3CO4A

Crystal structure of a chitinase from bacteroides thetaiotaomicron
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
311
structure length
311
Chain Sequence
SLKVVIGYLALDDWEFESLFPTIEWKYLTHINASFARVKADGTLNINPVRKRIESVRETAHKHNVKILISLAKNSPGEFTTAINDPKARKELIQQIIAFTKEYKLDGFDIDYEEYDNWDKNFPSLLVFARGLYLAKEKNMLMTCAVNSRWLNYGTEWEQYFDYINLMSYDRGAFTDKPVQHASYDDFVKDLKYWNEQCRASKSKIVGGLPFYGYSWEESLQGAVDDVRGIRYSGILKHLGNEAADKDNIGKTYYNGRPTIANKCKFIKENDYAGVMIWQLFQDAHNDNYDLKLINVVGREMMEEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitinase
publication title Crystal structure of a chitinase from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 110
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3co4A01
3.40.5.30 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 (Trans)glycosidases - domain 2 3co4A02
1E1EA 1EOMA 4OKDA 1W2VA 4TVUA 5A2AA 1VEOA 2G3JA 4JAWA 5FIPA 3PBGA 3OG2A 2GUYA 4D1JA 1OBAA 4DUWA 2OYMA 1CDGA 1V3KA 2YL8A 3NCOA 1TR1A 4LYQA 3W53A 1XCWA 4WSKA 3OB8A 4DM1A 1KXTA 5IHRA 4Z2JA 4TVDA 3RMEA 4E8DA 1CWYA 2J7BA 3ZJKA 3T0DA 2D0FA 2XFYA 3CUGA 1WCGA 3L4WA 5JIWA 4JL1A 1W32A 3F5JA 4PBGA 2J7GA 3WUBA 2Y8KA 1J18A 1IZJA 2WLYA 2DGAA 1AVAA 3ZJ8A 1WNOA 2WHMA 5HNNA 1UG6A 3GXIA 2DSWA 3PZGA 2WXDM 1BTCA 2PWGA 1CXIA 2GJXA 1WDPA 1PJ9A 3W29A 1GOIA 3WMBA 4YHEA 1GVIA 2E3ZA 3AMCA 2VNCA 3FW6A 2ZX8A 1G9HA 3AIVA 4HA3A 1U33A 4HPGA 3WELA 4B15A 1PX3A 2QMJA 2O9PA 3VGHA 4D6EA 1QNQA 4D6IA 2UWFA 3N18A 4D6DA 4A3YA 4L4PA 4P7NA 1J0HA 1V6YA 2E8ZA 3VD5A 3ZQ9A 1X6LA 4AC1X 5KEZA 5BXSA 3WL0A 4JFSA 2UY5A 5AYIA 2BS9A 1CXKA 3S2CA 2XTKA 3AHYA 4CD7A 3AMGA 3VNYA 5A2BA 2E4TA 1OGBA 3EYPA 5A6JA 5I79A 3M07A 4RE2A 2W91A 4MB4A 2WVVB 5E70A 1ODZA 1JFHA 2CBUA 2Y8VA 1VIWA 4P7LA 3SCWA 3CZKA 3WDJA 4UZSA 1JIBA 1WAWA 1Q6DA 1V0LA 5A94A 1LF1A 4ATLA 3BC9A 1B3ZA 1UYQA 1W3LA 2WMHA 1E70M 2WWDA 3OLGA 1J9YA 2X2YA 4M80A 1UD3A 2ZE0A 1YQ2A 1GORA 4UQEA 4GO9A 1W3JA 1EQPA 4WIWA 5KZ6A 4H41A 1TCMA 3SUWA 1HT6A 1C8XA 4UFMA 3PZ9A 3AMDA 2CPUA 4BCEA 1PPIA 1B3WA 2ESCA 1JYNA 3WNOA 1CGUA 3CMJA 4Y7EA 1H4PA 2DSVA 5DT5A 4OIFA 4HA1A 3VIKA 2RGMA 2W4XA 4PMYA 3AOFA 4GO8A 2EXOA 4LQ1A 4JHOA 2D3NA 1QNSA 3W0KA 1UWQA 3L4UA 3LPPA 4JCMA 3B9EA 1HKIA 3WMCA 1E6ZA 1SFSA 1PIGA 1PZ2A 4MNKA 1KQYA 2V38A 3BMWA 3WUEA 1EO5A 3GBDA 4W8BA 4AZCB 4JFWA 4ATDA 2JIWA 2YDRA 4AZHA 4N42A 1JL8A 5DO8A 1C92A 3VGEA 3AISA 1AQHA 2WAGA 1HKMA 2O9RA 4TOQA 2EQDA 4BQ2A 4TTGA 1DHKA 3CUJA 3FY1A 1LQ0A 3QR3A 2EO7A 3VMPA 3ARZA 4H8VA 1W9PA 3BAIA 4GQQA 2ZX5A 1ODUA 1JD7A 3GH4A 1Q4NX 3WMSA 2WK2A 5BXRA 3K1DA 4DWSB 3MMUA 2DIEA 1UWIA 2WLZA 3SURA 4W8LA 4H04A 2BY1A 8A3HA 1MFUA 4PTXA 1TFVA 1MVYA 1JYVA 3VIFA 4DUXA 4U3AA 3MS8A 5E9AA 3AIQA 4U5IA 2XVNA 1UOKA 2J7CA 3ARYA 3VGDA 2X0YA 1FP8A 1QPKA 2WHKA 6TAAA 5CG0A 1E0XA 2GDVA 4PN2A 2F8QA 1EXPA 4R27A 1E72M 1ZJBA 5IDIA 3VX1A 1KCLA 1QOXA 1M04A 1R87A 1EH9A 1W91A 3TONA 3WL1A 2BHUA 3ZR5A 1LWHA 1LL6A 1Z32X 3A3HA 2OSWA 4QLLA 2F2HA 3WD3A 2DQXA 4J27A 3SUTA 3TOPA 2CBIA 3DYMA 4CU6A 2Y24A 1WDQA 4UOQA 2D0HA 2JEPA 2PWFA 1B0IA 3IAQA 5D9PA 1W3KA 1MW1A 1LL4A 3QHNA 3VOCA 2ZXQA 2XSBA 1FH7A 3WNLA 3W27A 3BCDA 1GHRA 3OGVA 3POHA 1E3ZA 4M56A 5A95A 1H11A 1HL8A 2BXZA 2CCRA 2Y5EA 3BSGA 3WQ8A 1BG4A 1RD6A 3W28A 4UZUA 2XFRA 4HA4A 1CGWA 3W6LA 3WD0A 5CSUA 3EDFA 1OT2A 3PZNA 5ABFB 1JZ5A 1EDTA 4MNJA 1K9DA 3RILA 1GOKA 2GFTA 1ZBWA 2WVSA 4F8XA 5ABFA 2CHOA 3AIUA 1WZKA 2W66A 1XH0A 2Z1KA 1HN1A 5FL1A 3KL3A 1ITXA 4HZ7A 2EPOA 1E40A 1QHPA 1YHTA 2ZX7A 4GQRA 5AYBA 1JAKA 1KGWA 2X05A 5I77A 3RJXA 3QHMA 1E4LA 4FLOA 3PHAA 4BS0A 2XVPA 3WQ4A 5A2CA 4S3KA 1QBBA 3AROA 4MPKA 4AIEA 4WLCA 5A6LA 5I24A 1V3LA 1ZBVA 2J4GA 4FLQA 3VKKA 3DYPA 3EBVA 2BNJA 4ZE5A 2XJ7A 1O6IA 1WE5A 3NDYA 1PEZA 2BHYA 5A6SA 1TE1A 3OGSA 1XSKA 1OSEA 4KH2A 1OIFA 3TTYA 2XSAA 3RPMA 3M7SA 2VCCA 3VPLA 1MW0A 3M46A 1W1YA 1QI0A 1QNRA 3HMCA 4MAVA 4W87A 3UG5A 3WY1A 3VIPA 2CYGA 2VMFA 3ARRA 2WCAA 4R5EA 3WEMA 1W2PA 2VX6A 4HOXA 3K4AA 4JZ5A 3APGA 2WYSA 3SCUA 3WNKA 3AS0A 2XYLA 4B3KA 4CN6A 4GINA 1AQ0A 4P7RA 1UD2A 2XWDA 2FHCA 2VVSA 1KWKA 2C7FA 1KBKA 1UR8A 2EPMX 3AMKA 4PRWA 4XX6A 1HXJA 2VX4A 3K8KA 3EDDA 4AEEA 5A6MA 5A8OA 2DDXA 3ARSA 4HU8A 3WNMA 1VF8A 3MO4A 4LX4A 4CCEA 4FF5A 3VIJA 3AXXA 1G0CA 2E40A 2Y2WA 3VUPA 1B3VA 4AD3A 4ZEPA 4QCEA 1E4MM 1KB3A 3EMZA 4ZENA 1A47A 5DF0A 3AXIA 5CZKA 1UH3A 4UOZA 2WHLA 3N9KA 4M81A 4NSBA 1QW8A 1XD0A 3DECA 3VTRA 4UQAA 2XFFA 1CIUA 1M01A 2DH3A 3I3DA 3SCPA 5FOOA 3AXHA 4K68A 1OD8A 4V27A 1QW9A 1NM9A 1MW2A 4MTVA 4AIOA 3ZR6A 1I1XA 4CU7A 2C8NA 3E1F1 3I3BA 3VVGA 3OBAA 1HX0A 1I1WA 1BF2A 1E0VA 4J7RA 1MQPA 5IHSA 4HTYA 4Z2IA 2BVTA 5ABEA 1LWJA 4IM4A 3OLEA 4YPJA 2NT0A 2CETA 1KWGA 4Q7NA 3TA9A 2ZWYA 1UQYA 1WB0A 4GZEA 3CLWA 1GCYA 3CMGA 3K4DA 1VENA 3PZQA 3VX0A 2WMKA 3VD7A 4CVUA 4QLJA 5M03A 2GJRA 1V3JA 3GBEA 4IPLA 4W93A 4EAMA 3THDA 1CXEA 1UR0A 2VRJA 3T08A 3WH7A 2X09A 1KBBA 2CKSA 1SYTA 3FN9A 5M5DA 2ZX6A 1CLXA 4AD2A 3GM8A 4HMCA 4YN5A 4ZFMA 3VMNA 4UQDA 1JD9A 4U31A 4HU0A 4NZCA 3NJ3A 5GQBA 1V0NA 2J78A 2X0HA 3ZT7A 2V3GA 2OLHA 3IJ8A 4EK7A 4PTWA 2YLLA 2OWWA 3FAXA 2NW0A 1V6WA 3BAKA 1B1YA 1H3GA 1XH2A 4TX8A 1FHLA 4PYSA 1E73M 2XPKA 4AD5A 3NSXA 3A4WA 3AZTA 3ARQA 1V6VA 3RO8A 4UQBA 