3CO4A

Crystal structure of a chitinase from bacteroides thetaiotaomicron
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
311
structure length
311
Chain Sequence
SLKVVIGYLALDDWEFESLFPTIEWKYLTHINASFARVKADGTLNINPVRKRIESVRETAHKHNVKILISLAKNSPGEFTTAINDPKARKELIQQIIAFTKEYKLDGFDIDYEEYDNWDKNFPSLLVFARGLYLAKEKNMLMTCAVNSRWLNYGTEWEQYFDYINLMSYDRGAFTDKPVQHASYDDFVKDLKYWNEQCRASKSKIVGGLPFYGYSWEESLQGAVDDVRGIRYSGILKHLGNEAADKDNIGKTYYNGRPTIANKCKFIKENDYAGVMIWQLFQDAHNDNYDLKLINVVGREMMEEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chitinase from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords Chitinase
total genus 110
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3co4A01
3.40.5.30 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 (Trans)glycosidases - domain 2 3co4A02
1ZBVA 3TONA 3K4DA 2WCSA 2HISA 3PZTA 5FKYA 3L4ZA 3OZPA 3WIJA 3IAPA 1KBKA 3EBVA 3VGGA 4LPCA 1UD3A 2CHOA 1U30A 1TUXA 2WBGA 3VPLA 3WNLA 4GQQA 5I6SA 3KE0A 2DH2A 5E70A 3CHEA 2VQTA 1V0MA 5D9PA 1B2YA 2OWXA 4XZWA 3AIQA 5LYRA 4NI3A 3WH6A 4PSPA 4PMNA 3O9NA 1V0NA 1KXHA 1WZLA 3LPGA 4CD8A 4H8UA 3I3EA 4AZCB 1RD6A 4B3LA 4E8CA 3ARPA 1QNQA 4YHEA 2G3IA 1HKKA 1UG6A 4PYSA 1B90A 3LPOA 1CGUA 1UR2A 3WBEA 3SUTA 4ML4A 2OWWA 6A3HA 1HXJA 3EYPA 1WPCA 2EEXA 2XVPA 3VX0A 2EPKX 4W7WA 5D4YA 3CO4A 3FHQA 1ZS2A 4IISA 4D1IA 4L4PA 4J3XA 3BAWA 1M04A 4BS0A 4U33A 2OSWA 1KCLA 3MUIA 3WQVA 5DT5A 1JZ6A 1CGVA 2Y2WA 3S6TA 1A47A 1EXPA 4H7VA 4IM4A 4E2OA 2BXYA 1W9BM 2J62A 1QNRA 5D9NA 3BAIA 2EPMX 4JFSA 2BVYA 4U31A 2ZX7A 1C8XA 2EPLX 4D6IA 1QNOA 2XFYA 3WKZA 1UKSA 1WP6A 3NJ3A 4PTWA 2V3EA 4HOXA 3UR8A 1EA9C 3RM4A 4UCFA 3ZMRA 1JAEA 1B31A 3VD5A 4UFJA 4CU7A 1KQYA 1W3KA 1MQPA 5I78A 3CUGA 1CXLA 2XFFA 4MAVA 2OSXA 5A6MA 1CWYA 1QI0A 3VD7A 1ISVA 1K9EA 7A3HA 3AS3A 5IFTA 3PZUA 5BXPA 2A3CA 1MVYA 4AIOA 1E4LA 1S46A 2BY0A 3BCDA 2PWGA 4X0NA 2YA2A 3CUJA 4CN6A 3OLGA 5I23A 3AI0A 3K8KA 5D9OA 4HPGA 3VIOA 3AXIA 3DHPA 1NOUA 4OZOA 4JZ5A 4C7FA 2J7BA 2XGIA 1LLOA 1WDPA 4W88A 3CUIA 2J75A 1FHLA 4DUVA 5A6LA 2D3LA 2GDVA 4HTYA 3WUBA 3L4VA 4RE3A 1L0PA 2A3BA 4AD0A 5M17A 4OBRA 3ZJ8A 1OINA 4CD5A 1KWGA 3VDCA 3ECQA 1E71M 1AMYA 2TAAA 2V38A 5E6YA 3CZLA 2VUYA 2WVUA 4KRUA 1W1VA 2DSZA 4NRRA 1Y7VA 2DT3A 3O6AA 