH4A 2YDSA 3VD5A 3CHFA 2E8YA 5EFDA 3UCQA 1QI0A 1JD7A 2X8RA 1UD2A 3EDKA 4JHOA 1JZ2A 2NT1A 1W9UA 4PSRA 3AZRA 4WIWA 2VX4A 1BPLB 4ATWA 5AC5A 1WZLA 4HTYA 3KL0A 1UG6A 2RGLA 5A6BA 3WH7A 1W1PA 1LWJA 1BVZA 2WYSA 4C7FA 2VO5A 1V6YA 2W5FA 4GZEA 3WH5A 3CUJA 4YN5A 1UWUA 1XV8A 2F8QA 2W67A 2UY4A 3M46A 3GNPA 1JAEA 1WCGA 4QDMA 4CD5A 5HDRA 4OIFA 1ODZA 3ZR6A 2WHKA 3CZ8A 4MB3A 4R5EA 3ZSSA 3MSDA 3M07A 1JL8A 3IAPA 4MNKA 3TTSA 4HA4A 2O9TA 3BAKA 3SCTA 1E40A 1V3IA 5BCAA 3VDBA 4EE9A 2J8FA 5D8ZA 3GDBA 1CGVA 2ZWZA 4HOXA 3N17A 1E6PA 3IAQA 2A3EA 2JEPA 1KXVA 4HMCA 2ZX8A 3CZJA 1EH9A 3CPUA 3MANA 3TA9A 4AZ5A 5CGTA 3VU2A 3ZJKA 1H11A 4B15A 3KE0A 1GONA 1OCQA 4PYSA 3VM5A 1H0GA 1DWHM 3OLDA 2FGLA 2J7DA 2XJ7A 3FAXA 4AD4A 1B31A 4GZIA 3TOPA 2JFEX 3KEHA 1UWRA 1JIBA 1OT2A 2J79A 5A8NA 1WB0A 1EDTA 2VRQA 1K9TA 3SCRA 3NDZA 3CUGA 3ALGA 2YDQA 4E8DA 3BCFA 6TAAA 1G1YA 5CLTA 1XSIA 1R85A 3VX0A 1QW9A 1Q6DA 1F4AA 5M03A 1NP2A 1CECA 3AIUA 2IXUA 1E6RA 4UFKA 3WDQA 3OZOA 4YPJA 4CCCA 3BGAA 1R7OA 4WKAA 2AMGA 4TX8A 4BF7A 4D6IA 1C7SA 2YJQA 4ML4A 2C0HA 1W1VA 2J8GA 5LA2A 5HNNA 4WSJA 1US2A 4IPNB 4KH2A 1TA3B 2W4XA 3PZNA 4H2CA 4A3HA 3PN8A 3AYRA 4CUCA 2G4FA 1W9BM 3AOFA 3ARYA 3ZMRA 1A3HA 4AMCA 1H0IA 3ARWA 3UERA 1GUVA 1DP0A 2CXGA 1UZ1A 1V6XA 5TD4A 4WJXA 3T09A 2GK1B 3AIBA 2XSAA 1QNSA 5FD0A 3GTNA 1CBGA 2EXOA 1IZJA 3WEZA 3WL0A 3GM8A 4EK7A 2Y24A 1OIMA 5CQ1A 4WKHA 1WDSA 3I3EA 1TMQA 1US3A 1GW1A 1GORA 1KWKA 2PWDA 3EBVA 2V3DA 4EAMA 4CU7A 4PTVA 4J3TA 5A6KA 4U31A 3AZTA 4PMRA 3II1A 2DIJA 5CG0A 4HP5A 3VO0A 1EHNA 1P6WA 3AIQA 2CPUA 2CYGA 2ZICA 3VVGA 3WMCA 1UUQA 2ZUVA 8CGTA 2YA0A 4ZENA 7CGTA 3VD3A 4H8HA 2WVSA 3WUBA 1NARA 5IXEA 4W7WA 1W9PA 4UQ9A 3UESA 2OYKA 5FIPA 2PC8A 5M3WA 5D4YA 3B9AA 4TXEA 1QI5A 4QAWA 2VNCA 1E56A 9CGTA 1BYDA 5E6YA 2X1IA 4PUDA 5KEZA 2OSXA 4PTWA 2C8NA 1EOKA 2XUCA 1H3GA 4QFUA 2Y8VA 3WDPP 4TTGA 3RM8A 3CZGA 3K4DA 3W0KA 1QBAA 1G5AA 1K9FA 3T0DA 3LPOA 1WZKA 2FHCA 3RDKA 2VUYA 4KGLA 3WD4A 3A6OA 4GI9A 3RO8A 4BQ5A 2V3GA 3AJ7A 3FXYA 1Q6FA 1W3JA 5I2UA 1V3HA 2EPKX 3WNLA 5ABHA 1XD1A 4OJYA 5I24A 1QI4A 1M53A 3RJYA 4OZOA 2BY3A 3RCNA 3ARZA 3CMJA 3AS1A 5GQBA 3VX1A 4HZ7A 2VR5A 3EDJA 2J78A 3W27A 3CZKA 2VZUA 2WLZA 2QMJA 3WH6A 4J3VA 4AD5A 3VIHA 4J3UA 2WKGA 3VNYA 1QNOA 1LG2A 2WZHA 4CKQA 4PTXA 3ARUA 3W24A 1GHSA 1HKIA 1M03A 1BG4A 2GUYA 3K1DA 2BS9A 1FHLA 1EO5A 3QHMA 2GJPA 1GVYA 1J0JA 4BQ2A 1UR9A 4PN2A 1KCKA 1CWYA 4R27A 4CVUA 1FHDA 1E3XA 1E4IA 3L4XA 1OGBA 3TONA 4AYSA 3WEOA 4AZ7A 5I5RA 4W89A 3AHXA 1KGXA 2D3LA 4AZIA 4PCSA 3N1AA 4JFSA 3N15A 1AQHA 5EMYA 3WD1A 1CEOA 4UZSA 4NF7A 3ZQ9A 1X6NA 1UWIA 5BRQA 3HU7A 3MSGA 6CGTA 4DUXA 1JDAA 1I1WA 4EANA 1XH0A 1GOKA 3BSHA 2WC7A 1D2KA 4UFIA 3VIMA 1D7FA 3CMGA 2QPSA 1EHAA 2WMJA 3UEQA 5IFPA 2DSVA 2J7EA 1HP5A 2XWEA 2D22A 3AMKA 5LYRA 5BXTA 1XSJA 2BHYA 4D6HA 2DT2A 5JUVA 1CENA 3AS2A 3WDHA 3F4VA 3GXDA 4PMUA 2WMGA 1NP0A 1CXEA 2J7CA 5CXPA 2J75A 1BG9A 2DH3A 5LA1A 4Z2JA 4M81A 4D1IA 4MB4A 3WKZA 4JL2A 3RJXA 3O6AA 4XZBA 3VIJA 1J0YA 3O9NA 2E8ZA 2BHZA 2VCCA 5C71A 1I75A 2J25A 1PBGA 3SUUA 4HZ8A 3TTOA 1V0NA 2G3MA 3VGHA 1G01A 2CIPA 5HBFA 3FN9A 1UH3A 3WNKA 1JG9A 1BQCA 4W7VA 1UR0A 1MQPA 2V5CA 2FHBA 3ZIZA 1HJXA 4ACZB 2NT0A 3SCNA 1KR1A 1ITXA 1PX3A 1E4LA 1L0PA 1M04A 5I23A 2UWFA 1GNXA 3AI0A 3GXIA 1RD6A 4JFWA 3CH9A 3AHTA 1KGWA 1W91A 4UQCA 4B9ZA 1MW0A 1VF8A 5D9PA 4FF5A 2ZXDA 2UY5A 1QNQA 3QOMA 2XFYA 5I77A 2EBNA 1UD5A 4U2ZA 5DFAA 4M1RA 2VZVA 3AXHA 2VQUA 1WDPA 3BLPX 4NI3A 2YIHA 4LPCA 3PZGA 1HF6A 5M5DA 1OINA 5GNZA 3EDEA 1G9HA 1ZBCA 2VRKA 2Q8XA 1UKQA 4AD3A 3CUFA 2BHUA 2VT0A 5E09A 4BQ3A 2VZTA 1GHRA 4AWEA 1B3WA 2BXZA 1LL4A 3WN6A 1TA3A 5A8PA 3N04A 1GOIA 2VVSA 2WAGA 2VI0A 1UR1A 1OT1A 5AY7A 2YBTA 3I3DA 1OB0A 2J7FA 1WDRA 2Y5EA 4FLRA 4OKDA 2XIIA 4DWSC 4AZBA 1CTNA 1OD8A 3B8SA 3MS8A 4P8XA 1G94A 1VEOA 1XD0A 4UNIA 2WZEA 2WCAA 5F7UA 3SCUA 4IUGA 5GNXA 1ZB5A 2F2HA 3SUWA 3UR8A 3AS0A 1CXLA 3AISA 2EO7A 4MTVA 3TTQA 4DWSD 1TG7A 2CETA 3GBEA 2A3AA 2D23A 1V08A 2X0HA 5I78A 2BFGA 4JAWA 2E9BA 4P7RA 4ZXOA 1CLXA 2XVPA 3IJ9A 3A47A 1GOWA 4FLOA 5FKYA 1QPKA 1U33A 2XTKA 3WF3A 2O9PA 2E4TA 3VPLA 2BVDA 3PZVA 3WY1A 1JZ8A 2WK2A 2BNJA 3POCA 4UCFA 4CU8A 1KXQA 2YL9A 4XX6A 5DO8A 3RIKA 2PWGA 3VGEA 4PBGA 1UR8A 2C7FA 4XB3A 2XPKA 4UTFA 1U2YA 5A6MA 5I6SA 1BGAA 3AZSA 5C8BB 1PZ3A 3QOKA 3OGVA 3K8KA 2CCRA 3ARSA 3PHAA 4GO8A 3AMCA 3N13A 4MJ2A 5JBFA 4OOUA 1NWUA 2PBOA 3AQUA 2XM2A 4X0VA 2WKLA 2TAAA 2WHLA 4AISA 3L4TA 2G8ZA 3PBGA 2DT1A 2IUZA 2QMKA 3GZAA 4CVWA 4U5IA 1LL7A 4W7UA 2JEQA 2X0YA 2ZX7A 3GNOA 2CKRA 