4URIA 3OIHA 2C0HA 3VILA 1RP8A 2WPGA 1OCQA 3IK2A 3DC0A 5BRQA 3A4AA 3U5UA 5D9MA 3A6OA 2A3EA 1J01A 1KXQA 3AHTA 1JNDA 3RJYA 1UHVA 3WUGA 3L4VA 1D7FA 1BYBA 1PAMA 4BA0A 4WKFA 1TA3B 2OSYA 1JYXA 4MAZA 2FGZA 4CD5A 4J3XA 3POCA 1LG2A 1TA3A 1UA3A 3F5KA 2J77A 2FGLA 1IT0A 1KGUA 2GJPA 4EANA 3QHOA 4WF7A 2J7HA 4QFUA 4DWSD 1ZJAA 2DT0A 3AQUA 1WZMA 3ZSSA 4IISA 5BYWA 1NARA 1J0YA 2J62A 5A69A 5FD0A 1H1NA 3DYOA 3WNPA 4GPNA 2ZUMA 2WBKA 1G5AA 5C71A 3VIIA 5E0CA 3MV11 3W81A 1J0IA 1NOFA 2PWEA 3ARUA 1E6NA 4HZ8A 4FLRA 1EIBA 3KWXA 3QGVA 3PZVA 4AZ5A 4F9DA 2O9TA 4BQ5A 2XVLA 3MMDA 1XCXA 5ABHA 1D2KA 4ZE4A 2X1IA 1FH9A 2WZHA 4AISA 1VB9A 3GH5A 3RM8A 2W63A 4OOUA 1J0ZA 3WD1A 3THCA 3WFLA 1HJQA 4M1RA 1DWGM 1B3YA 2VCAA 5I6SA 1UZ4A 1G94A 2WVVA 3UETA 2GDUA 3SCSA 4OBRA 3BAJA 3ZM8A 2XWEA 3ALFA 3CGTA 1ISYA 1HKKA 2WANA 1Q6GA 2GVYA 2JF7A 7A3HA 1TUXA 3AYSA 2VI0A 4V28A 3MUZ1 2EPKX 2D3LA 5M17A 1QI5A 1UWTA 1E6RA 2DSZA 3MUAA 1W9VA 4UNIA 5ABGA 3WFZA 3RM4A 3FXYA 1M7XA 2VQUA 4MDOA 4GIAA 4TUFA 5C70A 3VU2A 1VRXA 2NT1A 3N12A 3T0AA 4JHZA 3PZIA 4Z2HA 1ISVA 1E1FA 3HU7A 4XV0A 1U2YA 2QMKA 3L4ZA 1FP9A 3WNNA 5A8MA 4Q22A 4P7QA 4NRSA 3OZPA 4D1IA 2WB5A 2D22A 3BAXA 3GXMA 3UERA 2WMFA 4D71A 4LXFA 1UWSA 2XGBA 3AICA 3IJ9A 1PBGA 5CLTA 1WDSA 4AZCA 1AQMA 3W4RA 1C7SA 2VRQA 2A3AA 3EDJA 3RCNA 1QI2A 2VQTA 3VIOA 5FCZA 5IFTA 4P8VA 1FHDA 3FHAA 1GVYA 4BQ3A 2WCSA 1H2JA 1H0IA 4ACZB 1G01A 3MV01 1JF5A 3VMOA 3N1AA 4W85A 5BXPA 3ZOAA 1W1PA 2WZIA 1C7TA 1OD0A 2XIBA 4AEFA 3GZAA 2XHYA 4PCSA 4UFKA 4CU8A 4DWSA 2J75A 2G3MA 3UR7A 1VFMA 1HJXA 4UFHA 1HP5A 1B30A 1FA2A 3L4YA 4CGTA 1BLIA 3AZRA 3DHUA 3LPGA 2WC4A 3FNDA 1RH9A 1JFXA 1EQCA 3SUVA 2WMGA 4W7WA 1V3MA 1OGSA 3UCQA 3WBEA 4AZ6A 1I75A 3F4VA 3WH8A 4L4OA 1JDDA 4M24A 3QOKA 4RE3A 2ZXDA 3LMYA 1JG9A 4HMEA 1UH2A 2D1ZA 3WQ6A 4GI9A 5BXTA 1QNOA 5HDRA 1CGXA 2WVUA 2OWCA 4PMUA 2QPUA 5HOSA 3SCNA 3VDCA 2VZVA 5D9NA 2OYLA 3FAWA 1DWIM 1BSIA 2J25A 1M03A 2WWCA 4KGJA 2WBGA 4OZOA 4CUCA 4AD1A 4PMVA 1E9LA 4XB3A 3WD4A 1JZ4A 3KE0A 2PWDA 3CTTA 5HPOA 2J47A 3MMWA 2DT3A 2XM2A 3B8SA 3ARXA 2CERA 4W8AA 4MJ4A 3BH4A 2BFGA 4W5ZA 1XYZA 1E6SM 2JEQA 1H41A 4AZIA 2FDMA 5CGMA 3SCQA 3OLIA 4PSPA 4PTMA 2BY3A 1FFRA 1XC6A 2ZUTA 1VAHA 1UR1A 2QHAA 3VM5A 3T2PA 1GJUA 1VJSA 4W84A 3MSDA 2QLYA 3WF2A 1NP0A 2J8GA 3NSNA 1OB0A 2PF0A 1C90A 3CHEA 3VNZA 1Q6CA 1JI1A 3SUSA 1OINA 1JZ7A 3ZJ7A 2WKLA 3WIJA 1BPLB 1CPUA 4D6JA 1UA7A 2EPLX 1QBAA 2WSPA 3I3EA 4QAWA 4J3TA 1R7OA 1W1TA 3L2LA 2V5DA 3VIMA 4LYRA 4GZJA 4DWSC 4DUVA 1JAEA 1DTUA 3S6TA 1MQQA 3WBAA 1UD8A 4CD8A 4LYPA 3B9DA 1JXKA 1UWRA 3OA5A 1FFQA 4CCCA 2ZWZA 1KR1A 5EFDA 1JXJA 5I2UA 4WKHA 5GNXA 4F66A 1CZ1A 2ZUWA 2BXYA 1E71M 1W9BM 3N17A 3WN6A 1UKQA 1UR4A 5A8NA 3WQWA 4WK9A 2HISA 4GKLA 1ECEA 5HPCA 4W7VA 2PBOA 3ARVA 3CZLA 1XV8A 4UQCA 4Z2LA 4GI6A 3WDHA 3WF4A 3GDBA 2Q8XA 1B2YA 5BCAA 1E5NA 3II1A 3BLPX 1NWTA 3AIRA 1CEOA 4H8HA 2CKRA 4AZ7A 1XGZA 1TZ7A 1QHOA 2WHJA 1Q6FA 5AY7A 2BVYA 1CGVA 5A6BA 3CH9A 2YA0A 3WQ5A 2YLAA 3EMQA 1MXDA 2YL6A 3CPUA 1UR2A 2VZTA 3KEHA 3PTMA 1ZL1A 3KL0A 3VINA 1R7AA 1PZ3A 3D5HA 1P6WA 3BAYA 1HL9A 2WZEA 2DT2A 4H7VA 1UKSA 2AMGA 5AC5A 5CLWA 4MNLA 1XYFA 1L8NA 4IUGA 2V3EA 4OUEA 3CIVA 1EDGA 4D6GA 3WDIA 4H2CA 3ARWA 2W61A 1JNEA 3ARPA 1JZ2A 3WUFA 2CBJA 1CYGA 4C7DA 3WEZA 4PMZA 2VO5A 4D6HA 1BAGA 3VGGA 1V6UA 1GOMA 1E0WA 3AS1A 2EBNA 1J0KA 2JFEX 2OYKA 2WSKA 1CXLA 4D6CA 5HXMA 1ITCA 3IANA 7TAAA 4J3VA 4JIEA 1CGTA 1TMQA 2PC8A 2G3NA 4EKJA 1GZJA 1E5JA 1KQZA 2J7EA 4WKAA 3TP4A 5JBDA 3CHDA 2BHZA 1SMAA 1ZB5A 2QF8A 3VIHA 2FHFA 1JZ8A 1VBUA 4CVWA 3MANA 1MWOA 1E55A 2VZSA 4WSJA 1QI3A 1S46A 5EFFA 1H49A 2ZX9A 1VBRA 1B90A 1UUQA 3SCTA 4UTFA 1UR9A 4W88A 3U7BA 4Z2KA 5E6YA 1KXVA 4ZXLA 1X1NA 2BV9A 4HOWA 1ISXA 4WJXA 1QI4A 4AWEA 4JFVA 1K9TA 4N0RA 1VEMA 1W1VA 3PZMA 2YJQA 2E0PA 1K6AA 3O6AA 2BY0A 1E6XM 4UQ9A 5JBFA 2VUYA 3CHCA 3ALGA 2CXGA 2VT0A 1UKTA 3UG4A 1HJUA 3PN8A 4PMQA 4MNMA 5I0DA 3SEPA 3K8LA 1US2A 3BCFA 4OOZA 2W92A 4PSRA 3RDKA 1D3CA 1DWJM 3CZGA 5DEZA 3AHVA 3U5YA 3CZJA 3VD4A 1HVQA 2A3BA 2JE8A 3W38A 1GJWA 5CQ1A 1ISWA 3UR8A 2FH8A 4B3LA 3W25A 2WW5A 1XSJA 3GTNA 3SCVA 5TD4A 2D24A 3CUFA 1ESWA 1V3IA 2MANA 1R8LA 3T2QA 2VZOA 1CTNA 2FHBA 2WCGA 4JKKA 3WF0A 3EDKA 3J7HA 1NH6A 3UESA 3WQVA 4UFIA 1BYCA 3QOMA 1W9XA 3ZT6A 2YOCA 1CENA 4FMVA 1E15A 4Z2GA 4KGLA 4YHGA 4CN1A 1WP6A 3MUY1 1GQLA 3PZOA 1CXFA 4FLSA 1BYDA 3FHQA 4HZ6A 1GQKA 2ZUVA 2E9MA 2QPSA 2WKGA 2VRKA 1B9ZA 1GOQA 4P8UA 1E43A 3ZJ6A 2J79A 4CN4A 5FL0A 3LPFA 4W86A 3WH9A 3AS3A 5IFPA 2GK1B 3G6LA 2GJXB 2XUCA 1EO7A 2GK1A 1V3HA 1JGIA 1GHSA 4NI3A 2TAAA 5BROA 4PCTA 1B31A 1UWUA 2PI6A 5E09A 4P8XA 1OT1A 1K9FA 4F79A 1KCKA 1LJYA 1LL7A 3KL5A 3NSMA 4E4PA 3LPOA 1C3FA 5D8WA 4AZBA 2VVNA 3GXFA 3WSUA 2XG9A 5I5RA 3OLDA 3GXDA 4LGXA 5GPRA 1JI2A 3OZOA 4DM2A 3W6MA 1XHGA 4AIUA 1O7AA 5CJ5A 1W9UA 1M53A 1W3HA 2E9LA 3IJ7A 4RE4A 1C93A 2B31A 5A1AA 2JIEA 1KR0A 3ARTA 2WNWA 1JZ6A 3TTQA 4U3CA 2VCBA 1Q6EA 2V3FA 3TTOA 1GPFA 3VD3A 2IUZA 3OGRA 1WPCA 3SUUA 1JF6A 1WKYA 1UKPA 4A4AA 4MB3A 4W5UA 1R85A 3CUHA 3AMLA 4U33A 4MJ2A 2J7FA 3VGBA 3GNPA 1GQIA 3KZSA 3M6DA 1UZ1A 1H0GA 4JKMA 7CGTA 1FOBA 4X0NA 3VO0A 8CGTA 1DP0A 1K9EA 3A47A 2D20A 1BGGA 2FH6A 3N13A 3WD2A 3PZTA 3ZO9A 4C7GA 