3SCOA 1R7AA 1XSJA 3SCRA 3PBGA 3VGEA 3WF4A 3DC0A 2W5FA 2IXVA 2PB1A 4YN5A 1E6XM 5A2BA 2WSPA 3RCNA 1E56A 1UD6A 3W37A 2Q8XA 1WKYA 1KCKA 3SCWA 5EFFA 1DWAM 1H3GA 3SCVA 1O7AA 3GBEA 3WD1A 3AIEA 3OLEA 5DMYA 3FAWA 2WAGA 2X09A 4PBGA 3ARTA 3IJ8A 2WMHA 4F9JA 1BLIA 4J3WA 1QI2A 4HU0A 2YBTA 1XC6A 5FD0A 2ZX9A 4FMVA 3CUFA 1QHOA 5IFPA 2E8ZA 2E9BA 1KB3A 1HJQA 3UG4A 1BSIA 4AYSA 4P8XA 1W9UA 3PTKA 4KGLA 3MO4A 2BY1A 3WEMA 4D6CA 3WH5A 2XG9A 1UH2A 3CZ8A 3A4AA 4TXEA 2VRJA 3AHXA 3U7VA 5JBFA 1D2KA 3WD4A 1H2JA 1H41A 1FH8A 3AISA 4GIAA 3NDZA 4FLRA 2JEQA 3W82A 4CU8A 4MB1A 1RH9A 2FHBA 1K6AA 2D2OA 1W2PA 2CETA 4AD3A 4GPNA 2J7FA 5E0CA 3JUGA 1JD9A 2CITA 5ABGA 4TX6A 1CEOA 4KH2A 2ESCA 4TTUA 2YOCA 1PZ2A 1U33A 1W2VA 1CGTA 1RP9A 3WMBA 4MADA 5E0FA 4EK7A 2GUYA 2D1ZA 1CGWA 1V3MA 1W3HA 3AMGA 3WUEA 3BAJA 2YA1A 3F4VA 3WMCA 1WZAA 1MQQA 4AD5A 2O9TA 3OGSA 3AHTA 3A47A 2G41A 2XVKA 3N12A 4HMDA 5BXRA 4A4AA 3N1AA 1J9YA 5GNXA 1GONA 4GINA 1ISZA 2YJQA 4H04A 1W9PA 2BVDA 1VIWA 1W9VA 3J7HA 2JE8A 3N9KA 1QI5A 3AS2A 4MB3A 1GOWA 1K9TA 1OB0A 1EHNA 3CTTA 2YL9A 1CYGA 5CGTA 3L2MA 1FFRA 2WANA 2EBNA 3NDYA 1LL6A 3WUGA 1CLXA 4AZGA 1UR1A 1E5NA 3UESA 1EDTA 3ZJ7A 3WDHA 1G9HA 4JFTA 2G3MA 3AQUA 4DUXA 1TCMA 3WNPA 4EANA 1E43A 2ZX5A 1JG9A 1WZMA 1E9LA 4A3YA 1W1TA 2W66A 1QNSA 1JYXA 1I1XA 2YIHA 4PUDA 3OZOA 2VR4A 1MQRA 2V5DA 4CUCA 4J3VA 1OGBA 1HJXA 3ZOAA 3PN8A 3HMCA 3RMEA 4AZIA 4LGXA 2ZX8A 1ODUA 4UNIA 4W84A 4HA4A 2J7GA 1C91A 1XH0A 5JUVA 1XYZA 3AIUA 1MXGA 3GBDA 3AZRA 2V5CA 4UQ9A 5A95A 4HOZA 1TG7A 2WB5A 3BH4A 4U2ZA 1QHZA 3OLDA 1TE1A 3OGVA 3GNRA 2ZWZA 5HOSA 1M01A 1J18A 1OCQA 1HNYA 3KEHA 2UWFA 3PZIA 1OM0A 2JF6A 1UWIA 4PTVA 2OYKA 2EO7A 4LYQA 1H09A 1ZBCA 2Y8VA 4MB5A 3VIFA 3WQ4A 4Z2LA 5A6BD 1GHSA 4N0RA 4S3KA 4JKLA 5I5RA 1CECA 2EPNA 4AEEA 3I3BA 2BS9A 4PMDA 1F4AA 4AZ6A 1QW8A 1LL4A 4JL1A 5CSYA 5A94A 3UEQA 1JDAA 2WLZA 2DEPA 1MWOA 1J11A 1VBUA 5A6JA 5A2CA 1QPKA 4KWUA 2FDMA 5ABEA 1M7XA 1OGGA 4PMXA 4MJ2A 1E6PA 3POHA 1OWQA 2J77A 2V3FA 2VCCA 4PUEA 4J3SA 2J8FA 4UQDA 1BGAA 1KGXA 2WM0A 3SUUA 1UD8A 2YDRA 1X6LA 2WHJA 1HJUA 1E1FA 3T0AA 1DWFM 4Z2JA 1MFUA 1O6IA 3PHAA 3ZR6A 5CJ5A 1VB9A 2BXZA 1DTUA 1PBGA 3TTSA 1NQ6A 1SMDA 1UA7A 1BG4A 3AIRA 3AMLA 5A8QA 1EHAA 2WKGA 1C8YA 1JZ3A 3WDRA 2C7FA 4DM2A 5JIPA 