1OBAA 2DSKA 4JCLA 2V3EA 1VIWA 1E72M 2ZX5A 1H4PA 1JDDA 3QHOA 4AXNA 2WVVB 3HN3A 3THDA 3W29A 1VBUA 2NSXA 3IANA 3GXMA 2QHAA 1KB3A 2VRJA 2DT0A 1GJWA 1ODUA 3MUAA 4MNMA 1W1YA 3WNPA 1CGUA 1KR0A 3VUPA 4AZHA 3VMOA 4Z2IA 2WPGA 3WNMA 3SUTA 2GDVA 1ZJBA 1IZKA 4D6DA 4BS0A 1VENA 2OWXA 4D6JA 1SR0A 3AHVA 1CGTA 2WBKA 3QGVA 1Q6GA 1SMAA 3ARTA 4HMEA 1TFVA 4CN6A 3T08A 1XRVA 4FLSA 3CTTA 1E9LA 2VMFA 4GKLA 1EO7A 3ARQA 1JDCA 5GPRA 4HA1A 1KWGA 1VFFA 1J10A 4LXFA 1WKYA 3RMEA 4HU8A 1CGYA 1V6VA 1W1TA 3ZT6A 1F4HA 1UH4A 2O9OA 2WNWA 1VB9A 2YKKA 1MW2A 1XSKA 1UA7A 1PIFA 4PMOA 1E73M 1K9EA 2PB1A 3BSGA 2PWHA 3WFLA 4L4PA 3B9DA 5I79A 4PMVA 2QPUA 4GQQA 3L4UA 1HJSA 4QLLA 4YHEA 2DH2A 1QHPA 3DHUA 1KBBA 3U5YA 4MDOA 1DHKA 3CGTA 3W25A 1FFQA 2XGBA 4UOJA 2VTFA 3MUZ1 1ISYA 2XFRA 2IXVA 2WM0A 1E3ZA 3NYDA 4OBSA 1VFMA 3VIIA 1ZL1A 3AXIA 2JE8A 1AQMA 1C91A 1V0KA 3NDYA 1CZ1A 1HKMA 4UFMA 3VIGA 2E0PA 2PBGA 4AC1X 1B3XA 3F5LA 1JI2A 1EIBA 4MJ4A 2OYLA 2CESA 5IHRA 3CHDA 3VMNA 4KRUA 3T2PA 4HPGA 3DECA 1CGWA 3CLWA 3AIRA 3EMZA 4X0NA 3OGSA 3DYOA 3WIJA 1V3KA 3PZIA 5JBDA 1XHGA 2VCAA 5CPQA 4DM2A 1ZBWA 1FOBA 2YLLA 2YDRA 2X05A 3GNRA 1ZBKA 3MUIA 3CZEA 3ZT5A 1GQKA 4Z2HA 2WWCA 4H8UA 3K8MA 4JIEA 4M56A 4AIEA 3J7HA 4ACYA 4C7GA 4Z2KA 3RM4A 1PPIA 2CBIA 2J4GA 4F8XA 2UY2A 1CYGA 4ZE4A 1NQ6A 1BYBA 3O2LA 4W8BA 3SCPA 1C3FA 4ACZA 1E6SM 1MQRA 5DT7A 5E9AA 2F61A 3ZT7A 3MMUA 3PZTA 1XH1A 1HP4A 3WH8A 4MAVA 1E1FA 3UETA 4F66A 1YHTA 1TCMA 3AXXA 3OB8A 5CSYA 4P7OA 3AIWA 1V0LA 2FHFA 4B3KA 1JFHA 4UFJA 4S3JA 1HX0A 1E0WA 1EQCA 4UR9A 2D0GA 2EPNA 2XVGA 4MB5A 3MUY1 1JYXA 3FHAA 3WF2A 1E5JA 3WMBA 4MADA 1WAWA 1UWQA 1GOMA 1UKOA 3W4RA 4W93A 4WF7A 3SUSA 4TTUA 1WP6A 1JNDA 1V3MA 3E1F1 1KCLA 2ZIDA 2OSWA 3CO4A 4BQ4A 4M29A 3T0AA 3VDCA 4E2OA 1LQ0A 3CIVA 2VURA 2JALA 3GH7A 4PTMA 1E15A 1RP8A 2YL6A 4UFHA 3PZUA 4CCDA 1JYNA 4D71A 3WQWA 5DMYA 1XCXA 3WD3A 1DTUA 2CBVA 1V6UA 5A1AA 5ABFB 1J0IA 1D3CA 2DEPA 3BMWA 2WCSA 2DQXA 1I1XA 4CD4A 4GQRA 3VKKA 3ZOAA 4DUVA 3WQ4A 1W3LA 2JIEA 4ATLA 2DT3A 2EPLX 4D72A 3WFZA 4N42A 2DSZA 4CU6A 1QOXA 1KGUA 1ISVA 1DWFM 2ZWYA 1W9XA 5A6BD 3AFBA 1RPKA 1CLVA 1C90A 1SYTA 1QI2A 1DWAM 3G6MA 1OM0A 1MW1A 1QNPA 4AY1A 4HOWA 1GOOA 2V5DA 3I3BA 1Q6CA 1J01A 1J11A 5A8OA 1XH2A 1EDQA 2D20A 4PEEA 1H2JA 2WLYA 3MKKA 2DGAA 3VIKA 1EDGA 1X1NA 4V28A 4JKMA 3WUFA 1ZBVA 1BHGA 4WK9A 1ZJAA 3OA5A 3NCOA 2XWDA 1XCWA 3UG5A 5CJ5A 3ZJ7A 4ZEPA 1LJYA 1DWJM 3N12A 4P8VA 3BC9A 4AD1A 1MFVA 2D2OA 1H1NA 3ZSTA 2B31A 3VILA 2BVYA 3AMGA 5A8QA 1B3YA 2YLAA 4MNLA 4D6EA 3SURA 1DWGM 2DDXA 2VC9A 1PX8A 1KXTA 4HZ6A 1ZS2A 2OYMA 4N0RA 5AYIA 1B2YA 3IK2A 4KRTA 4YHGA 4MPKA 2VZSA 2W91A 3LPGA 5FL0A 1E4NA 1HJUA 3FW6A 2VX6A 5A2AA 3VGGA 1OGSA 4AZCB 3VGDA 4PRWA 5DF0A 1B3ZA 1HJWA 2W92A 1HNYA 4H41A 4GINA 1M7XA 3SCQA 2J62A 1GQJA 1JF6A 4RL3A 1WNOA 4C7DA 1W9DM 5ABEA 2E3ZA 4OBRA 4AEFA 1GZJA 3L2MA 2OSYA 5HXMA 1TVPA 1PX4A 4AZ6A 5EFFA 1BYAA 1VJSA 1QBBA 2GFTA 2DSUA 3FHQA 1W2PA 1R86A 2E9LA 2YBUA 3WL1A 3BAJA 4S3KA 2E40A 1JNEA 3W38A 2WANA 3VINA 4P7LA 1NOUA 1LL6A 2D24A 3SCWA 4B16A 1V02E 2WHJA 3S6TA 3CHEA 1BF2A 1V03A 2GVYA 3LMYA 4PCTA 3APGA 1TE1A 1V3LA 4V27A 2ZXAA 1M01A 3UG3A 1CIUA 1HN1A 2AOSA 3WDJA 3NSNA 1E1EA 4UQEA 3WNOA 3ZO9A 3PTQA 3NSXA 5A95A 4P7NA 4GXPA 3POHA 3VTRA 1HXJA 1HJVA 3WBAA 5HPOA 2J74A 2WWDA 2WSKA 2ZUUA 3IJ8A 3BLKA 3BCDA 3L4ZA 2W66A 3MMWA 4P8UA 3BXWA 1K6AA 5JIPA 4DWSB 2Z1KA 4P8WA 3DYPA 4WLCA 4W8LA 2ZXBA 1FP9A 1A47A 5IDIA 1JZ4A 5LA0A 1J9YA 1QVBA 4Q22A 3VDAA 3BAYA 6A3HA 3RPMA 5A3HA 4J3SA 1FH9A 4JKKA 4GZJA 4PMDA 1ISXA 3SEPA 2WMIB 5JIWA 4PSPA 1GOQA 3NIYA 3AMDA 2XM1A 1Q6EA 3JUGA 4U3AA 4AIOA 3ECQA 1OGGA 3VD9A 1B1YA 1V02A 3NSMA 3OLEA 2GK1A 2CEQA
chains in the Genus database with same CATH superfamily
4AB4A 4FIRA 2GJRA 3ARVA 4LCRA 1P1MA 1N7KA 4H7CA 1HIZA 4HJWA 1YX1A 2BX7A 2CFFA 2PLJA 2VEGA 3T8QA 1Z6KA 4L6HA 5BOFA 1VP5A 2YYUA 2ZXQA 1K4HA 3OLIA 1ZZMA 3LCIA 1REQB 1V0MA 3TCEA 5G1TA 3IUIA 3HPAA 3EOUA 1E70M 2CHNA 1MMFA 3LGDA 4JX6A 1IT0A 1ITUA 3GVRA 2Y8KA 5DELA 2GJNA 3UYCA 2QDHA 4GIEA 1XLAA 4RCXA 1QPNA 3LPFA 3H7VA 6XIMA 4O1BA 4H9TA 4YTQA 3W37A 1RZMA 2DSWA 4WOQA 3GDTA 1E6QM 3U2EA 2NW0A 3NOEA 3TFCA 2ZBTA 3F2DA 3WEMA 1YYAA 2A7NA 4JN7A 3P5ZA 4GO9A 3VCCA 1RLCL 1GQIA 4ICMA 4AWTA 4B2DA 1GVOA 3AHZA 4E5TA 3H55A 3EDFA 4DI8A 2J6XA 1BKHA 2OZ8A 3TIMA 2WVTA 5BW6A 3PBUA 1R2SA 3W1XA 4E2DA 3N11A 7TAAA 4AHOA 1FWFC 3UP8A 4LUJA 3SIMA 3LM7A 3IRDA 5BXRA 4ATDA 3HGOA 2O55A 1NOFA 3HJEA 4AXKA 3TTYA 4A8IA 4R34A 1QT1A 3NGFA 3UJRA 2C71A 3WSUA 5CPTA 2WVUA 