1CXHA 3SIMA 4ZXOA 1V08A 3AZSA 1BHGA 1BVZA 1SMDA 5F7UA 4U2ZA 3VDAA 4PMXA 4AYSA 1PIFA 1VEPA 1RPKA 2VTFA 2YDSA 4BQ4A 3GNOA 3AIEA 4AW7A 4MDPA 2W67A 2E9BA 3IAPA 4QP0A 5A8QA 3ECQA 2YDQA 3CHFA 3NUKA 2D0GA 4PUDA 3ZMRA 4QCFA 4GZIA 4LPCA 4X0VA 3NYDA 1DWHM 2ZXBA 5JBEA 2EEXA 3O9NA 2XVKA 5I23A 2YA2A 4JL2A 4ATWA 1B3XA 6A3HA 2RGLA 3VD9A 1DWAM 1EA9C 1EHAA 2VZUA 2D2OA 4M8UA 3VDBA 4JCLA 2CBVA 2VX5A 5C8BB 4QDMA 1CECA 2CEQA 4P8WA 1V0MA 2CESA 4XZBA 5CPTA 1V6XA 1V02A 2JALA 1ZBCA 4ACZA 5LYRA 5BRPA 2YIHA 1N82A 1EOKA 5A8PA 4UR9A 1UH4A 4ACYA 4A3HA 3WF3A 3RM9A 4FK9A 2ZICA 4J3UA 2WC3A 4KMQA 1U30A 3HJEA 3CO4A 5D4YA 3CUIA 3K8MA 4X9YA 1FH8A 3GH7A 1E4IA 1C91A 1NQ6A 4M82A 2VR5A 3DHPA 1E56A 3W24A 3U7VA 4TTUA 4CD6A 3BLKA 5A6BD 4HOZA 2ZUUA 1ISZA 2BVDA 3BXWA 2XVGA 4M29A 1ZS2A 1VFUA 5D8ZA 3WENA 4XZWA 3SCRA 5JUVA 2Y4SA 1F4AA 3AHZA 1CBGA 1GONA 1GNXA 3AIWA 1OWQA 4AZGA 3T09A 4PTVA 1BQCA 1HKJA 2QV4A 4H8UA 4D6FA 3W82A 3ZSTA 1UD5A 4HP5A 4CCDA 1WDRA 3UG3A 4KRTA 1CNVA 2EPNA 4BF7A 2G4FA 1LG1A 4B9YA 4B16A 3UEQA 1WO2A 4PMNA 4PMRA 2IXUA 1J0JA 2DH2A 1MQRA 4UFLA 4AD0A 3WDPP 2BY2A 1E4NA 1F4HA 3NIYA 1KFWA 3PZUA 2ZUSA 4MADA 5I78A 1J12A 1TG7A 2PB1A 3VIGA 2G3IA 3BMVA 1E3XA 2G41A 1BFNA 2OSXA 3PTQA 1WZLA 1X6NA 1HJWA 1QVBA 4CKQA 3BSHA 5M3WA 5HBFA 4JKLA 4V2XA 4J3SA 5LA0A 1H09A 1OIMA 1R86A 1KXHA 3U57A 3O2LA 2O92A 1GUVA 3WDRA 3CZ8A 4D72A 3HN3A 3MUIA 1IV8A 3WDQA 1DWFM 1XRVA 3TTSA 2V5CA 3T0BA 2CITA 1EDQA 3VM7A 1ZBKA 2DSUA 3B9AA 4AD4A 1C8YA 2YL9A 4ML4A 3EDEA 1HVXA 4MB1A 1E6PA 4NRRA 3K46A 1VFFA 4QLKA 4TVCA 2WMIB 2ZOXA 4W89A 1V0KA 3AYRA 2WM0A 2WMIA 2XM1A 4KRUA 2AAAA 4F9JA 5ECUA 1BG9A 1GOWA 1V03A 3WKZA 9CGTA 5CSYA 1HP4A 1EHNA 1BYAA 2NSXA 1NWRA 1GOOA 4KWUA 1QNPA 4PMOA 1OM0A 2J8FA 5EMYA 3AFBA 3N11A 3GYCA 1NWSA 2ZUNA 2DPEA 1MYRA 3JUGA 1JYWA 3VDHA 3AHXA 2EJ1A 2J7DA 3AS2A 2DT1A 3BAWA 3PTKA 3EMCA 1JDCA 4AY1A 4B9ZA 1HIZA 1PX4A 2D23A 1XH1A 5A3HA 1SR0A 4J3WA 5DFAA 1C8QA 4AMCA 1GQJA 3WH5A 1UD6A 1WZAA 3W37A 3GNRA 4CD4A 2ZIDA 1CGYA 3SCOA 4U2YA 5CGTA 1E6QM 1NWUA 2VOTA 3MSGA 3AI0A 2CHNA 2YBTA 3CZEA 3WF1A 1J11A 2IXVA 3ZT5A 3N15A 5DT7A 1EGZA 2VURA 2VJXA 2A3CA 2YL5A 1TVPA 4PEEA 3CBWA 4GXPA 2GSJA 4OJYA 3WH6A 1UKOA 1LLOA 6CGTA 4NF7A 1QHZA 2YA1A 2VL4A 2PWHA 2PBGA 1DEDA 2VR4A 4U5KA 1BGAA 1OGGA 2UY3A 2G8ZA 4XUYA 5E6ZA 2W62A 5GNZA 3L2MA 1RP9A 2YKKA 4S3JA 2A3HA 3WEOA 1HNYA 4OBSA 1HF6A 1V02E 5GNYA 3ZIZA 1G1YA 2V3DA 3AIBA 4TX6A 2WVTA 1MFVA 4EE9A 4AXNA 4W7UA 1GW1A 5D9OA 5A6KA 2XIIA 4E8CA 3MU7A 4HMDA 1UD4A 3L4TA 4UFJA 4MB5A 5IXEA 4JFTA 3N04A 2VX7A 3G6MA 2UY4A 2DSKA 2WC7A 1VFOA 2AOSA 2UY2A 5DMYA 5CXPA 1L0PA 1ZU8A 2OWXA 2YBUA 2ZXAA 3A4XA 3VGFA 2W5FA 5E0FA 1BVNP 5LA2A 2CNCA 1PX8A 2Z1SA 4HPHA 5EBAA 1XD1A 1HJSA 1IZKA 4J28A 5CPQA 3T2OA 1A3HA 3RIKA 1MW3A 3F5LA 3D3AA 2WMJA 4UCFA 1NOWA 2X8RA 4GI8A 1H5VA 1J10A 4E2OA 4BZYA 4JFUA 5JIPA 1NOUA 3BGAA 4C7FA 5AC4A 1TVNA 1US3A 5FKYA 1VJZA 1JDAA 2DIJA 1AMYA 5I3DA 3AJ7A 2CIPA 1MXGA 1Y7VA 2J74A 4IPNB 3NDZA 2E8YA 2VC9A 4PUEA 4RL3A 3W26A 3MKKA 4PMDA 4UOJA 4P7OA 1HJVA 5EB8A 3L4XA 2JF6A 4TXEA 2DEPA 5BWFA 2HVMA 5A6AA 5CPSA 5LA1A 1NP2A 1XSIA 1JZ3A 2F61A 1CLVA 1UQZA 1W9DM 2XGIA 1KGXA 2O9OA
chains in the Genus database with same CATH superfamily
1K8YA 1PCKA 1QOPA 3IUDA 1SSGA 3MSRA 1RBAA 3CAKA 3GNXA 4EXBA 1W2VA 4TVUA 5A2AA 3KRUA 3V1HA 4D1JA 1OBAA 2YXOA 1FCUA 1V3KA 3NCOA 4LYQA 4G7FA 4NJJA 1D9EA 1OCBA 4HA0A 4DM1A 4WDWA 1XFCA 1CWYA 1RD5A 3QSRA 1QPNA 1Z3NA 2YR1A 1ME8A 3GX9A 3IJ6A 2ZTJA 4PBGA 2J7GA 2Y8KA 3L65A 3OU8A 1IZJA 4FX7A 2DGAA 3QPZA 1PB0A 3DN5A 3VKAA 3DFPA 1OADA 4C90A 3PS7A 4HSNA 2QAFA 4F3HA 5EMJA 1VH7A 4EXAA 4RDZA 4DYJA 3V3WA 3HPSA 1OFPA 3NO3A 5F2MA 3S2NA 4I3GA 5GHRB 2ZA2A 3AMCA 3TNBA 3HV9A 1OK6A 1QWGA 1EJSC 3AIVA 4HA3A 1Q66A 4UTWC 1PX3A 5AHFA 3SJ3A 3UYIA 2QMJA 2UWFA 2OOFA 4L4PA 4P7NA 4AC1X 5KEZA 2DZWA 4GNJA 2V5JA 2X30A 4NHVA 2VEMA 4JFSA 2OT1A 3MHUA 4KEMA 1CXKA 2XTKA 3AHYA 4ZOBA 4L6OA 4CD7A 3AMGA 5A2BA 6PTDA 3VA8A 1DJZA 3LOTA 5LIKX 4MB4A 2OX1A 3B03A 3UXKA 1ODZA 1R3YA 3R2GA 5FF3A 5BW6A 5HQMA 4F2UA 1OFQA 1EUAA 3S46A 4AHQA 2B81A 3STGA 3LS9A 2Y63A 1UYQA 4NU7A 3M47A 1E70M 3VOIA 1FWFC 5D2YA 8XIAA 2G3FA 4KWSA 1FQ0A 2PA6A 4E5TA 3PWAA 1J9YA 4M80A 2ZE0A 1YQ2A 4UQEA 3MB9A 1TCDA 1W3JA 1EQPA 4GO9A 1TYGA 2EG7A 4TU1A 4DEFA 1B3WA 3E12A 4Y7EA 1GTHA 4OIFA 4OQVA 2J24A 4BKNA 2W4XA 4PMYA 3QZEA 2DVXA 3AYVA 1F76A 1XLGA 1IT7A 3FDKA 3L4UA 4LC8A 1SUXA 2NLYA 5HQLA 1PZ2A 2XIOA 2V38A 5REQB 2D73A 3I6EA 4GE8A 3GBDA 4AZCB 1XR2A 3MVTA 4JFWA 2JIWA 1OABA 3F2BA 4BJHA 1DORA 4IQDA 2O9RA 4JTEA 3UA4A 1L6SA 4IPPA 4TTGA 1DHKA 3CUJA 3FY1A 2QVHA 4XQ6A 3BJTA 2HZGA 1IR1A 3S6OA 4ZGYA 1TRIA 5MF5A 4Z1CA 3BAIA 5E9XA 5FF2A 4GQQA 1VP5A 1Q4NX 3K1DA 5ENLA 2QUTA 2XZ7A 7XIMA 3MMUA 2PE4A 7ODCA 1UWIA 2WLZA 3USBA 5DLCA 2VOMA 4H04A 2BY1A 3BLFA 4DUXA 4EPEC 2XVNA 2VC5A 2QAPA 3F4DA 3IIXA 3VGDA 4NXKA 3P62A 2BP1A 4EIVA 2WHKA 1AZ1A 2J9YA 1GYNA 2OELA 4GZ7A 3C56A 3G22A 5FEPA 1ZJBA 1DJHA 3P80A 1KCLA 4XZHA 3A3HA 1YYAA 4J27A 4A3UA 1WDWA 3O15A 3TOPA 4Q8WA 1DXFA 2D0HA 2JEPA 4KEUA 4ZQNA 2PWFA 3IAQA 3R89A 1W3KA 3PF3A 3QHNA 3VOCA 1EWDA 3WNLA 1P7TA 3W27A 1LZOA 3VZXA 3R7MA 1GHRA 5HNUA 5HJLA 2Z0IA 3POHA 4QG9A 