3TBNA

Crystal structure of a miner2 homolog: a type 6 cdgsh iron-sulfur protein.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
GSSHHHHHHTDPVIAQKAPYPVTVEAGKTYHWCACGRSKAQPFCDGSHKGTGLAPVAYTPDKAGTAYFCGCKASKAPPLCDGTHKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Molecular Evolution of CDGSH Iron-Sulfur Domains.
pubmed doi rcsb
source organism Magnetospirillum magneticum
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein
total genus 16
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09360 zf-CDGSH Iron-binding zinc finger CDGSH type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.5.90 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 Ribosomal Protein L9; domain 1 3tbnA00
3TBNA 3REEA 3TBOA 4F28A 3FNVA 2QD0A 3EW0A 4F1EA 4F2CA 4OO7A 3LPQA 2QH7A 3S2RA 4OOAA 4EZFA 3S2QA 2R13A
chains in the Genus database with same CATH superfamily
2Q9QA 3EW0A 3LPQA 4FR0A 2HBAA 3CO4A 4FSDA 2EHOC 4EZFA 2QD0A 3J7ZH 4FS8A 2Q9QB 2E9XB 3FNVA 4F2CA 3ANWA 2X4AA 4UY8H 4OOAA 2OUTA 1CQUA 3TBOA 4OO7A 2E9XD 5GHRB 2QH7A 2HBBA 4KW7A 3S2RA 2LSMA 3S2QA 5GHSC 3TBNA 3REEA 4F28A 4F1EA 2HVFA 5EG5A 3FNDA 4RSRA 2HJQA 2X49A 1DIVA 2R13A
chains in the Genus database with same CATH topology
2Q9QA 3EW0A 3LPQA 4FR0A 4FSDA 2EHOC 4EZFA 2QD0A 4FS8A 2Q9QB 2E9XB 3FNVA 4F2CA 3ANWA 2X4AA 4OOAA 2OUTA 3TBOA 4OO7A 2E9XD 5GHRB 2QH7A 4KW7A 3S2RA 2LSMA 3S2QA 5GHSC 3TBNA 3REEA 4F28A 4F1EA 5EG5A 4RSRA 2X49A 2R13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBN A;  3REE A;  3TBO A;  4F28 A;  3FNV A;  2QD0 A;  3EW0 A;  4F1E A;  4F2C A;  4OO7 A;  3LPQ A;  2QH7 A;  3S2R A;  4OOA A;  4EZF A;  3S2Q A;  2R13 A; 
#chains in the Genus database with same CATH topology
 2Q9Q A;  3EW0 A;  3LPQ A;  4FR0 A;  2HBA A;  3CO4 A;  4FSD A;  2EHO C;  4EZF A;  2QD0 A;  3J7Z H;  4FS8 A;  2Q9Q B;  2E9X B;  3FNV A;  4F2C A;  3ANW A;  2X4A A;  4UY8 H;  4OOA A;  2OUT A;  1CQU A;  3TBO A;  4OO7 A;  2E9X D;  5GHR B;  2QH7 A;  2HBB A;  4KW7 A;  3S2R A;  2LSM A;  3S2Q A;  5GHS C;  3TBN A;  3REE A;  4F28 A;  4F1E A;  2HVF A;  5EG5 A;  3FND A;  4RSR A;  2HJQ A;  2X49 A;  1DIV A;  2R13 A; 
#chains in the Genus database with same CATH homology
 2Q9Q A;  3EW0 A;  3LPQ A;  4FR0 A;  4FSD A;  2EHO C;  4EZF A;  2QD0 A;  4FS8 A;  2Q9Q B;  2E9X B;  3FNV A;  4F2C A;  3ANW A;  2X4A A;  4OOA A;  2OUT A;  3TBO A;  4OO7 A;  2E9X D;  5GHR B;  2QH7 A;  4KW7 A;  3S2R A;  2LSM A;  3S2Q A;  5GHS C;  3TBN A;  3REE A;  4F28 A;  4F1E A;  5EG5 A;  4RSR A;  2X49 A;  2R13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...