2ACSA 1XPGA 2DZWA 3KOYA 1MI3A 1H5YA 3T0CA 5HNRA 4C6QA 4AVOA 3KBJA 1EYWA 2D73A 3QPYA 1H62A 1JEZA 3ZR5A 2D1ZA 3CYVA 4KW7A 2YOCA 1WPCA 3TTEA 3WLMA 1TKKA 4Z1AA 3GXTA 1B54A 5HR6A 4RK8A 1MZRA 3G24A 1JGMA 1NWTA 4KKXA 2GLKA 2X40A 1SFSA 4QJ3B 3F4CA 1VPQA 1MXDA 4RE4A 3P60A 1D7KA 4UZUA 1A0EA 3HGSA 1RD5A 3ARPA 1UJQA 4FNTA 3HV8A 3ZS4A 4LUIA 2OVLA 3WF0A 4WUIA 3KZSA 4IPJA 2ZUWA 2XIBA 4H6EA 4GUJA 4PMQA 5BWAA 4JIHA 4X2RA 1GJUA 3PTMA 3O3RA 1AODA 3GR7A 1QR7A 1IEIA 1JULA 2E6YA 4Q4QA 2O92A 3QY7A 3EB2A 3M0KA 2CNCA 1UKTA 4Y9NA 1KFEA 2YCEA 4S3GA 1R6WA 1POKA 3NQEA 4N9CA 1RUSA 1KBKA 1UP2A 1R7AA 1XG3A 1Q66A 3E3HA 2IMRA 2OMAA 2OWWA 3OLGA 2QLYA 1YNPA 3LMZA 3MJMA 4KERA 1VRXA 1UASA 1NH6A 3A4AA 2C1GA 1J6OA 2QAFA 2WC4A 1T41A 4L6DA 2UY3A 1VBJA 3AU2A 3LENA 1XDMA 2WSPA 2Y88A 3KTCA 3OIHA 1QTWA 4KCWA 1YW1A 3W2LA 3MHFA 4DAFA 3F2CA 3LCLA 4N9DA 1TYGA 1R3VA 3C2RA 2VQTA 4QCEA 3C3UA 3EWZA 1NM9A 1O5XA 1DXIA 3VD7A 3QQWA 1B30A 1JZ5A 4TX6A 3SAZA 2WJFA 1VQTA 1OFEA 3T4CA 1MXGA 3OG3A 1QUMA 4JYEA 1CB2A 4UTWA 5D38A 5LXEA 1C92A 1IEQA 2I9UA 2RH9A 4DWSA 3L5MA 1KCZA 1LLOA 5DQPA 4XO7A 3CT2A 2QJMA 3AS3A 3RFAA 2REQA 4OE7A 2XYLA 4ERAA 3HG4A 1EUNA 1NDWA 2OKTA 4LYPA 1S5MA 2XVNA 2XGIA 5DY2A 1IV8A 4GIYA 3F4WA 4FOJA 1G0CA 5HUPA 1Z44A 2I56A 4EKJA 2HVMA 3TSMA 2HDJA 3VNZA 4DO5A 3E2RA 3STPA 4A3YA 3NJ3A 5AHFA 4YMZA 1I2NA 4B3ZA 1UHVA 1H7WA 1OFDA 5EBAA 4DJDA 4O10A 3CUHA 2KZHA 3PM6A 3CUIA 2HVNA 1MNZA 1WA3A 4NAEB 3HJZA 3KL3A 4GI8A 2ACUA 2Y2WA 1BWLA 4NZ5A 1EQPA 5BOEA 4L4OA 1XGZA 2HBVA 2GVLA 3FIGA 1AL7A 3M16A 1JI1A 3M43A 4HHMA 1I45A 3MYOA 4NU7A 4OO7A 4LQ1A 4F2UA 4D6FA 3M4HA 4GRSA 5C9ZA 5M17A 4OOZA 4DXXA 1VAHA 1BAGA 2NLYA 2EGZA 3URBA 2P10A 3B04A 4QCFA 2W0UA 1Y5VA 1JQVA 3IGSA 4Q8WA 2J9YA 2Y5JA 1R3YA 2D0HA 3GYEA 5AC8A 5HJXA 3W1LA 3QYSA 3CQ0A 5IFTA 2VDIA 3EDDA 1JGIA 2V82A 1ENUA 4IMCA 3EPOA 1QW8A 1JZ6A 1E0XA 3GAKA 5XIMA 3MC5A 3R0KA 3OGRA 4AX7A 4DX3A 4PMYA 1I0DA 1R3WA 1W9VA 1DQXA 1GPFA 3EOEA 3OHMB 3DG7A 3PJTA 3N9SA 4NJJA 3SUVA 1UP3A 3AYVA 3TLLA 1G4PA 4NXSA 1B3OA 5FJPA 2P8BA 2FKPA 4AG0A 4RNIA 3DOPA 4LEQA 4FLQA 4TMBA 2Z7GA 3SADA 3UZZA 4UTTA 2P0OA 4PMXA 1C8QA 3A3WA 2OODA 1UOKA 4NILA 1WYIA 4LBRA 2V5KA 4YVVA 3L4YA 4US6A 3LCFA 1CW2A 1UUOA 1HVQA 4LF1A 1DQWA 3SN0A 2DQWA 4MOZA 1TQJA 3L9CA 1JFXA 2QCLA 3HG2A 3CL8A 3BJTA 3BZJA 3DESA 1DWIM 4Q7NA 1J0ZA 1K03A 4A8RA 4XV0A 5CLWA 1VFLA 1WZMA 2OPJA 3AMLA 3AU6A 2PCQA 3LXBA 2OB3A 2EPHA 3KRZA 3DC0A 2BDQA 1NWRA 3NO1A 3GVGA 5FOOA 1FCVA 3WLQA 2XSBA 1L6WA 2PCEA 2GVGA 5D9OA 3NZGA 1ZFJA 2Z0IA 3REQA 1EC8A 2G3NA 1EP2A 3L2LA 3TJXA 5MKGB 2VXNA 1US0A 3TOYA 4JTUA 1W54A 2XHYA 4GIAA 5BWFA 4XUYA 2RDXA 3QFEA 1OADA 1S1PA 5D9NA 3NQAA 2D2HA 5IHSA 4B9YA 2PDLA 4DIAA 2D0FA 4LUSB 3U5UA 1DVJA 1LF1A 3NAVA 3PNUA 1IWPA 2ZZ3A 4FALA 1R30A 4EZFA 5K9XA 2OFJA 1HKJA 1H49A 3N6JA 2CITA 3E74A 4G56A 4H8VA 1FWWA 3TYCA 2H9AB 1VJZA 3L0NA 4GY1A 4C90A 3USZA 4OHQA 4QJ4B 1X6LA 5ABGA 3M0ZA 2J13A 1DIEA 1LQ2A 3UYIA 1UH2A 3OZMA 2F6XA 2WO5A 3S4TA 1EL3A 3GDKA 3URAA 2Y4SA 4U33A 1Z32X 3GG7A 4OWGA 4MJZA 3C2OA 4XWUA 1FXQA 1RXOB 2WW5A 3U57A 4FNQA 4H8NA 2DZUA 1VFOA 3CQKA 1FKWA 4TU1A 1GVQA 3MWCA 3P8IA 1E9IA 2ZOXA 1Q6LA 2YDSA 2E67A 4K8GA 1H61A 5D37A 3UCQA 1JZ2A 2YX0A 4UTJA 4KFPA 4HNNA 3STEA 4WIWA 3QJAA 1V4YA 1MRQA 5A6BA 1F3TA 2B7PA 2W9MA 1P7TA 3U2OA 1LWJA 2PRMA 1JR1A 4H00A 1V6YA 2W5FA 5K3VA 4L9XA 3CUJA 4YN5A 2PD5A 2BTMA 2Q3RA 2E5DA 1QPQA 3L2IA 3M46A 1JAEA 4QDMA 5CPLA 2JGYA 4EOUA 3ITVA 2WHKA 4R5EA 5CEWA 5K4XA 3MSDA 3VOFA 3NO3A 4MNKA 2O9TA 3RRAA 2NV9A 5BCAA 1YXCA 1CQUA 1TRDA 3MBDA 1KXVA 1EH9A 4KIRA 2RKXA 1QAPA 3MI2A 4B15A 2C3ZA 3VM5A 4L7ZA 1H0GA 2R94A 1K3UA 4L80A 3FAXA 2JFEX 2R1NA 1UWRA 2J79A 5A8NA 1EDTA 2QGYA 3KOZA 3SCRA 4WY0F 1FDYA 5BZAA 4JGDA 3RU8X 3BLLA 3BUVA 1YTDA 2GSEA 4E8DA 4CCZA 6TAAA 1EPXA 4J40A 4FX6M 4M7SA 4KRZA 2V2CA 5M03A 1NP2A 1CECA 3VKDA 2R1KA 3AIUA 4V1YA 1J93A 3DKJA 4YPJA 3M1ZA 2Q02A 4WKAA 2AMGA 4X3ZA 1GGOA 2YJQA 3E9AA 1B5TA 2FFIA 3E0LA 2J8GA 3EX1A 1LOLA 4JICA 3LV6A 1E1CB 1OG6A 3GNDA 2I16A 1YDYA 4KH2A 2ZZ7A 1HTIA 3PZNA 3VKBA 4H2CA 3F1QA 1A5OC 4NZJA 5GHSC 3ZMRA 4AMCA 1H0IA 1CCWB 1S1RA 4XD5A 1LLWA 3DGBA 5FD0A 2G50A 3GTNA 2TODA 4Q32A 2QCEA 3WL0A 4EK7A 3NQ6A 1OIMA 4ZZ9A 3I3EA 1XLJA 1JCMP 2PDQA 2B4GA 1D3GA 2CLPA 1OCJA 4J1OA 1XBXA 3EBVA 3W6YA 3TC3A 1TV7A 4PCNA 3N29A 3F2BA 3TW7A 4WY0B 5I00A 4PMRA 3PR2A 2Z2UA 1P6WA 2ZYFA 2CYGA 1M41A 2Y7EA 5AKQA 8CGTA 5KZDA 2YA0A 7CGTA 2WVSA 3Q4DA 1IGSA 3INPA 3LI0A 4W7WA 1FHUA 4BWLC 1X1OA 5FIPA 5FF3A 2PC8A 3G22A 1OC7A 4TXEA 