1E3ZA 5TBOA 2O4MA 3NQ6A 5A95A 1HL8A 4MGGA 1T96A 4XZNX 2P53A 1XRSA 3W28A 2JGQA 3WLLA 3E38A 3ZWTA 4JS3A 1AH0A 5U4NA 2YYTA 3LPQA 2E5DA 3NA8A 3RILA 4RKAA 2GFTA 2X1TA 3L2IA 4JBRA 4F8XA 2O7QA 1A5AA 1LRNA 4BEQA 3LCIA 1WZKA 2EJAA 3V5OA 1KFLA 1RCQA 3R0DA 4HZ7A 4YTSA 2PWVA 2EPOA 1QHPA 4MHBA 1NIUA 5FF7A 2P8BA 1FVPA 4GQRA 3UY7A 1JAKA 2X05A 4AF0B 4X9SA 3QHMA 4FLOA 3KS5A 4YXGA 4BS0A 2XVPA 4PUKA 4CEXC 3KRZA 4DLMA 2J88A 3U2ZA 4F2CA 2R91A 3D3FA 5XIMA 4MPKA 4C6DA 5FACA 4GBUA 4HYRA 1V3LA 3UZXA 4HK5A 3IJIA 1ZBVA 3RLUA 2SFPA 2BNJA 1EA0A 2ZVIA 3R0KA 1WE5A 3NDYA 3CU2A 2Z4GA 5EG5A 3SQSA 2XSAA 1JQVA 4DZIA 3M46A 1JCTA 4C6BA 1SPQA 2CYGA 1ZAIA 2WCAA 3DI1A 3C2EA 3WEMA 2VX6A 2WYSA 1R38A 3CV7A 2XYLA 3VNIA 1VCVA 3ZLGA 4XBSA 2XWDA 3IRSA 1A3WA 4AB4A 3STEA 3AMKA 4PRWA 3P14A 3K8KA 3GWQA 3ARSA 4W9TA 3AALA 4NXSA 1LM1A 1G0CA 2G97A 3VUPA 3NQ2A 1A0DA 3JZEA 1GWJA 2QJGA 3NQVA 1E4MM 1KB3A 1OFDA 1O1HA 2NLIA 3P0XA 4KCWA 1C29A 1UH3A 1LLZA 5FJIA 5AHEA 3N9KA 4M81A 4NSBA 1QW8A 1YRRA 5LNSA 3OPSA 2Q3OA 2QEZA 1CIUA 1UMYA 3LRKA 2Y89A 3SRDA 3UXLA 5FOOA 4K68A 4GXWA 5DXYA 4NZJA 4V27A 4G2DA 4ERGA 1JULA 3UXAA 2DVUA 1NM9A 1VLWA 4MTVA 2A6NA 1Q6LA 3I3BA 4O14A 5HULA 1DTNA 1H7OA 5DCDA 3OBAA 5FESA 4J7RA 3S0CA 3W1AA 2RDTA 4MIMA 2DU2A 2I7GA 3ABQA 4N02A 4HYVA 4TV5A 2R8WA 2NQHA 3TA9A 2ZWYA 4GZEA 3LERA 4G1KA 1GCYA 3PZQA 1VENA 2WMKA 3VD7A 4J40A 5C7VA 2GJRA 3BLOA 2FZNA 3VE7A 4Z1DA 3EX4A 4IPLA 1QPOA 3THDA 2X1SA 2X09A 1KBBA 1PXGA 3CM4A 3EEGA 4YN5A 2FJKA 4LUTA 3VMNA 1JD9A 2OKOA 3SZ8A 3GHSA 1CX9A 4LUJA 3HB9A 4U31A 3G77A 1FCQA 2J78A 2QCNA 3FCPA 2OLHA 3LLXA 5D2TA 3SAZA 4CNOA 3DG6A 2DJLA 2NW0A 1V6WA 3BAKA 1Y5VA 4YNGA 1B1YA 4OWGA 1IWPA 5AB3A 3H2NA 2HROA 1XGDA 3JW7A 3NSXA 1YE6A 3ARQA 4URIA 4GYPC 3VILA 1RP8A 2LLEA 1OCQA 1YDVA 3G1YA 1IIGA 5D9MA 2H6RA 1XBYA 3AHTA 1JNDA 4JQAA 1UHVA 4TR9A 1EP3A 3WUGA 2GVEA 1PAMA 4BA0A 4WKFA 1JYXA 4MAZA 2NQ5A 2FGZA 3HG2A 4NJHA 3UR5A 1NFBA 4YCOA 3F5KA 1KBIA 2EG6A 3QHOA 4D8ZA 4QFUA 4HPJA 4DWSD 4E0CA 3WLMA 4V1XA 3C0SA 4IISA 5LKYA 2PDFA 1YADA 4Q33A 1UP0A 2BMBA 3WNPA 2Q02A 3CNYA 1G5AA 1L6GA 5C71A 1US0A 3VIIA 1AJZA 2IQDA 5KITA 3W81A 1I8JA 1NOFA 2PWEA 3ARUA 4PODA 1EPVA 3L68A 2XVLA 3QMSA 4O4VA 4AISA 3LDVA 2ISWA 2C13A 2W63A 3QC3A 4OOUA 1J0ZA 2IKGA 3WFLA 4M1RA 2PTDA 3ICJA 4LY8A 2NQZA 1J5TA 1DXIA 3SY8A 5IDZA 1B3YA 4REQA 3ANWA 2WVVA 2V68A 4FOJA 2UBPC 3GKFA 3LRMA 1GG0A 1QR7A 4DF2A 1R2TA 4NZ3A 3WLRA 2A7PA 2GYIA 1XG4A 1J6OA 4GCAA 7A3HA 1JQXA 2E6FA 1MEWA 3N2XA 4NP7A 1XYBA 3MUAA 1UWTA 1E6RA 1VC4A 2C16A 2Y6ZA 2ISDA 5ABGA 4GVGA 3W22A 4MYXA 3H26A 2XIQA 4GJIA 3NEVA 4ZO9A 3TMQA 1MO0A 1M7XA 1UPMB 5I3HA 4GIAA 4TUFA 3XIMA 3VU2A 2H3DA 1R47A 1VRXA 3CAQA 3N12A 4MZYA 3PZIA 3B8UA 4F0SA 2O55A 1KM0A 3RGTA 4V1YA 1ISVA 1RALA 3HU7A 2W27A 2HXUA 4GH3A 3QW3A 4XV0A 1U2YA 1IXOA 3GB6A 3WJWA 4Q7BA 1T40A 4ZQCA 3NNTA 1V51A 1PO9A 4R7WA 4X2PA 2D22A 4RSRA 3I7SA 1GVQA 4L65A 1FTXA 4D71A 3CQKA 2PDCA 3AICA 2CLPA 4HSOA 3RCYA 1AQMA 1WYIA 4TV6A 3RCNA 4OTKA 4P8VA 1FHDA 3FHAA 3GUWA 4BQ3A 4ZO6A 2GSHA 4W85A 1UC4A 3RX3A 1OD0A 2VDHA 4AEFA 4WJ8A 4HQVA 4CU8A 4DWSA 2J75A 3GSMA 1K4HA 2FZBA 3S47A 4HJWA 3MZ2A 3KVMA 4I9JA 3L4YA 1L6FA 1BLIA 3RFAA 3AZRA 3DHUA 1XS2A 4H3DA 1I60A 4ERIA 3FNDA 1JFXA 3T8LA 4DBEA 3TEVA 1GKPA 4ILSA 4W7WA 3QGKC 2PPGA 4ADUA 3QKZA 1MEHA 3HURA 3H4XA 3ONCA 4M24A 1FWJC 3QOKA 4RE3A 5HNTA 3FFSA 1ZAHA 2WNZA 4GISA 3KBMA 3QV6A 5BXTA 3APYA 3GE7A 1H7RA 3NQEA 5HOSA 2BGSA 4JIRA 3VAVA 3CB8A 4ORIA 4DO6A 1BSIA 4JTSA 1M03A 4S3DA 3G1FA 4OZOA 4CUCA 4PMVA 4XB3A 2PZ0A 2B7QA 1EF3A 3EWXA 2BBFA 1OK4A 3CTTA 2I56A 3MMWA 2DT3A 2FGBA 4ZO7A 3ARXA 1TREA 3UWZA 2CERA 3L12A 4N9CA 3MVIA 1P0NA 1Y5XA 4Q6XA 4W5ZA 1XYZA 4DBWA 4IFOA 1E6SM 5FJOA 4K7YA 4M0XA 1AH4A 3TQVA 2OU4A 5CPMA 4PTMA 1FFRA 4AUBA 4IQEA 3VM5A 1IYXA 1ME7A 4UTLA 2F6UA 2XIJA 2FB3A 4L5ZA 1MZRA 2HMCA 1VJSA 4W84A 2QLYA 3HPXA 1NP0A 3NSNA 3QPYA 3CHEA 1Q6CA 4I5RA 4UMCA 3GNNA 4MFEA 4G6CA 4EP8C 1MRQA 3QBUA 1KV8A 4YYCA 4GNVA 4JX5A 3DFNA 1R7OA 2V2DA 5H8PA 3H12A 3LV6A 3N25A 3S5ZA 3S6TA 3PUGA 3WBAA 3N4EA 4GHRA 1R9ZA 4LYPA 1UWRA 3SQLA 2V30A 1YDOA 5EFDA 2X7WA 4R7OA 1SSDA 2ZUWA 2A21A 3UZYA 1E71M 3UGRA 3WN6A 4LOCA 1UR4A 2GZXA 3CO8A 3NZPA 6TIMA 3A5FA 3E2SA 1UUOA 4Z2LA 3WQCA 1EBHA 4H9VA 3WF4A 4YTQA 1B2YA 2PU0A 2VKZG 3KDNA 3UW6A 3W74A 4H8HA 8XIMA 3S1UA 1H63A 5HK4A 3V4BA 5FAGA 1FWHC 1XLCA 4AZ7A 1XGZA 1TZ7A 4TX9A 1TB3A 3EWBX 1H51A 2I9EA 1FHVA 2BVYA 2GUBA 5A6BA 3T4CA 2CLFA 2QS8A 1TWZA 2YL6A 4EX4A 2Z00A 4MZ8A 3SY5A 1ZL1A 2H90A 3BE7A 2H8XA 3M5XA 4PL2A 4LS0A 1P6WA 3TCEA 3W1XA 1M6JA 3B8TA 1EGVA 1TZ9A 2DT2A 4H7VA 4QJ5B 5AC5A 4PZVA 3G0SA 4CNTA 2FPYA 6ALDA 3OQEA 1GVEA 1EDGA 4D6GA 4H2CA 4RDVA 4L9YA 2W61A 4G7EA 1JZ2A 3M0HA 3WUFA 3MI2A 3UWWA 5CEWA 4D6HA 1GOMA 1O12A 2OYKA 2IQ0A 2PGFA 1Z69A 3W7MA 4RJEA 3F4NA 1W3TA 3EW0A 3IANA 3EKZA 7TAAA 4JIEA 4RPQA 3LBOA 4EKJA 3SQMA 1KQZA 4WKAA 4O12A 5JBDA 4IZGA 5C55A 3VNMA 3UZ5A 1SMAA 1ZB5A 3WK1A 2G37A 3R10A 3VIHA 2PDUA 3B3DA 4CQAA 1KM4A 5CC7A 1S46A 3N2BA 2NV1A 3WLTA 1BRLB 4Q4PA 3SCTA 1UR9A 2HSAA 1BRLA 3JU2A 4GD0A 1GQNA 3BG5A 4QS6A 5TNVA 3ABZA 4UMBA 3CQ0A 4LSBA 5MKGB 3VOGA 3P5ZA 4I90A 2R82A 1UOZA 3U0HA 1K9TA 1OX5A 4N0RA 4R34A 1W1VA 