4ZQCA 4REQA 2P0IA 3UPMA 4G8TA 3BTNA 2A79A 4EP8C 2O4QA 1YRRA 4GZ7A 4UCGA 3T4WA 4M6UA 4PUDA 2EKCA 2FPTA 3RF9A 1IT8A 3BVJA 5AZ0A 2R24A 3BQ6A 4YYFA 3R6IA 1UROA 4EWJA 4TTGA 1J8VA 1LM1A 1TTJA 3RDKA 3L7RA 4KGLA 3V0SA 3WD4A 3BARA 4GI9A 3KHDA 4CLMA 3W75A 4BQ5A 3C8FA 3I10A 3L5AA 1TTQA 4WDWA 2SFPA 1KM5A 1W3JA 2F7FA 4XZIA 3S2QA 3WNLA 1XD1A 3R94A 3UVAA 2ZVRA 1XLKA 1QI4A 4HHHA 1EJUC 2Q6ZA 3RCNA 4CQAA 2OUTA 4D9PA 3ARZA 5K4ZA 5EMKA 3W27A 3CZKA 2VZUA 2QMJA 5FEPA 4MKSA 2CLLA 4AD5A 3EEGA 3VIHA 1XICA 2WKGA 4IP5A 4LTSA 3TLQA 1PYFA 3DH7A 3BK0A 2MNRA 2LLEA 3AWOA 5FEZA 3NQCA 1GHSA 5TBOA 2Q9QB 5M1TA 1M03A 5FAJA 4AF0A 1EO5A 3STCA 1GVYA 2XFWA 4H9UA 2AQVA 1KCKA 3HB9A 1E3XA 3U3HA 5KZEA 1IXQA 4DBDA 1S2AA 3FKRA 4TV6A 3LRLA 3ES7A 1KV5A 2HJQA 3EWWA 4JFSA 3N15A 5EMYA 5CCZA 3PUEA 2Q8LA 2NQHA 4JTHA 3ZQ9A 3GTIA 1RA0A 3FJLA 3HU7A 1VBHA 2GL5A 4NUWA 2OZ3A 2YSWA 2O56A 1XH0A 1GOKA 1D7FA 2QR6A 3M0XA 3G1AA 4XSLA 1HP5A 2D22A 5I3KA 3AMKA 2EF9A 5LYRA 1V6TA 4GY7A 4A05A 5BXTA 3L66A 3E0IA 5DANA 4D6HA 1XXXA 3PF3A 3NA8A 7REQB 1CENA 3AS2A 3WDHA 1QO2A 3E5BA 5I3GA 4PMUA 5CZTA 3B0XA 2J75A 5TIMA 3M0JA 2DH3A 5DBTA 3MW7A 4M81A 4ZQRA 4Z1DA 2VD9A 3EWCA 4LW7A 4DY1A 1WXZA 2NVCA 5H6HA 3O0FA 3TBNA 1TX0A 2J25A 1YLVA 2A6NA 1BQGA 3SUUA 3GXPA 3N25A 2G3MA 1XYMA 5E9XA 1JG9A 3KCOA 2Z29A 1UOZA 3ZIZA 5LNWA 2C79A 2Q8ZA 4ACZB 3SCNA 1ELSA 1PX3A 1M04A 2VWTA 1KFKA 2UWFA 4S1FA 1GNXA 5LIXX 3W1TA 2HXTA 4RZ5A 2DFAA 4JFWA 3A5FA 3CH9A 3P6LA 4RR4A 2VFHA 5C9WA 1QOQA 1JVNA 4WXZA 1RCQA 3W3OA 4FF5A 2ZXDA 2UY5A 2C6QA 3MTWA 1Y5XA 1ONEA 2PDFA 2PAJA 2B7QA 1UD5A 4QDWA 5DFAA 3AXHA 3BO9A 3NPVA 3N3MA 2VYOA 2E7FA 5F4SA 5D2XA 5LHEA 3RPTA 3BSMA 3PZGA 3QSTA 1IEXA 1JDEA 4BHYA 3E96A 2NUYA 2VRKA 4AD3A 3TSDA 4BQ3A 5KETA 4A6GA 2UBPC 3NPXA 3SR7A 4AWEA 2BXZA 3KDNA 2CZDA 4D8AA 4S3CA 3SSZA 3P62A 5A8PA 3OVPA 4EXAA 1DJNA 1OT1A 3NQFA 3S46A 4WGXA 1TJRA 2J7FA 2NUXA 2XIIA 4C6PA 1OD8A 3B8SA 3TX9A 4JNMA 1XD0A 3NQDA 2ZZ2A 4IUGA 4LT9A 2VGGA 3ABOA 1ZB5A 1J79A 4CQDA 3W7GA 3UR8A 1A5NC 3GW3A 4ICCX 3QKZA 5HANA 2EO7A 5AVHA 4BWLA 1TG7A 3W85A 3PANA 1UBSA 1KM6A 4IHCA 3B3DA 4R3UA 2E9BA 4INFA 4ZXOA 3IJ9A 3QMSA 1C8VA 2G96A 3A47A 5T91A 4FLOA 3TJLA 3G77A 5FJUA 2E4TA 1OCBA 2ZRXA 4GQ0A 4WR3A 3WY1A 2BNJA 1DHPA 3POCA 1SW3A 4HNLA 2OOGA 4CU8A 2YL9A 1K8XA 3Q37A 4O4VA 3RIKA 3VGEA 4H9VA 4ZO8A 4UTFA 1BGAA 4MIMA 2FVKA 3PBMA 4DZHA 3OYXA 5LSMA 1PKLA 3FGCB 3K8KA 1IIGA 3ARSA 4GO8A 3AMCA 4IJRA 3CL6A 2AL2A 4OOUA 3H6OA 4X0VA 2WKLA 1MEWA 3TQ0A 3UWEA 2EG8A 3MP4A 4XK2A 3VOHA 3BG9A 4EVZA 3PBGA 2QT3A 4V33A 1FRBA 4CVWA 1PVNA 1ZY9A 1XIMA 4W7UA 5DXYA 2ZX7A 4O19A 4JCLA 2V3EA 3GFYA 1VIWA 1E72M 4IMEA 4O0ZA 1H4PA 3QHOA 4AXNA 1XR2A 2DZSA 3HN3A 4PB4A 4C6BA 1XINA 3W29A 1L6GA 3LNPA 4LNYA 1I8JA 3ABZA 1VBUA 3S2NA 1L6FA 2DT0A 4C6NA 1ZUAX 4LFYA 4Q4PA 3KS5A 1EJVC 4MNMA 3OA3A 1W1YA 3IUHA 4DBUA 3IJ6A 1KR0A 2OTDA 4AZHA 4L64A 3VMOA 2OU4A 4HKPA 1EJWC 3WNMA 2OX1A 4LAMA 1IZCA 1WKEA 3TC6A 4PE8A 1SR0A 3QYQA 3S0CA 3CXOA 3S5ZA 6REQB 2WBKA 3QGVA 1SMAA 1TFVA 1E51A 3HQNA 3CLMA 1Q3NA 4XSMA 1X1ZA 3BPWA 1E9LA 2WNNA 3TR9A 3C2EA 4O1CA 1JDCA 2W3ZA 3H2AA 1KWGA 1WKYA 4NNAA 4IQDA 1TMLA 2PURA 2BMBA 3DHFA 3LN3A 1MW2A 1WBJA 1PIFA 1AD4A 1K9EA 3BSGA 2PWHA 4L4PA 5I79A 4GGHA 4HTBA 2QPUA 1KBJA 4CEUC 5DBUA 4TMCA 1XLDA 4GQQA 1HJSA 5LZLA 4LOCA 5LIUX 4LF2A 1RBLA 3C2FA 3NWRA 4MDOA 3WLJA 1XIFA 4UOJA 2AAMA 1SSGA 3H2CA 4LAUA 4XIMA 3NYDA 3CPRA 1VFMA 4NP7A 3VIIA 3EPNA 2NLIA 1C91A 1HO4A 2QCCA 4EPDC 2DVUA 4UFMA 4JEJA 3EGJA 3CHDA 5FSDC 4KRUA 5AZ1A 3DECA 1CGWA 3AIRA 4KPLA 2G0WA 3EMZA 3OGSA 2C1HA 3GRIA 1FOBA 5D30A 3WFAA 4PL2A 2QULA 3YPIA 3MUIA 3CZEA 4FXJA 3D3FA 4AIEA 4GBDA 4EACA 4C7GA 1PKNA 3H4GA 2PTXA 2UY2A 2ASHA 1BYBA 2XU2A 1C3FA 3HV9A 2F61A 4U4MA 3T1GA 5FSEC 3MMUA 3G1VA 3MI3A 1EGMA 2QJNA 2NWSA 3UETA 2W27A 1Q4WA 5CSYA 2GGHA 1V0LA 3SGZA 2Z2AA 3A64A 3KBSA 3EA2A 4UFJA 1HX0A 3TMLA 2D0GA 3CWOX 3LK6A 3MUY1 3UNDA 3FHAA 3CU2A 1WAWA 1GOMA 2ZRWA 3W4RA 4DEFA 3DKLA 4S2CA 3E1F1 2VFEA 4BFAA 2OSWA 3S1XA 1EGVA 3R43A 2INFA 1IR1A 1E15A 3PPGA 1FXPA 4UFHA 3PZUA 1H1YA 1JYNA 1C29A 4D71A 3WQWA 3GAYA 5DN1A 1TQXA 1DTUA 4LUSA 1V6UA 4LSBA 4UY8H 5ENLA 4J2MA 2DQXA 1DYSA 4YWIA 3VKKA 3WQ4A 4QS6A 5G2IA 2Y89A 4RSRA 4F0MA 4N42A 2DSZA 4YJ5A 1AJ2A 1NF0A 3B06A 3GY1A 3TU9A 3IJLA 4HNCA 4LUYA 1XLCA 1SYTA 1QI2A 3BLEA 4GISA 4RV3A 2QEZA 1KTNA 3SIZA 3N34A 2NQ5A 4HOWA 1QNPA 2V5DA 4GC4A 4LVBA 3UFYA 1V79A 1XH2A 2WQPA 3ANYA 1EDQA 4RDWA 2E6AA 4LY8A 4PEEA 4HN8A 5DRIA 3LCGA 4QHRA 3VIKA 1EDGA 4Z1CA 1X7IA 1YDOA 4V28A 4JKMA 1BHGA 1W0MA 5LIKX 3C61A 3OA5A 5HQMA 5TAOA 2C19A 1O1HA 4M0XA 5CJ5A 3ZJ7A 4L4LA 4EPKA 1LJYA 1F7BA 1M7JA 3QN3A 4JNZA 3P61A 4ZGYA 3EZ4A 4G7EB 2OT1A 4AD1A 1MFVA 2WPBA 1FWIC 3AMGA 1TSIA 1W1IE 1B3YA 2YLAA 1S5NA 2IPGA 4S2BA 1DWGM 4UBPC 2DDXA 4L1WA 2ZKMX 2VC9A 1PX8A 3R8RA 4IXHA 1OQFA 4YU1A 4IIHA 5BOOA 3QH2A 2OLAA 4MHBA 4MPKA 3ITGA 3RX2A 3ZWSA 1JCYA 5C2GA 4AZCB 1R9YA 4LCSA 4FX8A 4D8ZA 1HNYA 4E2VA 3AXKA 4UMBA 2HS8A 3HM7A 3WG6A 4H19A 1LT8A 3FNVA 3S9ZA 4Q3MA 3GKFA 1JF6A 1WNOA 2GZXA 3ONCA 1KM1A 1W9DM 4K36A 3RHGA 4I8YA 4OBRA 2OSYA 1GKQA 2ZCGA 2GFTA 4GJIA 4S23A 2DSUA 1WXYA 2Z1WA 4YVXA 1N8WA 2GWNA 5HJYA 3GHRA 2VUNA 3WL1A 3N2TA 3BAJA 2OX4A 2TPSA 4HGXA 1ICQA 4U10A 1JNEA 3L0KA 3FDGA 2D24A 3NXFA 3T55A 1F5ZA 2WHJA 5HMFA 3HQPA 3OOQA 3W00A 4PCTA 3B8VA 1TE1A 3OU8A 1TV8A 4HK7A 2ZXAA 1M01A 1I0BA 3KOXA 4JDYA 4XTIA 1ZHAA 3NQGA 4JIPA 3ZO9A 1GW9A 4XQ6A 4C6EA 3NSXA 3I65A 5A95A 4GXPA 1HXJA 1DQUA 5HMSA 4LU0A 3UCDA 1OEPA 5HPOA 2J74A 4OGZA 2FJKA 1L9WA 3MMWA 3WLIA 3TWAA 3BXWA 1K6AA 5JIPA 4HQVA 1YEYA 2FZ8A 3M0LA 3DI0A 1A47A 5IDIA 1JZ4A 1KRMA 4Q8MA 3UU0A 1FWTA 1TJ0A 5A5WA 1QVBA 6A3HA 2A2IA 1Z48A 3RPMA 2GSHA 3HBLA 4LRTA 3KVJA 4JKKA 4DO4A 4A3UA 2QF7A 2PE4A 4QR6A 1ISXA 4Q4KA 4NKCA 3S1GA 3UY8A 3NSMA 3OLEA 3G0SA 4E8CA 1TR9A 1X97A 4Q33A 2P5NA 4CNNA 2YPIA 3MHUA 4RPPA 3W26A 1UYQA 1OZMA 4ZE5A 1DE5A 3PFMA 5E0FA 1AA1B 3QR3A 2R91A 4O1DA 4DO6A 4XAGA 1RVKA 1A4LA 3A4XA 4FMVA 2ZZ4A 5C6MA 3CC1A 3WQPA 4DBEA 3TCSA 3W1PA 1Q85A 2GOUA 1V77A 3XISA 2V6AA 4IX2A 2QH7A 2D3NA 1E9ZB 3N2MA 3M7SA 3EW0A 1MWOA 3THCA 3E0WA 3PWGA 3PPHA 1RSCA 1TPEA 3IACA 1UQYA 2FDMA 4W87A 1PDYA 1P4CA 3DYMA 1RH9A 1XL9A 5L6UA 3KWXA 3CIWA 2R1MA 2OEMA 4O15A 2HVFA 3ARXA 1W5PA 3MV01 3HFTA 1JAKA 3GTFA 3VOJA 5ECUA 4V15A 4JFVA 2RFGA 4RUBA 1VRDA 5E0CA 1WZAA 3DU0A 4WCJA 4P61A 4PL1A 2OR2A 1ZAHA 2C16A 5BXSA 5A6JA 3M0IA 1IR2A 1LRNA 3AICA 4ES4A 1KFWA 4X2PA 3A5VA 1NOWA 2EPMX 1U30A 5FJTA 3FY1A 4DNHA 2POZA 4B5WA 5FEWA 1EWDA 2Q09A 3LQGA 2HWGA 2O9RA 2CLMA 1NDZA 4ROPA 4F9JA 1ALDA 1AVAA 1PEZA 4GIRA 4MVAA 3A22A 4C6CA 1WX0A 2WSYA 3K46A 1HL9A 4IQJA 4ERIA 4X22A 2GGIA 5E70A 5CGMA 4RE2A 5GJNA 1VR6A 3OJGA 2A3BA 2ZRZA 3ZJ6A 2GJLA 2E9MA 5E5CA 2GJXB 2DZBA 1X96A 1AMKA 3O16A 3OG2A 4IM4A 2OQYA 3C2YA 4BR1A 2MANA 3BMVA 3R89A 4QM1A 3FNDA 1UW9A 4GABA 3E12A 3O8AA 4PULA 1H7XA 3W6LA 2VDGA 5JBEA 1QMLA 1E6NA 2QCHA 1UA3A 4W5UA 4QLJA 3NM3A 3AIVA 5D8WA 3N9KA 4XAFA 3LHUA 3GG8A 1PKMA 2WOQA 4O18A 5J5RA 3EXTA 4IJBA 4PMJA 2J27A 1IXPA 1KTCA 4M1BA 1ADSA 1Z8AA 3LB0A 1QI3A 2ZUMA 4B92A 1FCUA 5CC7A 1HT6A 2FGBA 2OQHA 3BDKA 3CV6A 4URIA 3RUBL 4J28A 1KQYA 1EZ2A 2OCZA 1A80A 1XLGA 3KVKA 1THFD 4MB1A 2XGZA 2OT0A 1WE5A 3N18A 3WQ6A 1CX9A 4AW7A 2HBAA 5EG5A 1C8XA 4KS0A 4NZFA 2CW6A 1Q7MA 1H09A 3CQJA 3PZOA 3VE7A 3RYSA 3AUOA 3CYJA 1VBGA 3GDRA 4LBSA 4QP0A 3MKVA 1S2TA 3SI9A 1Q4NX 4WSKA 2YBVA 4HZMA 4Q6JA 5IM51 1P0KA 4NQ1A 3EX3A 3XINA 4UB9A 2ESCA 1Q2SA 1Y0EA 1MZHA 4AD0A 5JH1A 3GH5A 4E38A 1ISZA 5A2CA 3ME3A 3OBAA 1VHCA 1Y8BA 3QW4B 2GQ9A 3UXDA 2BY0A 3EX2A 1YIXA 4PMZA 4S3FA 5KITA 3GU9A 3O7UA 1TB3A 4B5VA 3ITCA 2B81A 4J27A 2ZDRA 3U2CA 4JL1A 1POJA 2BY1A 4Y9OA 4BZYA 2FH8A 3TA6A 4MAZA 1W1ZA 2WZIA 4OT7A 4GMEA 4IMGA 5H8UA 2G95A 4BI5A 4LCQA 4I5RA 4NSBA 3G18A 2ZX9A 3B9NA 3N2XA 5IDZA 1F2JA 3RITA 3BAXA 1ITQA 3AHYA 2DZPA 4GPNA 3W88A 4GYFA 4IUOA 1A4MA 1X39A 4HOZA 1LLZA 4QXIA 3H4WA 4K7VA 2Y0FA 3UZJA 1OJXA 1H60A 1BFNA 1XC6A 3W28A 4Z42C 4NXKA 4YCOA 2PGFA 4ZA0A 4JQ3A 1TZ9A 1XFBA 4UQAA 1FUYA 4QG8A 3IJ7A 4TVUA 3DFYA 3N2OA 1QHOA 2PGEA 3TW6A 2Z2BA 1JD9A 3F5KA 5EKYA 1E6XM 1UCWA 2C1IA 1G4EA 5DEZA 3W7IA 3TBOA 4QG9A 3E2VA 2HBXA 4F0SA 4HPHA 4ZXLA 4CD6A 1JF5A 4KFNA 1IEWA 4CQBA 4BF5A 6ALDA 1CLKA 3UJSA 3G0XA 4JTQA 4F79A 3QTPA 2JIWA 2VX5A 1CXIA 2J88A 3WDIA 1TR1A 4JY8A 3M6DA 1NAL1 2DIEA 4A29A 5EL1A 2FTYA 3AYSA 4FR0A 4I7WA 2NUWA 5CGQA 3EMQA 1UD6A 2E25A 3D3AA 1GK8A 3UD6A 2XH2A 4XKMA 5CC6A 1CXHA 3CTLA 2EEXA 1JYWA 4GYPA 2PD9A 2W6RA 2X1TA 1WUEA 1J4EA 3LZ5A 1UWTA 4IP4A 5BROA 2IQ0A 3MV11 4E4PA 1J0KA 5C70A 4C6IA 4JHMA 3HIJA 1XKYA 1U83A 3V75A 4AYGA 1OC6A 1BRLA 1XIHA 4Z17A 3W7LA 3PZQA 1SR9A 3MYPA 4XD4A 4X9YA 4LYRA 2VHLA 4W85A 2V68A 4R9OA 1KXHA 3BAIA 4ROQA 4FOKA 1NWSA 4BCEA 2PSNA 1MDLA 5REQB 3NQBA 3M5YA 1XYAA 2EKGA 1LWHA 3K2GA 4ORMA 1GZ1A 3TXVA 1BYCA 1ADOA 3GW0A 1M68A 2CZFA 2G3IA 1OD0A 2VEFA 1OSEA 1KO0A 1TJPA 1MW3A 4PR4A 4XKYB 3SCVA 3V1PA 3EKLA 4WKFA 3R4IA 2E5BA 6REQA 3KCLA 2JBMA 2G97A 3G1FA 5I3DA 1HL8A 3TQKA 3H22A 1MO0A 4XISA 3CAQA 3OZPA 3TAOA 