3GTIA 5MHBA 3PZMA 1NAL1 4HIBA 3ZFHA 1K6AA 3O6AA 2BY0A 1IXQA 5JBFA 3ALGA 2VT0A 3VNJA 1HJUA 5I0DA 4AYGA 3BO9A 2MNRA 2W92A 2I14A 3CL8A 1W6TA 1D3CA 4FX8A 4C1NB 4EPDC 3U5YA 3VOJA 1FKWA 3W7NA 3IS4A 1EKOA 3QW4B 4I7UA 1ISWA 3UR8A 1FCBA 3VOHA 4DO5A 1NFPA 4JTCA 3GVGA 4K8EA 4O1AA 1MDLA 1R8LA 1X7FA 2VZOA 3ME3A 1G4TA 2ACSA 1AQFA 1NH6A 2DUXA 2O56A 3UESA 3PG8A 1N8IA 4IWWA 4F2BA 2PCQA 3IJQA 1OEPA 3CASA 3M16A 1XIIA 4CN1A 3FHQA 4G56A 4EPKA 3LCWA 2ZUVA 4RUBA 3RLGA 1D7KA 1S5MA 2E9MA 3MUXA 2WKGA 2J6VA 1RVGA 4CN4A 3PJTA 4QE5A 4IJCA 3LPFA 3S4TA 3WH9A 3AS3A 5IFPA 2GK1B 2GJXB 4HBKA 2XUCA 4CNNA 5JH2A 5M1TA 2GK1A 4QSHA 1V3HA 4US5D 3LCXA 3L0NA 1GHSA 2Y88A 1OYAA 2I17A 3KTXA 4P8XA 3UYCA 1KCKA 4HSHA 3LPOA 2AGTA 2ALRA 4DXXA 4AY7A 4X61A 1M65A 2XG9A 3VCCA 1XCFA 1EJRC 3UPWA 3O0FA 3O7UA 3HZ3A 5BOEA 1M53A 2E9LA 3IJ7A 3DFHA 4RE4A 4US6A 3URAA 1I2RA 4MG4A 4KKXA 2PP3A 1R46A 1JZ6A 1J96A 1XIEA 1Q6EA 1A49A 2C14A 1UBPC 1WQ5A 4Y96A 3PJWA 5BZAA 2HV5A 3ZLHA 1ICQA 4OUIA 5T9BG 3WG6A 1EGMA 5DN1A 1KLYA 1LCOA 3FYYA 2NVCA 3S6DA 4U33A 2VEIA 3F2CA 1NFGA 4RW5A 2J7FA 1QT1A 1Z9AA 3SFKA 1GW9A 3M6DA 1UZ1A 2G96A 4FSDA 1FOBA 3WLJA 3URQA 1K9EA 3M5YA 1BGGA 4C7GA 4U28A 4NI8A 1V08A 3NWRA 1J4EA 1FXQA 3AZSA 4H4IA 1HQTA 3HIJA 4IIEA 2AKMA 4AYSA 1PIFA 1JGMA 4DJFC 1RPKA 2VTFA 2YDSA 3LUTA 4U10A 2IW0A 4QITA 2I57A 3IAPA 4EAYA 4HN8A 5AC8A 1VHNA 2YDQA 3EB3A 1ZJIA 4GRSA 1WKDA 1VCGA 1JEZA 3H7UA 5HA7A 4DHGA 4GZIA 2ZXBA 4K37A 3BW2A 1BD0A 3O9NA 2XVKA 3O06A 4CQBA 2YA2A 3W07A 4JL2A 1BXBA 1B3XA 4GLEA 1EHAA 2D2OA 4JCLA 5IBXA 2VX5A 5C8BB 4QDMA 3C2VA 1M3UA 1CECA 1XG3A 1EWEA 4P8WA 1GVFA 4XZBA 2V9DA 1VHCA 5CPTA 4YTTA 1JUKA 1ZBCA 5BRPA 1JUEA 1EOKA 3GVWA 4UR9A 3PP7A 3MZNA 4IMGA 4DJDD 1YBQA 1O95A 4UTJA 4KMQA 2Y85A 4C6FA 5D4YA 3K8MA 2YW3A 3T4WA 1HO4A 3GH7A 1A0CA 1NQ6A 4Q8UA 3DHPA 1MNSA 4US5A 4CD6A 5K2ZA 1SZFA 4LU0A 1ISZA 1DXEA 2P8CA 4M29A 1ZS2A 4FZIA 5D8ZA 5DBTA 4GK8A 3WENA 2VGFA 4E3TA 3W1NA 5JUVA 3M1ZA 4LV4A 1F4AA 4FPSA 3A9BA 2E5BA 2PDHA 1GONA 3JZUA 1GNXA 3AIWA 4AZGA 1DQUA 4GWEA 2BOFX 4A05A 1A5CA 1UP3A 3U9IA 1UD5A 5FSDC 4CCDA 1LTDA 4DLFA 2E7FA 3DHFA 3E3HA 3CMFA 4F48A 4H00A 4B16A 4L56A 2HXTA 4PMNA 4PMRA 2IXUA 4QISA 2DH2A 2FMOA 1N7KA 3NIYA 3W6YA 1KFWA 3IJLA 4MADA 5KZEA 1IQ8A 2PB1A 1OG6A 3VIGA 2G3IA 3DEQA 4K7VA 2HK1A 2R1PA 2OQLA 3PSWA 1WZLA 1HJWA 3S83A 3P6LA 4G9PA 5HBFA 4JKLA 4J3SA 1H09A 1OIMA 1R86A 4H2HA 1XLMA 4IHCA 2HE5A 1CLKA 3CWHA 1MDRA 1GUVA 2Z29A 4WQ6A 4KT2A 3ABSA 1TWIA 4PCFA 3CS2A 3M0YA 4JTLA 4N2YA 1XRVA 3TTSA 2VWSA 3QQ0A 1KM1A 4AIBA 2I5QA 4AD4A 5EMKA 2YL9A 4HYWA 4NRRA 1A5NC 4E2BA 2GL5A 4OECA 5C2XA 3KLLA 3AYRA 4LRTA 4S3AA 4XO6A 3VE9A 1S5TA 2AAAA 1EB3A 5ECUA 1BG9A 3W1TA 3WKZA 4BEUA 4DWDA 4IXHA 9CGTA 1BYAA 3G1RA 1QNPA 1OM0A 4O54A 4DAIA 5EMYA 3MI6A 3AFBA 3JUGA 2DPEA 3T1GA 4QE4A 1U1HA 1X8CA 2J7DA 2Q8ZA 3PTKA 3EMCA 2D23A 1JCMP 2CW6A 1X1OA 3ITGA 1RCXB 4O0QA 4E2DA 4DJDA 3WH5A 2OVLA 2OFJA 4FR6A 3GNRA 2ZIDA 1CGYA 1E6QM 3Q45A 1EJXC 2CHNA 2BB0A 3REEA 4XSMA 2A0NA 3K4WA 3S9IA 1J11A 1VYRA 2IXVA 3JVAA 1ONEA 1YTDA 3Q94A 1EGZA 4XISA 5DT7A 4AFYA 3F4WA 4IJRA 4C6JA 1QW7A 3AAMA 4K2SA 1DE6A 1I9CB 4PEEA 4O10A 1LLOA 4OV9A 3HGSA 4J2MA 3NQ7A 3NL5A 2UY3A 2G8ZA 1TX0A 5XIAA 2W62A 3L2MA 2YKKA 4S3BA 1LYXA 5CZJA 5FSEC 2AGKA 3PJXA 3PWIA 1V02E 2YYUA 1O66A 5DQPA 3ZIZA 5A5WA 2V3DA 2WVTA 3RHGA 4EE9A 3C0LA 1VFTA 2NSOA 3A5VA 3LX9A 5CJNA 5HR6A 5BMWA 5A6KA 3GFYA 2D2HA 1HGYA 4B92A 3C4UA 2E25A 1F3XA 3ITOA 1H1ZA 1UD4A 3L4TA 4AWSA 2CFFA 4AAJA 4AWTA 2VX7A 3GDRA 4GOAA 2OEKA 2UY4A 2DSKA 4IT1A 1MEIA 3G8EA 5CBJA 1P0DA 2X2GA 4JPGA 1RA5A 2R14A 1ZPTA 2YBUA 2EHHA 2HEJA 4LVBA 1UPPA 4NAEB 2QF7A 4FXJA 1UJQA 3TU9A 2PURA 5EBAA 3VKCA 1QO5A 3K2GA 4QX4A 3MJYA 3RIKA 1MW3A 3C3UA 4LCQA 3LTYA 1I2PA 1AL8A 1AH3A 1UZDA 3DGRA 4S3CA 2Y7EA 1XQKA 1J10A 4E2OA 3EAUA 4GYKA 5JIPA 1NOUA 4QDPA 3B4UA 1OG0A 4WDXA 5AC4A 1TVNA 1AMKA 1JDAA 2DIJA 4KERA 4RPPA 2Z1XA 3RX2A 3R6IA 2J74A 3DFOA 3EB2A 3NDZA 4XAFA 4RL3A 3EB4A 1YE4A 1UIPA 5EB8A 2WQPA 3A22A 4YYFA 4TXEA 5BWFA 4AY8A 5A6AA 5HMEA 1NP2A 2F61A 1EC9A 2GJLA 3QLDA 4UBPC 3P81A 1BWKA 5H8UA 5FIPA 4Y8EA 1RJQA 3MP3A 1YNQA 2GUYA 3N6QA 4DUWA 3FKRA 2OYMA 1CDGA 3FVDA 3V0SA 1IHIA 1M7PA 1ITQA 1KXTA 2HDJA 3HGOA 3RMEA 3DFYA 3ZJKA 1UB3A 2D0FA 4H6KA 5JIWA 3S2JA 4JL1A 3KCJA 3RPDA 1C8VA 2YCLA 3SIZA 1AVAA 3ZJ8A 5HNNA 2AMXA 3CYJA 1TMHA 1VRDA 2XFWA 3OVPA 1VBHA 3PUDA 1WDPA 3VZZA 4B4FA 1KW1A 1PJ9A 1XDMA 4O1EA 1XDJA 3WMBA 1HGWA 2PTXA 4Q4OA 2HQAA 1H7WA 2VNCA 3RUBL 2PP1A 2BODX 3OVGA 4HPGA 4JY8A 1P0KA 5EPDA 1TWWA 3VGHA 4IIBA 4XAZA 4JYFA 4D6DA 4EWND 1F73A 3VD5A 5BXSA 2DFAA 2WQDA 3CIXA 1OGBA 1RLDA 3EYPA 1DOSA 1RK5A 3H7VA 3HA1A 3W86A 4H8NA 4RE2A 1OVDA 1RPXA 1IEXA 4F0MA 2CBUA 2V8ZA 1VIWA 2Y8VA 2PDPA 3E5BA 1WAWA 2VEGA 3MI3A 1LF1A 2A85A 2PGRA 3ZR4A 4H9YA 4C6CA 3EOUA 3R13A 1LQ2A 4J5NA 2HBAA 1GORA 1LBFA 3OO2A 5KZ6A 4Z17A 1XWYA 4NYUA 1CW2A 5EL1A 1C8XA 1DBTA 3CYVA 2PRMA 1XLIA 3GVVA 3DIPA 4WXYA 1UW9A 1PPIA 3OTRA 4R7JA 4ORMA 3LA4A 3BWWA 1DJGA 1JYNA 2GDQA 1GEQA 3KVJA 4NVTA 5DT5A 2NX3A 1VBJA 2X42A 4XZIA 4NIRA 3VIKA 4HK7A 2RGMA 3JR2A 4LNYA 5T91A 3E9AA 3RNDA 4GO8A 4NNBA 4I5UA 4JHOA 2D3NA 1GKRA 3W0KA 3REQB 4DYKA 3P74A 4JCMA 3B9EA 4RX0A 3N73A 4G5DA 1O68A 3REQA 1KQYA 2YB1A 3ANUA 3MT1A 1C92A 2BWGA 3B40A 3VGEA 1BQGA 2QH7A 5AYXA 1AQHA 1HKMA 4TOQA 1V6TA 1M68A 1YPFA 2QVNA 4IL2A 3SADA 3QR3A 3VMPA 1W9PA 1PL9A 1ODUA 3WMLA 1JD7A 3GH4A 4GQ0A 4IG2B 4V15A 5LGXA 3E0FA 2E5CA 2V2CA 4IG2A 1MFUA 2VELA 1TFVA 3BANA 3TN4A 1JYVA 3IUHA 4U3AA 2E1DA 2PC4A 5E9AA 3S9YA 5EMMA 5J5RA 4CNPA 1RJPA 2YSWA 3KOFA 1QPKA 4C91A 1CQUA 3GK0A 5TF0A 1IGSA 5KZDA 5IDIA 3VX1A 3VABA 1R9YA 2J9ZA 1EIXA 3TONA 4LBSA 3ZR5A 2C19A 1JCLA 1Z32X 2OSWA 4OOAA 1CB2A 2F2HA 1N2VA 4JICA 4B5VA 2CBIA 3DYMA 4CU6A 2QCMA 2Y24A 3DU0A 1RHCA 1LL4A 2VDGA 3IGSA 6REQB 3WYZA 3S3GA 4ZTYA 2ZDSA 3OGVA 1R2RA 3RU6A 6REQA 3NOYA 3QVQA 2Y70A 4MUZA 3QQ1A 3KW3A 1RD6A 4J2PA 4L4LA 2XFRA 1QK2A 4HA4A 1PS9A 3QTPA 3WD0A 5CSUA 2DIKA 1KRBC 1OT2A 4QRNA 5ABFB 4MNJA 3S1XA 3N9SA 1ZBWA 1IF2A 2RJGA 1ICSA 5ABFA 5CH9A 3DFSA 2CHOA 4C1LA 2A2IA 3AIUA 1BEUA 2V69A 1XH0A 2Z1KA 5B80A 3EWCA 5GJNA 1RQEA 3KL3A 1ITXA 4ZA0A 2ZZ3A 3QFEA 1FHUA 3I4EA 3W2UA 1YHTA 3D47A 1D8WA 2ZX7A 3GXTA 3RXZA 2Q8LA 5DCEA 5JQ9A 1W3IA 3RJXA 3PHAA 4XD3A 3AROA 3KCOA 3TSBA 1IEVA 3UP8A 4KW7A 5XINA 5BOFA 5K7JA 3RPTA 5A6LA 2QUUA 1UUMA 3K1GA 3W1QA 3CL7A 3STPA 1MXSA 3DYPA 5KTLA 4ZE5A 2XJ7A 2V82A 2BHYA 5FJUA 3TBOA 3CB3A 1XSKA 4PE8A 4AX7A 2ZYFA 4LVAA 3TTYA 3HQNA 1UC5A 3SFWA 3VPLA 1JR1A 3GTFA 3HMCA 3WY1A 2HBXA 2ABAA 3TW9A 1E1CB 3IVTA 4GCXA 4S1FA 4HOXA 1E1CA 3D6NA 3K4AA 4JZ5A 2HPMA 2GOKA 3APGA 3SCUA 4PL1A 4NILA 4CN6A 4HNCA 3T0TA 2FHCA 3WBWA 3HG3A 4XK2A 4BWLA 4N4PA 2QGHA 2ZCGA 1KBKA 2EPMX 5LNVA 5D09A 1HXJA 4J9JA 2VX4A 3R11A 1IR2A 3NZQA 4AEEA 2DDXA 4QQUA 5JU6A 3MO4A 5G2HA 2CZ5A 3VIJA 4FNTA 3MSYA 5C9ZA 4IFRA 2E40A 3KBSA 1T7LA 1ML1A 4FOUA 1S39A 2QJNA 4YTRA 4ZENA 3G1DA 1A47A 1KC7A 2V2HA 2NXIA 5CZKA 2WHLA 5E5CA 2PRHA 1OFAA 4ZOCA 1L2QA 2ZRXA 1H7PA 1O5KA 3LQGA 2G4JA 4XWUA 4XTIA 1QJWA 5C54A 3QTGA 3B0PA 3NQDA 3R12A 3PJUA 4FNQA 2CC0A 1Z41A 4F28A 1CB7B 4AIOA 1I1XA 4LT9A 4CU7A 3E1F1 1HX0A 1BF2A 5IHSA 1JPIA 5ABEA 2FJUB 2PS2A 1SGJA 5J5DA 4Y9PA 4JY9A 1ECQA 4DJDC 1R6WA 2CETA 3DXIA 2HTMA 1M7JA 1UQYA 3NL6A 1LORA 4NT0A 5G2WA 1U83A 3VX0A 1EZ2A 4GUJA 4WEVX 3T40A 2A6LA 4C5YA 1V3JA 3NAVA 3CV6A 4I7WA 2OUTA 5G1YA 3S1WA 5CBIA 2NV9A 3T08A 4IFKA 4KEVA 3FN9A 1CLXA 3N2MA 1AK5A 2Z6JA 1F61A 1QPRA 2GSEA 1Q65A 4DI9A 2V3GA 3GFZA 1A50A 4HJFA 4Q4QA 2DP3A 4EK7A 4PTWA 4EXQA 2YLLA 3LHTA 3FAXA 3LRLA 1K1DA 2WM1A 1M7OA 1H3GA 5I3FA 4WY0B 1XH2A 1FHLA 4PYSA 1E73M 4AD5A 1EF2A 1PKMA 3GNDA 4WY0A 1V6VA 3V0UA 5DY2A 4UQBA 4Z1YA 1XIJA 3OIHA 2ZVRA 1J6PA 1XYMA 3IK2A 3LCHA 1W3NA 3B05A 5BRQA 3A6OA 1KXQA 1S1PA 3M5VA 3RJYA 1OFOA 3R8HA 4A35A 3L4VA 3UVIA 1TPH1 1AJ0A 3T8QA 4DPPA 2QQ6A 5JH1A 4IGHA 3WK0A 1IT0A 1CCWB 2GJPA 4EANA 1FUYA 3L5MA 3LHYA 1Z44A 3K30A 4GGBA 1WZMA 1D8CA 5BYWA 1NARA 1J0YA 5A69A 3C2FA 1ZSXA 5G4WA 4ML9A 2ZUMA 4B5UA 5CG7A 2OT0A 2ISFA 4K8GA 4LUIA 3N9RA 1J0IA 2QW5A 3FJ4A 4HZ8A 2FKPA 3FJNA 1YXYA 2INZA 3T7VA 2DUZA 1U1UA 4IH3A 1OC6A 1FH9A 2NWRA 1VB9A 3RM8A 3WK3A 1KTBA 4YVVA 4MY1A 3THCA 3IV3A 1PYMA 4ZSUA 3W2NA 5I6SA 4S3GA 4XVDA 3BCJA 1XXXA 4DJEC 4LH8A 4RR4A 5D05A 1YNYA 1AW2A 4OBRA 5LIUX 3BAJA 3ZM8A 4H6EA 1HKKA 2WANA 4JTIA 4NL1A 4MPQA 2GVYA 2ALDA 1XJBA 2ZZ6A 1XF0A 2DZAA 2ADAA 2QCHA 3RM4A 2D2GA 3W7CA 3LN3A 2VQUA 1AFSA 2IMRA 3S2LA 4N7QA 1W1A1 4JHZA 3T0AA 3GW3A 4O18A 1XM3A 4ROQA 4JTUA 2GPTA 3M9YA 1S2WA 1BKHA 4X63A 1RBOB 2Z2UA 1M9HA 3GC2A 3WNNA 2Y62A 4Q22A 3ID7A 2JKEA 4P7QA 3SW6A 5FAJA 3O6YX 2WB5A 2PDXA 1UWSA 3ES8A 1PVNA 3IJ9A 1TJ2A 3QJAA 1PBGA 1UCWA 3CAVA 3QY7A 5CLTA 1POJA 3TVAA 1WDSA 2CLLA 4JNMA 1VFHA 4ERAA 4EACA 5FCZA 3IK4A 2QUVA 2RDXA 3ELFA 1JF5A 3PUEA 2QCEA 3N1AA 4Y9OA 1FDYA 3ZOAA 1W1PA 4JGDA 3SB0A 4KCVA 4YVPA 1RY8A 4KIEA 4WZHA 3C2RA 1ICPA 2XIBA 1K70A 4PCSA 4UFKA 3H22A 2V5BA 5D2WA 2G3MA 2BLEA 4P61A 3RR1A 4CGTA 1EEPA 4UR7A 3LPGA 2X1RA 4C6QA 1K8XA 3IIOA 3UZWA 2WMGA 1UBSA 1OGSA 1XIFA 1V77A 4AZ6A 1HFBA 4O0KA 2ZC8A 3F4VA 4L4OA 3B06A 4BY3A 4S2BA 5AHLA 3TX9A 2F7FA 3KS6A 1JG9A 3Q37A 5FEWA 1KTNA 2P76A 1LROA 4TQTA 1YX1A 3MYOA 2WVUA 2W6RA 4O1CA 2OWCA 4PMUA 6ENLA 4FR0A 4A8NA 3C5QA 3FA4A 3VDCA 5D9NA 1DWIM 3FAWA 3RLHA 3TWAA 2E1WA 2WBGA 1GK8A 1XP3A 3DC8A 4F0LA 1SW0A 1PYFA 2VR2A 1JZ4A 5HPOA 2XM2A 2PZNA 3LBMA 1TQXA 3IJDA 5CC5A 3GU9A 2VXNA 1PKNA 3LM3A 5LIWX 3R8RA 4HZMA 1H41A 4AZIA 3TJLA 4MJMA 2FDMA 3VZYA 3OEXA 2NVAA 1VFLA 2QJJA 1VAHA 2C71A 2X40A 3GU1A 1ZP4A 1UR1A 2QHAA 4S2CA 4JTAA 1XKYA 2CWXA 4Q8NA 3BARA 1DIKA 1OB0A 2OTDA 4I8YA 3PG9A 2PF0A 2FVKA 1ALDA 3FVMA 3OA3A 4JN6A 1JI1A 1OINA 4FEZA 3NR0A 4S39A 3WIJA 2DW6A 3VI2A 2PP0A 5C6MA 1VCFA 2JKPA 1UA7A 2EPLX 1ONWA 3I3EA 3T07A 1W31A 3TFXA 2WKJA 1W1TA 3FEMA 4LYRA 2Z7GA 1JAEA 4QNWA 3IIVA 2R1KA 1YDNA 1UD8A 1DQWA 2HVOA 3A3XA 1W56A 5G4HC 4JNZA 2ZWZA 1KR1A 4KS0A 5GJMA 5I2UA 1RJRA 4S23A 2CLHA 3W02A 3CAWA 3KWSA 3HV8A 1UKQA 5C9WA 4BF5A 3QQWA 5AOUA 2B0MA 1SFLA 2HISA 4RW3A 1ZZMA 2QNEA 1ZQ5A 1ECEA 2Z2AA 4ZB2A 3B4YA 3L23A 1K8CA 1XV8A 3CZLA 2Q6ZA 3WDHA 2PDWA 1PV8A 3TN5A 4NAFB 5BCAA 2VD9A 1P4CA 1VQTA 2FYMA 1NWTA 3DOPA 2Z7KA 3NXFA 4NAFA 1WUEA 3B0YA 4XAYA 3FX4A 3UCCA 2H8ZA 5AY7A 3F4CA 2QCDB 4RE0A 2YA0A 3WQ5A 5L6UA 2B4GA 5G1TA 1FXPA 2F9RA 1MXDA 1SM9A 3CPUA 3OZYA 4IX0A 1RBLA 