5CH9A 1V6WA 3WH9A 4D6GA 1IYXA 1FA2A 4TVCA 2PWEA 2ABBA 3KS6A 4CN4A 1K1DA 1VLIA 3L68A 1DJZA 3TAKA 3LLXA 1XIIA 4TIMA 2CLIA 2VZOA 4GVIA 3NTYA 5HPCA 3SSJA 1RQEA 2WMKA 1PDZA 4GI6A 4M24A 4QSFA 4W86A 1YTKA 1J96A 4JNYA 1R47A 2XDFA 3P14A 3VKJA 2PDWA 4RW3A 3B0VC 4QISA 4ZL1A 4W84A 3UW6A 1XBZA 3UWYA 2F6KA 3T2QA 3WLLA 3TUUA 1Q13A 3KBWA 4XZWA 2HVOA 3FEMA 4IMAA 1KQZA 3V1HA 3WQ8A 3VDHA 3PZMA 1UR2A 1CDGA 2ABAA 4JFUA 1X8CA 5A94A 4D6CA 2WC3A 1VFTA 3HURA 2OWCA 3GUWA 1HFBA 3E38A 3TN4A 1ESWA 4HA0A 3VOCA 1F05A 4DJEC 4I7UA 3QRHA 3WLSA 2AMXA 1OF8A 2NQZA 4TVDA 1G69A 7A3HA 1H50A 3LA4A 1GCYA 3M64A 4I9JA 4F2BA 4NJKA 3NDOA 1HVXA 1MFUA 4H04A 2PDGA 3B05A 1DORA 2B7NA 2HV5A 1L8NA 2ANUA 3ZM8A 2VOMA 4PUJA 2HK1A 1H7PA 1JCTA 3R10A 5EFDA 1JD7A 4JHOA 3E0FA 3AZRA 5DLCA 3LGEA 3N14A 1RALA 4HK5A 3V5CA 3WX7A 3FYPA 4LV4A 1LUCB 4QNEA 2INZA 3WJWA 4C7FA 1BVZA 3QLDA 2NVDA 6XIAA 4GZEA 2QCDB 3S8HA 2F8QA 4QIUA 4UTHA 1W1B1 2W67A 2PDXA 4CD5A 1WCGA 5HDRA 2X7VA 4MB3A 4Q8NA 3ZSSA 3N6QA 3M07A 4E3TA 4DYKA 2CLEA 3RX4A 3BAKA 1E40A 2UZ9A 5I3JA 1CGVA 2ZWZA 3N17A 2A3EA 4HMCA 3UJ2A 4ALDA 4ECLA 5AHLA 3S2JA 1ML1A 5CGTA 6TIMA 3RXZA 1H11A 4PYSA 1TV3A 1OYCA 1DWHM 4DJFD 2PP3A 1B31A 4PFMA 3KEHA 1A5KC 4JYFA 3BLIA 1EIXA 1WB0A 3KLKA 2VRQA 3V35A 4MZYA 3H12A 2ATMA 2GGJA 4Y6GA 3NDZA 3CUGA 3B97A 2YDQA 2Z7KA 4JXCA 2O7SA 4ZB0A 1R85A 1AL8A 3UVIA 5F2LA 4CQ8A 4GFIA 1ONRA 9XIAA 3DG6A 3LV5A 4ML9A 1LZOA 2F38A 3WDQA 1GPWA 3QC0A 1C7SA 3SGUA 2QJIA 1LWIA 3B03A 4G7EA 4ML4A 5G1YA 2C0HA 1HL2A 1VS1A 4Y9PA 4H1ZA 5HNNA 4K3ZA 2JK2A 2QDDA 3KUMA 3VC5A 3UXAA 2W4XA 3S83A 3K5XA 4NAFB 4HB7A 3AAMA 4A3HA 1RY0A 4CUCA 3AOFA 3ARYA 3DFOA 3UGVA 3VNIA 3MDWA 4PH6A 2Y1HA 5TD4A 3T09A 3H8AA 2XSAA 4GG9A 1IQ8A 1CBGA 1IZJA 3WEZA 4HSHA 3EEZA 4NZ3A 2Y24A 1GYLA 1XDLA 4XAZA 4N2YA 4DLFA 1US3A 1J2WA 4C6DA 7XIMA 4R7OA 5HA7A 2PWDA 3HF3A 2XIOA 3LHZA 4J3TA 2EHOC 4U31A 3AZTA 3VNLA 2DIJA 3BG5A 3PG9A 3T78A 2GUBA 2BB0A 4HIBA 4HP5A 1EHNA 2XINA 3V5OA 3VCRA 3W7JA 3AIQA 3D0CA 5AB3A 1L6SA 2QNEA 3VVGA 2ZUVA 4O28A 4ZENA 3VD3A 5I3FA 4H83A 3PG8A 2XZ9A 2ISWA 2Y62A 3KXQA 3LYEA 2D2JA 4KW2A 3JVAA 1SM9A 2ZA2A 3KRBA 2OYKA 3FV9A 1QI5A 1R38A 2I57A 4K6AA 3RLUA 2VC5A 3DAQA 2VNCA 5AOUA 3TN5A 2WZTA 5E6YA 5KEZA 1OX6A 2YFOA 3EOOA 1T96A 1T6MA 2XUCA 1Q2RA 4DF0A 3LX9A 2Y8VA 4MY9A 3WDPP 4G2DA 3CZGA 3B8DA 1LBMA 4UTIA 3B0UX 5LNSA 5HULA 2DY3A 1WZKA 3PTDA 2DUXA 2EHHA 3J7ZH 3RO8A 1FCQA 3P7YA 2V3GA 3DDMA 4AY8A 3W1QA 1K77A 3MSRA 1Q6FA 2E1DA 3Q67A 3EX6A 3TV8A 3P2VA 5ABHA 4MWAA 4IP7A 4AVNA 1Q6OA 1A5BA 5G4WA 1TJ1A 4I9TA 1AZ1A 2ZC8A 4DJEA 4OZOA 3KLLA 3EB4A 3MZ2A 5GQBA 1X98A 3EKZA 2I5IA 3ANVA 3LS9A 2ADAA 2BXVA 4J3VA 2OO0A 1M6JA 4FR1A 4B2DD 3ZVHB 4NJIA 3VNYA 4B5UA 2GGEA 3V0UA 4LUTA 2PGRA 4PTXA 1MEHA 3ARUA 3E2QA 3DIPA 3K4WA 3RLHA 4A2RA 5HR7A 4IPPA 2GUYA 2BS9A 2R8WA 3QHMA 2PEVA 1ONXA 4HSNA 1SZFA 1ME8A 1ICPA 4L9ZA 4PN2A 2P1FA 3GLCA 3L4XA 4AYSA 1E4IA 1Y65A 3WEOA 4AZ7A 1FHVA 3GUGA 5I5RA 4FNRA 1TWZA 3UNTA 2FZDA 4AZIA 4ZB5A 2AKMA 4QDPA 4O16A 2IKJA 3I6TA 4QE1A 1X6NA 1UWIA 5BRQA 3MSGA 3HMJG 1JDAA 3S1VA 1AG1O 1DBTA 4IICA 3BSHA 1D2KA 2Z6JA 4K37A 3UEQA 1UR3M 2YW3A 4Q8TA 2R1LA 3W9ZA 1R2RA 1XIDA 2BHYA 2PA6A 1DJXA 4FNUA 2DT2A 3NQ7A 4G7FA 3MHGA 1RQBA 3F4VA 3GXDA 2WMGA 4UIOA 1XG4A 3URNA 2J7CA 3LXCA 3MUCA 2QCGA 5LA1A 1RPXA 3G1DA 4L4MA 1WKFA 4MB4A 2J8TA 3GVWA 1I9CB 5EMJA 4XZBA 3VIJA 2VCCA 1I75A 4CNSA 4FO4A 2PTZA 4CNPA 4D2JA 4RDYA 3AXMA 2WSQA 4HZ8A 4KEZA 3HQ1A 3VNDA 3NNTA 5FF7A 1E0UA 3KBNA 3T05A 1AW5A 2CIPA 3S2RA 3FN9A 1QJWA 5AHMA 4F0KA 4WGHA 3USBA 1SSDA 3NZPA 1GWJA 2A0NA 3LU2A 2FHBA 4OQVA 4HK6A 1DIVA 4LS0A 4IX0A 2NT0A 1KR1A 1FWDC 1ITXA 1X38A 1J5SA 1O5QA 1Q8AA 1N8FA 2DV0A 3GXIA 4LWWA 4CEXC 4DVOA 1P0DA 3AHTA 4NX5A 4UQCA 3ITXA 1VF8A 3REEA 1QNQA 3QOMA 1A5AA 4GGBA 1BXNA 1EWEA 1XC4A 3QMRA 5DRCA 4M1RA 1EPVA 2VZVA 3M6YA 3LD5A 5H1WA 1OFAA 4H3DA 1HKVA 5EA9A 4LPCA 2A4AA 3N2BA 1TPVA 5CSSA 4DNMA 1GEHA 1HF6A 5M5DA 3IS4A 3C0LA 3OZYA 5GNZA 4PRRA 1G9HA 1ZBCA 3LHVA 2Q8XA 4LVAA 1RK6A 5E09A 4B5NA 1W5OA 4FIQA 1TA3A 3B0YA 1JPHA 2WAGA 3ERPA 4UTWC 2GPTA 3W1MA 2Z26A 4C6OA 4WEVX 2YBTA 3F7JA 2DW7A 3I3DA 5HNUA 1XLMA 1OB0A 4JQ1A 3NL3A 1WDRA 4FLRA 1P6BA 4ZB2A 3FLUA 4DWSC 1CTNA 2C15A 2HE5A 1G94A 4RV8A 4MGGA 3EWUA 2WZEA 5FJOA 5F7UA 2E9XD 3SN4A 3QTGA 4ZBCA 4RXFA 3H7RA 4BK9A 1CXLA 3HPFA 2VWSA 3NQ8A 3PB2A 2V67A 1FCBA 3STGA 4MTVA 3TTQA 3IGHX 4DWSD 3PJUA 3SRKA 4XD6A 2Y8UA 5I09A 1G4SA 2CETA 2VEPA 3V3WA 2Z1XA 3FJNA 1CLXA 4QJ5B 1OX4A 1FWJC 1GVFA 4DJDC 4ZQPA 1GOWA 5FKYA 2FVLA 4D8LA 3T81A 2O9PA 5J04A 2AQOA 4LANA 2WQDA 3PZVA 1JZ8A 4H01A 2WK2A 1SO3A 4F28A 3PAOA 1SJCA 1YXDA 2Y61A 1PO9A 3ZYZA 4DJDD 4XX6A 3TYAA 5LIYX 2PWGA 4PBGA 3FA4A 1UR8A 2C7FA 5B7YA 1BXBA 3OGVA 2HROA 1G4TA 3LHTA 3KAOA 4Y8EA 1T0OA 3GS6A 4BKNA 2WM1A 2QUTA 5JBFA 4Z1YA 4F4RA 1K4GA 2ZFAA 3FX4A 2QQ6A 4XD3A 2FQIA 3IV8A 5XINA 4C60A 3L4TA 2G8ZA 2QMKA 3WO8A 2E1WA 3U4FA 4A22A 4U5IA 1K70A 3R7MA 5HWMA 3ZXWA 2WJEA 4CQCA 1OBAA 2DSKA 5CJNA 2Z1BA 1S2WA 1JDDA 3MZNA 3NL2A 2WVVB 3THDA 3CWNA 4Q8OA 4GUGA 2CWXA 3EXRA 5BU9A 2H90A 3IANA 2IKHA 4O1AA 2VRJA 3WQFA 1Q63A 3CIXA 1W37A 3EX4A 3UXKA 3WNPA 4UTTC 3VUPA 3IVUA 4Z2IA 3OW1A 1DJYA 1TPB1 2YCLB 1B4KA 4FP1A 3H4XA 4D6DA 3NG3A 2TMDA 3WMLA 1VENA 4Q6XA 3PJWA 3AHVA 3P74A 3ARTA 3R25A 3ARQA 1TVLA 3EXSA 4QQ3A 3RLVA 1KNWA 1KRAC 1J10A 1VFFA 4LXFA 3RMEA 3ZT6A 1UH4A 2PP0A 1ICSA 1ZAJA 2O9OA 5B7ZA 1GQNA 1S5WA 3GIQA 5AYXA 2KAUC 3WBXA 1X6UA 4GX8A 1I2OA 1UA7A 2PB1A 3WFLA 4A3QA 3LOTA 1IWBA 3B9DA 2YDAA 5XIAA 3W22A 2ICSA 3U5YA 1DXFA 1H51A 4KQNA 1FFQA 2XGBA 3LTYA 2VTFA 1PZ0A 2XFRA 3DFTA 4GH1A 4M7TA 1A3XA 3D6NA 2YW4A 1XYLA 4OBSA 2JE8A 4DZAA 1CZ1A 5GJMA 1JI2A 3LQLA 3P5YA 3W7KA 2CHRA 1S3TC 5IHRA 1F8MA 3VMNA 3CLWA 4X0NA 4AC7C 1QFEA 3DYOA 3LSCA 1V3KA 1JUEA 3PZIA 5JBDA 1XHGA 3H2OA 4Y9MA 4DM2A 3V16A 2J9XA 3GQYA 2YCKX 2X05A 4US5A 2DIKA 2VD8A 1LORA 1GQKA 3K8MA 3Q94A 2PDBA 2BOFX 2A7PA 1W5NA 3S2LA 3VC6A 3WQEA 2GUUA 2J4GA 3OPSA 4NYYA 1VPXA 3DI1A 4F8XA 5CKSA 4E3VA 1NQ6A 3O2LA 5I7GA 4H4IA 1MQRA 4Y8FA 3PZTA 1XH1A 2NQJA 1HP4A 3WH8A 2ZQ0A 5BMWA 4MAVA 1YHTA 1EYEA 2Y63A 3KRSA 3OB8A 3H26A 3GHTA 3AIWA 1KKRA 1XUUA 3KZPA 1EQCA 3PP7A 1TWWA 4MJMA 2CZ5A 3IJDA 1JYXA 3DZ1A 1J2BA 1UKOA 2DJXA 3KTXA 3GSMA 4Y96A 3HG3A 2CC0A 4O12A 3KRUA 4TTUA 2X0SA 1V3MA 1RQHA 1KCLA 4BQ4A 4M29A 4ZOAA 1XISA 1FQ0A 4NT0A 3VDCA 1XUZA 1LQ0A 4AH7A 4GI4A 3GH7A 4MUZA 4PTMA 2YL6A 4QE5A 3G0UA 3QR1A 1XCXA 4GD0A 1PS9A 2DEPA 3TH6A 3RG6A 3CS2A 3DUGA 3ZOAA 2ISDA 3RGTA 4DUVA 2VR2A 4OECA 4GUFA 4UNLA 1FX6A 1W3LA 2JIEA 2BLEA 3WFZA 1QOXA 1EJXC 4LVGA 5JU6A 2FZMA 5A6BD 3DFHA 3AFBA 5FA5A 1RCOB 1XLFA 3A21A 3LLDA 1OM0A 2X30A 2V81A 1MW1A 4AY1A 2H8ZA 1Q6CA 4Q4MA 3S2MA 3LHYA 2X42A 2BP1A 3B8UA 2V63A 3WK0A 1J11A 5A8OA 3SN1A 4JTFA 4KCVA 2WLYA 3SB0A 4PTDA 3HTWA 3LCHA 3Q58A 4CQ9A 3APTA 4WK9A 3U6WA 2XWDA 3M44A 1M7PA 3UG5A 4ZEPA 1DWJM 3MWAA 4JPGA 4P8VA 4IFKA 3KP1A 5IRPA 5AC6A 3WJZA 3ZSTA 5JXQA 2BVYA 3GU2A 3UZ5A 1QPOA 1AW1A 3B4YA 3WK3A 1ME7A 5DMNA 4D6EA 3SURA 1VLWA 1LUCA 1ZS2A 3R0UA 4YVPA 2OYMA 3W7QA 4N0RA 5AYIA 4KRTA 1TO3A 1BKSA 5D32A 3SO7A 2PDJA 1TV4A 1E4NA 1HJUA 1OFPA 8TIMA 3CV7A 3NZRA 1EFZA 3VGGA 1YPXA 1HJWA 1Z7AA 5TQLA 3GR8A 3NPWA 4DF1A 4H7ZA 2PDHA 4H41A 2L5HA 1U1UA 4GINA 1M7XA 1HO1A 3NZ1A 2P88A 3B40A 4FB7A 4H9ZA 4C7DA 3BJFA 5ABEA 3MQTA 1GZJA 1PX4A 4AZ6A 1T99A 3O6YX 5H8PA 4JTJA 3H23A 3QC3A 4K39A 2XN1A 1ADDA 1ZJIA 4ZODA 3VINA 3R2GA 1NOUA 2F84A 2OZ0A 4IG2A 1LL6A 3SCWA 1HG3A 4B16A 1V02E 4IIFA 2IQDA 2Y85A 1CIUA 4O17A 3WNOA 3CL7A 3BLDA 1HUVA 4J2PA 1OC5A 1EA0A 3PTQA 1PCWA 2E9XB 4H9MA 2J6VA 1HJVA 3WBAA 4LB4A 3EAUA 2ZUUA 1DIOA 3IJ8A 3BCDA 2WSRA 3VE9A 3DC8A 1EBGA 4IXXA 4DWSB 4I6VA 3DYPA 4W8LA 2ZXBA 1FP9A 2R82A 4WRHA 5LA0A 1VYSX 1J9YA 2I14A 2REQB 2PC4A 3BAYA 5T9CE 4NAFA 1FH9A 4GKTA 4GCAA 1UIOA 3F03K 4GZJA 4PMDA 3BGJA 1A3WA 3LTSA 3GX9A 3NIYA 1Q6EA 2OQLA 4AIOA 3VD9A 2ONEA 3IVTA 3MU7A 3L0GA 3G5EA 1L2UA 5C2CA 3W1RA 4YTRA 3PC0A 5BYWA 3CZLA 3CEPA 3G6LA 2RHGA 2NX9A 3TSBA 3M7WA 4JFTA 3QHNA 2WB5A 3I6RA 1NY1A 1UKSA 2WNQA 2RDWA 1UQZA 4TV5A 4AHPA 2PRHA 3E2SA 3M0YA 1VCVA 2PTDA 3ZLHA 4LAOA 3ABQA 1BEUA 3GYCA 3P0XA 2Z25A 1P0NA 4HU0A 4A3RA 2WHMA 2CBUA 4GWEA 4DZ5A 2C0AA 2HXUA 4E2BA 3ID7A 4IPLA 3DG3A 4O13A 2QYGA 3CBWA 4F0RA 2GDQA 4W88A 3VI2A 3QQ1A 3W7NA 3BZGA 1MRAA 1LDCA 2PWFA 2ZUNA 1SJAA 4XBKA 5DMLA 4NZCA 2ALDA 5CG7A 2CERA 3O0KA 4DPPA 3O05A 1WDQA 4G1KA 3VD4A 4Q4SA 2Z1SA 5EMUA 3IV3A 1D9EA 4K1GA 4IPIA 3WJSA 1XGDA 2WXDM 3AC0A 5I02A 1NU5A 4YTTA 5D9MA 2HE8A 3OHIA 1IHIA 4Q7IA 4J9JA 5A8MA 4A4AA 1E5NA 3L4VA 3H2NA 3W2MA 4KGJA 2ATSA 2A3HA 2CHOA 2AKZA 4C6JA 3I7RA 2FYMA 5C9RA 2OJPA 1O60A 3SZ8A 4M51A 3GG0A 3VMPA 5ABFA 2J47A 4GLEA 2V38A 4F0LA 2V3FA 1MYRA 2PWVA 1ECEA 4DYJA 4NRRA 3VABA 4ILSA 2BY2A 4CD8A 2IPFA 3GKAA 4N9EA 3SECA 4HT3A 4JR5A 3L4WA 3W53A 3ZVHA 1KFCA 2NZLA 3DBPA 3LHWA 1E6ZA 1J6PA 2V0TA 1V3JA 3LGGA 4PUKA 3G3DA 4PCPA 4AEEA 1A5CA 3WD0A 4F48A 3WDRA 1UD8A 3ATYA 3WBWA 2YL8A 3NEVA 1C7TA 4K7YA 3A4WA 3REQB 3NQVA 5I07A 4CNTA 3BAWA 5I03A 4K68A 3BL3A 2W61A 1AH0A 2VGIA 4HCLA 3WF1A 