3OODA 4IMCA 4GC4A 2DJXA 4GFIA 3PTMA 2E9XB 1B9BA 5C7HA 1C9WA 3D5HA 1HL9A 3I65A 1QOQA 1UKSA 2IQTA 5CLWA 3EPMA 1L8NA 4OUEA 3CIVA 3UXDA 4TMBA 3W7JA 3WDIA 4M3PA 1JNEA 3ARPA 4ZOAA 2E6AA 4C7DA 5DANA 1ZRQA 1EEXA 4JQ2A 4LUSB 4PMZA 4L80A 2DZBA 5LNRA 3O05A 1V6UA 3M0ZA 4LUSA 1E0WA 3M6YA 3T6CA 4QR6A 2WSKA 5HXMA 2W79A 3IGHX 2TRSA 3CPGA 5EU9A 2HE8A 2OO6A 1CGTA 4UTIA 3A9IA 3EX1A 2PC8A 3PNZA 5H1WA 5IOBA 1ZFJA 3TP4A 4H9ZA 3CHDA 3LV5A 4Q4KA 1HTIA 2QF8A 4OFCA 4H1ZA 4CVWA 3MANA 4WSJA 4C5ZA 1KFEA 1EC8A 1QI3A 2R1MA 5EFFA 1Q2RA 3NO5A 4R53A 1H49A 2ZX9A 1VBRA 5I09A 1Y0EA 4UTFA 3FIGA 4W88A 3U7BA 5U7SA 1EXBA 2C18A 4KPLA 5E6YA 2BOEX 2GGIA 2V5LA 3IPWA 3M44A 5EY5A 5HINA 4O13A 1Q6OA 2I16A 2XDFA 4MMWA 4AMAA 3IGUA 1LOQA 1K02A 1Z8AA 1L9WA 1XDLA 4FIQA 2E0PA 4Q8OA 1J2WA 5I3GA 4KWWA 3KAOA 4YLWA 4HU4A 2CXGA 1UKTA 1S1RA 4PCPA 4M6PA 4PMQA 3G24A 4MNMA 3SEPA 1TX2A 4BWLC 1DWJM 3AHVA 3VD4A 2A3BA 1GJWA 1GOXA 2ZZ4A 2FH8A 1F07A 3L67A 3GTHA 2XISA 4AG0A 3GTNA 1FY6A 4NKCA 4DNMA 3QM3A 4OHQA 3CUFA 2ZRZA 1A5OC 2VM8A 3NOEA 3ZXWA 3WQGA 1W5OA 2OO0A 4Q6JA 5FJRA 1BYCA 3OP2A 1BVWA 2YOCA 4Z2GA 1TV8A 4FXFA 4IUOA 3TH6A 4KGLA 4YHGA 4ZFCA 4CQ9A 1I2OA 3MUY1 1GQLA 2XINA 4HZ6A 3N2CA 4AEOA 1Q45A 3S1GA 1S5VA 2OPJA 4JTTA 4L6HA 2VRKA 2FZMA 5SWUA 1GOQA 3ZJ6A 5FL0A 1FBAA 4UTKA 4W86A 4KIRA 2NUYA 1NDVA 4MUPA 1EO7A 3ANVA 1AJ2A 2BGQA 4H6RA 4O17A 3GO2A 2TAAA 2ZRVA 3V18A 4FS9A 1UWUA 2PI6A 7PTDA 5E09A 3H8AA 1F6PA 1QWKA 2NVDA 4G1NA 3NSMA 1C3FA 5D8WA 3WSUA 1PSCA 3M0IA 2E09A 3L7RA 1JI2A 3GVRA 1XHGA 3W75A 1O7AA 1G4PA 1W9UA 4Q3MA 1W3HA 2YPIA 1NELA 1TQJA 3U2CA 1C93A 5A1AA 4WRHA 4U3CA 2FZDA 1OX6A 3AYTA 2IUZA 4FOKA 1WPCA 1XW8A 3NFUA 4A4AA 5CGQA 1P48A 1U5JA 4NX5A 3RRAA 3N4FA 1OZQA 1R85A 3CUHA 3AMLA 3APTA 4RZ4A 3TAKA 4MJ2A 3VGBA 3W84A 1L2UA 4JIQA 4C6NA 4O8RA 7CGTA 3KBJA 1DP0A 1EJWC 1NDWA 4XAGA 3TR2A 3U3HA 2FFCA 2FH6A 3RO6A 3PZTA 2OCZA 4ZXOA 3AWNA 5JVLA 1BVZA 1SMDA 1XIHA 2YX0A 3TLLA 3GNOA 3AIEA 4MDPA 4DY1A 5D38A 2WZMA 3ECQA 2GGHA 2EKCA 4M6UA 4WDTA 1ZUAX 3KTSA 1P1MA 1DWHM 1QK0A 4ROPA 5JBEA 3VFCA 2ZRUA 2RGLA 3VD9A 1DWAM 4FAMA 1EA9C 2VZUA 2HBVA 2R1NA 4I7VA 3G3DA 1QAPA 1C9DA 2CEQA 5AHMA 4LAUA 1LT8A 5DBUA 5ABTA 1R3RA 1V02A 2DZPA 3L0KA 3G8RA 3R94A 4ACZA 5LYRA 3VXGA 3P82A 5A8PA 1IXNA 7REQA 4ACYA 4A3HA 1KRMA 3WF3A 4GA8A 2DVTA 2Y0FA 1OC7A 3CUIA 4ICMA 1C91A 1AODA 1YIXA 4TTUA 1XIMA 3GLCA 2XVGA 3EOEA 3U8GA 2C15A 1VFUA 1LWIA 1RK6A 1Z89A 2PDIA 2RFGA 4IPJA 1W8GA 1CBGA 3G3MA 1OWQA 1BQCA 3R5EA 3DG3A 4H8UA 3RAOA 4DZAA 3UG3A 3DERA 1CNVA 2EPNA 4BF7A 4B9YA 1LG1A 4YWIA 1WO2A 2HCVA 5G5IA 2AL2A 1H5YA 3SM0A 1MQRA 1NU5A 3PBWA 4YIWA 4AD0A 1E4NA 3U2EA 4JN8A 1P7TB 1TG7A 1FWBC 1SU5A 3V35A 3E0LA 2G41A 3IVUA 1RR2A 1BFNA 2OSXA 4GIYA 3V5CA 1JUBA 3BSHA 3PBYA 2CLMA 5CZTA 2ZRWA 3HG4A 5G1MA 3O2LA 3WLIA 3WDRA 4WR3A 1I4NA 1M1BA 3QR1A 3MUIA 2PDQA 3V16A 5BOOA 4JX6A 5D2VA 2CITA 4AVFA 1UZHA 1NEYA 3VM7A 4S3EA 3OOQA 1C8YA 1G7VA 1L6WA 1HVXA 2PD5A 4O52A 1VFFA 4ALDA 2PDLA 2ZOXA 4W89A 1V0KA 3I7QA 1H1YA 2WM0A 1BF6A 3ITTA 2F6XA 4PBEA 4F9JA 1GOWA 4QGCA 4D8LA 3HFYA 1MUWA 5BRBA 2XIMA 4C1KA 3N11A 1PTDA 3LZ5A 1MYRA 2A7RA 3P60A 1SO4A 2NUWA 2EJ1A 1QASA 4UY8H 3ATZA 5H2ZA 1PX4A 3GZ3A 1TVLA 5HANA 4FR1A 4J3WA 2QCCA 1C8QA 3EWDA 1RLCL 4L6DA 3LSBA 3W37A 3NQGA 5I3IA 3CEUA 5DMNA 3N14A 1NWUA 3MSGA 2POZA 2YBTA 3WF1A 2VURA 2D2JA 2VJXA 1HO1A 4A8RA 3CQHA 4GXPA 3L21A 1KO0A 4OJYA 3ES7A 4PB5A 1P1XA 3VNDA 2VL4A 2PWHA 1OFBA 1DEDA 2VR4A 1ZTVA 4OBSA 1HF6A 2WJFA 3MBDA 4UTTA 2V5KA 1OHLA 3AIBA 1LLWA 3NVTA 3L5AA 4GH1A 3URNA 4AXNA 3B8IA 5D9OA 4L1GA 4UTUA 4GACA 2AQVA 4E8CA 2BZNA 3O0KA 4YVXA 5HMDA 2BDQA 3EOLA 2EKGA 3TC6A 4Q8TA 2NQ9A 5E0KA 3GY1A 1QMLA 2UY2A 3R8GA 5CXPA 4FF7A 3PULA 1ZU8A 4QHRA 1XL9A 2FPTA 3VGFA 2W5FA 4HNNA 3V36A 3M43A 3TC3A 1BVNP 2CNCA 4HPHA 1YDYA 1XD1A 1HJSA 4F0RA 4J28A 5EMUA 2PEVA 3MA8A 1NDZA 3S1VA 3BICA 1NOWA 2QD0A 1XUUA 4GI8A 4ICCX 4K1WA 4IPIA 2Z2BA 3QN3A 4BZYA 4UTWA 2C3ZA 2QV5A 4YCPA 4JQ1A 1US3A 3KOYA 2XZ9A 4DN1A 2WJDA 5AKQA 1AMYA 5I3DA 3AJ7A 1XLJA 4F2TA 2CIPA 1MXGA 2INEA 1KCXA 4IPNB 5LIXX 2E8YA 3EWUA 5EKYA 3EWWA 4UOJA 4P7OA 4PMJA 4Y90A 3DKLA 4MFDA 3RG6A 3VC6A 4LUTB 2HVMA 3N29A 2ON3A 5CPSA 4X3ZA 3WLPA 1XSIA 3FGCB 1CLVA 1DKWA 2XGIA 4FS8A 5DRIA 4LY4A 4KETA 1E1EA 5D33A 3FGCA 4OKDA 3E2RA 5I06A 3U6WA 3E6EA 3U2OA 4I9MA 2G5WA 1VEOA 5C5YA 1EJTC 4XZ9A 4MWAD 3PBGA 3GKAA 1TR1A 1E9IA 3BV4A 1OF8A 1XCWA 1TV3A 1WOBA 4RNIA 4WSKA 5D04C 1WXZA 2Y5JA 4TVDA 4FHAA 2J7BA 3HG5A 3T0DA 4LBRA 2XFYA 3CUGA 1WCGA 4UWMA 4IQJA 1PE1A 3FSTA 1W54A 3VKJA 1R2SA 5LHFA 1W32A 3F5JA 3C0QA 3WUBA 3TW6A 2CLKA 4GQBA 3PB0A 3V0TA 2WLYA 1KBLA 3T44A 4PA8A 4DBUA 3WJSA 2GJNA 2PTZA 2WHMA 3GXIA 3GRIA 4NJGA 3H2OA 1BWVA 2DSWA 3KUMA 1BTCA 4R88A 1CXIA 3GQYA 5F4WA 3LXCA 5DMMA 4LS2A 3W29A 3PB2A 1K8ZA 1F2JA 4YHEA 1GVIA 1KFJA 3DFQA 1LBMA 2CU0A 4N9DA 1IT8A 2PLMA 1TPEA 2UZ9A 1G9HA 1DHPA 1QUMA 1U33A 4B15A 3QLLA 3ERPA 4L1WA 3AXKA 4PTNA 3L9CA 1QNQA 1ZCCA 2QIWA 3T81A 3THQA 1IGWA 1VD6A 2VEFA 1FWCC 1J0HA 1V6YA 2GQAA 3P7YA 3WL0A 4I9AA 5AYIA 2BS9A 3UJFA 3S2CA 2ISVA 1OY0A 3VNYA 1FWDC 1XIGA 3GDMA 2GVJA 5DCBA 3M07A 1EZWA 4REQB 2W91A 2WVVB 3W1PA 2DZSA 5E70A 1JFHA 4P7LA 2QJIA 2OZ3A 1K6WA 2VEKA 