3W87A 3MO7A 4G9PA 3HMCA 3PBYA 4AVFA 3PNZA 4YCPA 3UXIA 1W3KA 3S2CA 1B4EA 4ZTYA 2XVLA 5CPMA 3GTHA 3S1UA 1VEPA 2Y6ZA 3JW7A 2P53A 4A35A 1TVNA 1VEMA 4CGTA 4GY0A 4FXFA 3C0JA 1TV2A 2FPYA 4PMNA 8A3HA 4MDPA 4HMDA 4O1EA 3WYZA 3F4DA 3U7VA 1DJHA 1XRSA 4MM1A 5FACA 4DQWA 2CZEA 1K8YA 5A8GA 3UWUA 4B5TA 1H5VA 1W56A 2EJ1A 4QGCA 5AC4A 1YBQA 2VOTA 3LCWA 4JQAA 1R8LA 1P43A 4KIEA 2EPOA 2ZUTA 3GIPA 4UTMA 5A6LA 3H70A 3T0TA 1LCOA 4UMCA 1JZ3A 3NURA 2PF0A 2JF6A 4J7RA 3CH0A 1VHNA 1E43A 1UPPA 4N6FA 1GQLA 4JCMA 5JVLA 4CD7A 3DEQA 5FL1A 2PODA 2BBFA 5CPOA 3UWWA 1AH4A 3WF4A 1SZNA 1FY6A 3QF0A 3U48A 3THQA 5E6ZA 1BSIA 2QJGA 2I5GA 2G3JA 3SCOA 4IZGA 1F6YA 3U9IA 1P7TB 3QQ0A 5C2XA 3DFSA 4QSHA 2JKPA 3T42A 4PEKA 1UIPA 4KETA 1K6WA 3ZVIA 5HOSA 4UOQA 3W86A 2LSMA 1VBRA 2GSJA 4LV9A 3TQPA 2X4AA 1VFUA 5G4EA 3DGRA 4EIVA 3NUKA 4RDZA 4RZ6A 3RM9A 3FJ6A 2ZE0A 3A13A 2QUNA 3H54A 1MVYA 4M80A 5D2VA 4W5ZA 4NHVA 4E4UA 3S3GA 1E71M 1XCFA 1G67A 3DFPA 2WMIA 2NQLA 5IBXA 1M5WA 4K8HA 1WAUA 4S3EA 1TPUA 3A9IA 3S5OA 4F9DA 1DPMA 1JUBA 3W7MA 1U1JA 1JPMA 3PULA 3ICJA 1K9DA 3S6DA 1AQ0A 1F3WA 4AZGA 3KL5A 4C6FA 3MO4A 5A69A 3SCSA 2FPVA 2J77A 3QY6A 5CZKA 3VAVA 3D5HA 4FS8A 3GXFA 3OTRA 3QY8A 1KV8A 3P81A 3DHDA 3RU6A 3WQ5A 4ZOBA 3LZ3A 2ZC1A 3BJSA 1GYMA 4ADTA 3MCNA 3UY7A 4MKNA 4JEQA 2WMHA 2YA2A 1REQA 4XG1A 4S3AA 2BWGA 2VL4A 4WOZA 4KESA 3WNNA 3F5JA 1SFTA 3RR4A 4V2XA 3WENA 4AFYA 1BWKA 1H41A 1ISWA 3MA8A 1D3HA 1U22A 1YE6A 3DCPA 4HYVA 4LX4A 2VCBA 3GVVA 2I17A 1B3VA 1PZ1A 4K8EA 4DJFA 1RR2A 2FTPA 2PZ0A 5BMXA 5AECA 4PUEA 1PXGA 3S9IA 4QG6A 4HA3A 5H91A 4MY8A 3WMSA 2DUAA 4RNFA 3ANUA 4AIUA 4DB7A 3D47A 1M7OA 3RAOA 2BVTA 4D1JA 2ZRUA 4I90A 1SZGA 2WVVA 4TQTA 1EJSC 4HPXA 1I2RA 3TYZA 3D46A 6PTDA 4IH3A 2QUMA 3W76A 2UV8G 1VH7A 4QNWA 1B9BA 4JTLA 2VX7A 2QDGA 3EMCA 5FF2A 8XIMA 3PJXA 1BVWA 1P0EA 1HZYA 3VYLA 1BGGA 3W02A 5CBJA 1E0VA 3MVIA 3EWXA 1NDYA 3GBDA 1WO2A 2W63A 3EB3A 4K2SA 4REQB 4IGSA 4M8UA 3N4FA 5HWNA 2J7GA 3CO8A 1Z3NA 1R9XA 4FX7A 3T44A 3SQLA 5AN7A 2F6UA 1PIGA 1EC7A 3VZXA 3T8LA 1K8ZA 2CKSA 3U7BA 1O68A 3L67A 4YWSA 2CLHA 5CBBA 1GG1A 4U2YA 4GE8A 1N55A 1UZ4A 3OO2A 4LALA 5D05A 4AD2A 5KINA 1Q8JA 4XAYA 4M6VA 3MB9A 4NNBA 3BICA 1RBOB 3TYUA 1BLIA 1VCGA 4XO6A 5LGXA 1YDVA 3EPMA 1MSSA 3ITOA 1XYZA 3W6MA 4WX2A 4GA8A 1KM3A 4QLKA 3WLPA 1FWGC 1RP9A 3H7UA 1PJ9A 4EX4A 5C5YA 1DJWA 1KTBA 1QNRA 2BSLA 2WMFA 3OIXA 4FS9A 4TUFA 3HQOA 4PB5A 4MMWA 3GC4A 3DX5A 3W07A 1YPFA 2B0MA 1HKKA 4MY1A 1EEXA 3RMJA 2GQ8A 4RE3A 1W2VA 1XRTA 1XRFA 4AF0B 3T2OA 4N6EA 4C1LA 4B5XA 3M0VA 3STFA 2HK0A 3CV1A 5D02A 1OIFA 4I8DA 5AYBA 1XFCA 3HPZA 2QW5A 4JTCA 4IT1A 9RUBA 3AIEA 1QPRA 3BH4A 7TIMA 3GHUA 3CHFA 2E8YA 4IWWA 1AW2A 5BNKA 1QI0A 2X8RA 2X1RA 3EDKA 4LY4A 2NT1A 4PSRA 4RZ4A 3G2GA 4OUIA 1F6PA 4AAJA 2VX4A 1BPLB 5K9DA 4C1KA 4AHQA 1UG6A 3UBPC 1PL9A 5G2HA 4C5YA 5GJPA 4N7QA 1WQ5A 1I2QA 5I06A 1EUAA 4MZ8A 1XIBA 2FMNA 2WYSA 4N02A 3UJEA 1XV8A 3GNPA 1IXOA 5D2YA 3CUZA 4OIFA 3CZ8A 5CC3A 4X63A 2DU2A 3I7QA 1JL8A 5DXXA 5CBIA 1V3IA 2XH0A 2J8FA 5D8ZA 2DORA 4OVXA 5F2MA 1QWKA 4HOXA 3IAQA 4DBWA 4BF9A 3CZJA 3MANA 1H7OA 4E4FA 5HWJA 4UMAA 5EYWA 3KE0A 1KKOA 1OCQA 3TZNA 4F3HA 4ZQOA 3OLDA 2FGLA 2XJ7A 3CM4A 2VEMA 4NAEA 1EKOA 3TOPA 1XW8A 1EX5A 1JIBA 1OT2A 1JQXA 2Z4GA 4MUPA 1G7VA 3BV7A 2VFDA 1K9TA 2PFHA 3LLFA 1DL3A 4A8NA 3W73A 1EZWA 1QK2A 1VC4A 1EP3A 2I5QA 3ALGA 5AHEA 4HCHA 3VX0A 3LRMA 5C54A 1QW9A 3EWBX 4RW5A 1QW7A 1TTPA 4MFEA 1E6RA 5C9XA 3OZOA 4CCCA 5BRBA 3BGAA 1R7OA 1KLYA 3THAA 1OFRA 1XWYA 1DIKA 1TWIA 3VKAA 4I6KA 4LS2A 2FB3A 4IPNB 2OOFA 3C0QA 4Z1BA 1ZALA 4NL1A 3PN8A 1XP3A 3OVGA 4C6MA 3ITYA 2Y7FA 1A3HA 1FWAC 4QBXA 4DUOA 1GUVA 3LEPA 4WDTA 2CXGA 1V6XA 3MI6A 3SJ3A 1RY8A 2GK1B 2CLOA 1XDJA 2QJJA 3SGGA 2EXOA 1P0BA 5L9FA 3GM8A 4PUMA 5CQ1A 1GOXA 4WKHA 1WDSA 1ZPTA 1ZP3A 1DJIA 2H6RA 4IGHA 1GORA 1KWKA 1KFLA 4EAMA 2HQAA 5LNUA 5EY5A 4CU7A 4AY7A 4PTVA 1JJKA 1KM2A 3II1A 5CG0A 3SY1A 4AWSA 3VO0A 2CPUA 1JPDX 3WMCA 1PTDA 4J3ZA 4H8HA 2ZDSA 5CC5A 5IXEA 1PE1A 3W23A 8RUCA 2PS2A 2ZVIA 3PSVA 5M3WA 4KWOA 5D4YA 4QROA 2C14A 4QAWA 3B8IA 1E56A 3VKCA 5DCDA 2F9RA 3VOGA 9CGTA 1BYDA 1BSLA 5DCEA 2IKIA 2X1IA 2BGQA 3VNJA 2OSXA 1F73A 1Z89A 4DXVA 2AL2B 4PTWA 2BVWA 2C8NA 1SVDA 4Q7BA 3KHJA 1FWRA 4QFUA 2HCVA 2CZVA 3M5ZA 4F2CA 1G5AA 5MKGA 4NG3A 3T0DA 4X60A 4F1EA 4DYEA 3LPOA 2FHCA 4FSAA 2VUYA 1M9HA 5KMYA 2PDPA 1RCXB 5HJLA 5IOBA 3BOFA 4IGMA 3AJ7A 4ZSTA 1W3TA 4XBSA 2DP3A 3IIPA 4C5ZA 2VC7A 4NJGA 4OV9A 1MEIA 2EPKX 1N8IA 1WUFA 3IEBA 4WZHA 4OJYA 1S2VA 3THUA 2BY3A 4HVXA 3CMJA 3AS1A