4UZSA 1JIBA 4GI4A 5F4XA 2QCFA 3QFWA 2Q09A 3EKGA 1X1ZA 3BC9A 4GY0A 1B3ZA 3QZ6A 2QDEA 4YJ5A 3BUVA 5DX7A 3IACA 4HHHA 2WMHA 2A1YA 2WWDA 1ZCOA 5C0QA 2X2YA 3CXOA 1UD3A 1AW1A 4H41A 3F7JA 2WJEA 2X16A 5CCZA 3QV7A 2CPUA 4ADSA 4BCEA 4KESA 5C2GA 2QGYA 2EF9A 4EPBC 4QAIA 3WNOA 4ZZ9A 3CMJA 3GW0A 5C9XA 2V6AA 3FYPA 4MWAB 4A8LA 3BG9A 2EXOA 4LQ1A 4MWAA 1QNSA 3N3TA 2EG8A 4Z0SA 3BJFA 1Z42A 3LPPA 4MY9A 1E6ZA 1SFSA 1FWWA 1PIGA 2VFHA 3GIQA 1PKLA 4W8BA 4ATDA 3B8VA 1WKFA 3V5FA 3C3NA 3AISA 1A5BA 3ITVA 4FO4A 3NGJA 3EOOA 1LQ0A 3UNTA 1GYMA 3ARZA 4H8VA 2IKHA 2R6OA 9RUBA 3WZ0E 3OBKA 1QO2A 2R94A 1VBGA 2WK2A 5BXRA 2ZFAA 4DWSB 3BLEA 1XYLA 2DIEA 5GJPA 4W8LA 1XLKA 3DBNA 4PTXA 2C91A 1MVYA 3AIQA 4KEZA 1ZP3A 3FV9A 1UOKA 1LP6A 3E0VA 1W8SA 3ARYA 4L9XA 2X0YA 2ONEA 1FP8A 5CG0A 1E0XA 1WKEA 5J8LA 3GAYA 4RZ5A 4IOTA 1EXPA 3UWVA 1E72M 1TUFA 1EPXA 1QOXA 2QULA 1W91A 1I0DA 1EH9A 1R87A 3DESA 3WL1A 2BHUA 3I6RA 1LWHA 1LL6A 4QIUA 1NF7A 1HG3A 4QLLA 3SUTA 3P84A 3M41A 3RX4A 2PLKA 2ATMA 3EX2A 1K7XA 1B0IA 3LCFA 3PVFA 3TSDA 2E67A 1MW1A 2EAWA 1X6UA 2PDBA 3BW4A 4Z0JA 4UNLA 3MPGA 2ZXQA 3QSTA 3OVQA 4Z42C 1UROA 1FH7A 1XLFA 3RU8X 3BCDA 1YW1A 1M5WA 3KHDA 4O19A 2CCRA 2FDSA 2R9RA 3WQ8A 2ACRA 3WBXA 2RUSA 3SBFA 1MSSA 1BG4A 1CGWA 3W6LA 1P43A 3BMXA 3KOZA 3W85A 1SZGA 4DXVA 1JPDX 4QS5A 3VUSA 2NWSA 1JZ5A 1EDTA 2DZTA 1GOKA 3CTLA 3Q67A 5LGZA 3W1UA 2YDAA 1XBVA 4PRTA 2OZ8A 1HN1A 1FWNA 3FA5A 3H2AA 1VPYA 1I6NA 5AVNA 4B90A 3UQNA 1E40A 4LTSA 4M6VA 3TKFA 1KGWA 3T05A 4LUYA 1W37A 3LNMA 1DJWA 2NXGA 1Z7AA 3WQ4A 5FA5A 1AG1O 4YWSA 4QTGA 1ZY9A 3C0JA 3BTNA 4S3KA 1QBBA 4H6QA 2Y7GA 2YZRA 4AIEA 4M51A 3TR9A 3P2VA 2DQWA 3BK0A 4A21A 1QDSA 3NGFA 2Z1WA 5I3KA 2J4GA 3VKKA 1VFSA 4ZQOA 7TIMA 4AXKA 4GUFA 3GG7A 2QXWA 4QSFA 1R3QA 1O6IA 1Y65A 2RHGA 1PEZA 1TE1A 1U5HA 3OGSA 1W1IE 3LB0A 4POCA 1OSEA 4CNUA 1OIFA 4PFHA 4R85A 3RPMA 2XH7A 3M7SA 3NEHA 1ZAJA 5LXXA 3ZS4A 2C1HA 1G6CA 4L7ZA 1MW0A 4M6QA 4XKMA 1W1YA 1QNRA 1KKRA 4MAVA 2OEMA 4W87A 1PHQA 4KW2A 2ABBA 3B8WA 1WBJA 3CEPA 3P8IA 5AHIA 2ZADA 3VCNA 2A7NA 5CAHA 3WNKA 1AUSL 4CNSA 4JNYA 4B3KA 4P7RA 4XTDA 1KBJA 3GIYA 2YCIX 4JTQA 2C7FA 3IRDA 4XD4A 3LMZA 1K7FA 3EDDA 5A6MA 2HBBA 5A8OA 4Y6GA 1E0UA 1PIIA 3WNMA 4UUIA 1WXYA 4LX4A 4KRZA 1F6KA 4FF5A 3W7QA 2Y2WA 1B3VA 3W2LA 1BTMA 4AD3A 5F2LA 4G7EB 3W73A 3EMZA 3THUA 4M7TA 5DF0A 3AXIA 3N2TA 4UOZA 3CV1A 1XD0A 1PZ0A 2XFFA 5GHSC 2C6QA 3KHJA 3SCPA 3MBFA 3SN1A 3AXHA 3R79A 1O1ZA 2NX1A 1J93A 2ZTKA 3AUJA 3UD6A 1QW9A 1AZ2A 4F40A 1TELA 3ZR6A 3W72A 3NPVA 3MHFA 4GUHA 2PTWA 3QY8A 3EZ4A 3VVGA 1TE6A 1I1WA 1E0VA 2XN0A 1MQPA 4BI7A 4HTYA 1TJRA 4Z2IA 1LWJA 3IVSA 1K3UA 1DJIA 2HWGA 2PF8A 4FB7A 1M41A 4YPJA 3BL3A 1F9CA 2NT0A 1KWGA 1WB0A 4H9MA 3CLWA 2FZ8A 3KM8A 2DZUA 1H7XA 2CLEA 4WVXA 4QLJA 3UJSA 5M03A 3EEZA 3GBEA 5CAKA 1OC5A 3FNVA 4EAMA 1OFRA 2GVLA 2X7VA 2CKSA 3H70A 1NSJA 1ZENA 4XD5A 2OGJA 5F2IA 1JJKA 3GM8A 4HMCA 1SJDA 4H7ZA 2PDJA 3AO0A 4UQDA 4PUNA 2IS7A 4NZCA 1T6MA 3NJ3A 3LHUA 4WUIA 3O6DA 3ZT7A 2VFEA 4UTTC 3IJ8A 1PHWA 5CPOA 1HZYA 2QDDA 1RA0A 4PEKA 3AU6A 4TX8A 2E77A 2XPKA 3LNPA 4RLIA 2VFIA 3RO8A 3W7KA 2WPGA 2OZTA 2AKZA 3MHGA 3DC0A 3A4AA 3U5UA 4XSLA 1J01A 1H61A 4Q4SA 2INFA 2BX7A 1KRAC 4HNOA 1BYBA 5FEXA 1TA3B 3S5YA 2OOGA 4LALA 4CD5A 4J3XA 3Q58A 2Z1VA 5HATA 1TA3A 2PDYA 2PU1A 4UTHA 4MLJA 2PRLA 1FX6A 2HNHA 1ZJAA 2XGZA 3AQUA 3ZSSA 2Y1HA 2J62A 2J8TA 1H1NA 4GPNA 3MCOA 3MV11 3KWXA 3UU0A 3PZVA 4AZ5A 4F9DA 4BQ5A 3H2CA 2DZVA 3MMDA 5HR7A 1XCXA 4MLRA 2AQWA 5ABHA 1D2KA 4QNEA 4ZE4A 2X1IA 4DQWA 4AVOA 1U5VA 5T8GA 4CQDA 3PBUA 4N4QA 3W76A 3WD1A 4O1BA 2ZZ7A 1HJQA 4JHMA 3LHZA 5KZMA 1MI3A 1KM5A 3S9ZA 1G94A 2VD8A 4D8AA 3ABXA 4Y9NA 2QJMA 2ZZ1A 3RF9A 4A2RA 4UIOA 3MQTA 5LNUA 3UPBA 4TIMA 3MDWA 3ALFA 3CGTA 1ISYA 5LNWA 4IIHA 8TIMA 3LLFA 1S2AA 1TUXA 2A5HA 3AYSA 4V28A 2EPKX 2D3LA 5M17A 1QI5A 4UNIA 3R0UA 1THFD 3WFZA 4JTDA 1N8FA 3SSJA 1YKWA 5FJJA 4ZVJA 3QC0A 3KBWA 2NT1A 1F7BA 2Y7DA 4Z2HA 1IXPA 4HU3A 2QMKA 1JCYA 3L4ZA 1D3GA 4KWOA 1KKOA 5A8MA 3VNKA 4JEQA 4GYJA 3CLMA 2OGYA 3UY8A 4D1IA 3BAXA 3UERA 2WMFA 4LXFA 3TYUA 2FTPA 4HMNA 1VYPX 3IEBA 3BVJA 5REQA 4AZCA 3KX6A 4E2VA 1DL3A 3W4RA 2VGBA 1C7SA 5D37A 2VRQA 3A12A 2A3AA 3EDJA 1QI2A 2VQTA 3DH7A 1FKXA 1GVYA 4WD0A 2WCSA 1G01A 1VJIA 3DAQA 1GVSA 2TMDA 3MKVA 1DYSA 2WZIA 2OMAA 4JX4A 3B9NA 2B7PA 3PM6A 5KSWA 1YBQB 1OFEA 3GZAA 1V4YA 2XHYA 3KLKA 3WK2A 1OZMA 1VFMA 3EA3A 1HP5A 1B30A 1VIZA 1FA2A 3W1MA 5B7ZA 2C1IA 3VKDA 2WC4A 1RH9A 2YFNA 3SUVA 3VDGA 3NZ1A 1ZNNA 4WGXA 3WBEA 3IGXA 3W7EA 3VYLA 4QJ4B 2ZXDA 3LMYA 1R0MA 1UH2A 2D1ZA 3WQ6A 3HBLA 4MOZA 2ZC1A 3PUOA 5HUPA 1VGAA 1ZJHA 5A6TC 4AHPA 2CLIA 4I9TA 2QPUA 1P6BA 3SCNA 2VZVA 3C86A 4B5XA 3IWPA 2O4QA 5J04A 1OQFA 1FWAC 4PUMA 4BI6A 3N19B 4IMEA 2WWCA 3ITCA 4KGJA 3NM1A 2OKTA 2W3ZA 2CZEA 3WD4A 3HGJA 4DBDA 2Z26A 3STCA 4L4MA 1TKKA 1T41A 3H53A 3B8SA 3R25A 3BOLA 1Q8AA 1QPQA 3D0CA 4MJ4A 3QZAA 4IGNA 4ADTA 2BFGA 4MWAC 1XFBA 1TIWA 4EF8A 3H2FA 3L0GA 4ZB5A 3OLIA 2QCLA 5FF0A 2BY3A 4GMEA 3LCLA 3ITYA 4HHMA 3UR2A 1GJUA 3NQBA 3BG3A 3WF2A 2J8GA 2TPSA 1SR9A 2YB4A 1YTKA 1C90A 3NO1A 5EA9A 4DUOA 1DIEA 1V93A 1KM6A 3ZJ7A 1DIVA 2P1FA 3H54A 1BPLB 4D6JA 1X98A 3STFA 1QBAA 2WSPA 4QAWA 4J3TA 3L2LA 3PTDA 4AF0A 4KCTA