3MMUA 1HP4A 4WKFA 1G01A 4J3UA 2DIEA 4UFHA 1L8NA 3WH8A 2BY2A 1R87A 1EQCA 3ALGA 5ABHA 3DYOA 1JF6A 4J28A 4PEEA 1OIFA 3WL0A 4HA1A 2PBGA 1H49A 2PWDA 2IUZA 1KXVA 2Z1SA 2WMFA 3NSXA 5A6AA 3KL5A 4YPJA 1XHGA 5BCAA 1V02E 3KZSA 1R7OA 1VFOA 1NM9A 1CXIA 4V2XA 1CXKA 4U5KA 4PMUA 1VEPA 3W24A 1CLVA 4UFLA 1CGXA 3SCUA 4JHZA 4MPKA 1GVIA 3WQ6A 3MV01 3AROA 3QHNA 3OA5A 1UZ1A 3WD0A 5I0DA 5IDIA 1AQHA 1DWHM 1KFWA 3U57A 1KGUA 3FY1A 3B9EA 3AHYA 3IJ9A 2YL6A 4E4PA 1UD5A 4P7NA 4WLCA 4UOJA 2W61A 1I75A 1KQZA 1W32A 4UR9A 1Q6GA 3SCQA 5DT7A 1HL9A 5EBAA 2WCGA 4AZCA 4TVCA 4NSBA 1J01A 4QDMA 1E0WA 5D8WA 2VJXA 3ZJ6A 5C71A 4CVWA 3BXWA 3T0DA 3O2LA 3GXMA 2ZUUA 4PSRA 3GNOA 3WMSA 1E5JA 4U2YA 3MUY1 4AZHA 2VC9A 4XB3A 5A2AA 3T2PA 1NOWA 3ARRA 4BQ4A 1VEMA 3SCNA 5DO8A 1QVBA 4Z2HA 2WC7A 2WZEA 5C8BB 3VIJA 2AOSA 2VRKA 5JBDA 5HPOA 1DWIM 4OJYA 1BPLB 4ZENA 2X2YA 1ISWA 3M7SA 2E40A 1M03A 2VURA 1R86A 4XUYA 4BCEA 3WD2A 4K68A 1HX0A 3GH4A 2F61A 1EH9A 2XVGA 3VIMA 3VIHA 3QOMA 4J27A 3DECA 4V27A 1AQ0A 3VX1A 1CZ1A 4OIFA 2A3HA 1E4IA 1C92A 4M8UA 1H11A 1XH2A 3QR3A 5FL0A 1JD7A 1GVYA 5A8NA 5CPTA 4IPLA 4Z2KA 3GDBA 1KBBA 4D6FA 1B9ZA 4W85A 2J7HA 2FHFA 2VT0A 1VJSA 3UR7A 3N18A 2DH3A 2XIBA 1W9DM 3N15A 3PTMA 5IXEA 1WB0A 2NW0A 5ABFB 1NWTA 3SUVA 1BYAA 4DWSC 3VDHA 1HVQA 1VAHA 5D9MA 1UR8A 1Q6EA 3AJ7A 4C7DA 1E73M 2PWEA 4AEFA 4ATWA 4UFKA 5GPRA 4D6DA 4JFVA 4QAWA 5AYBA 1WAWA 1E4MM 1I1WA 1GQIA 4M29A 3D5HA 5A1AA 3II1A 2J78A 2E9LA 3ZJKA 3GH7A 3VU2A 5JBEA 4E8DA 3WH7A 2WYSA 2ZXBA 2C0HA 2WSKA 1V3IA 2CNCA 4MNJA 3TOPA 2JF7A 3ZM8A 1E6NA 4PMZA 1OT2A 2C8NA 3KWXA 4NF7A 2OLHA 2CBIA 1TVNA 2O9RA 1MFVA 3WEZA 3OG2A 1HJWA 5DF0A 3W28A 2OSYA 1BVZA 2CKRA 4JKKA 5HXMA 5EB8A 2D3NA 4JL2A 4N42A 2VNCA 3WNMA 1JFHA 1W3JA 1HF6A 3MKKA 3VIIA 4UOQA 2J79A 4EE9A 4AWEA 1HN1A 1TVPA 3RIKA 3AIBA 1KGWA 3N13A 3IANA 3WNNA 4CN1A 3PZ9A 4JCMA 4KRTA 5I3DA 1VRXA 3A4WA 5KEZA 1PX3A 4QCFA 2BVTA 2QF8A 4C7GA 3T0BA 1SMAA 3CHFA 2D20A 1G94A 4ATLA 3MV11 2OYLA 3W6LA 1ZL1A 2W62A 1OSEA 1V0LA 4WSJA 1JDCA 1KR0A 2YKKA 1PX4A 3ZT5A 1LG1A 1QI3A 3W53A 1NWSA 1UH3A 3AFBA 4HU8A 3VGBA 1JXJA 4OOUA 1FP8A 2PBOA 3ARQA 2J7CA 3RILA 3QOKA 4TVUA 2JEPA 1J0ZA 1FH9A 1HIZA 4TOQA 4M56A 2XVNA 3ZSSA 4JFWA 6TAAA 5HBFA 3NSNA 2XFRA 1DHKA 1XYFA 3VUPA 5I77A 1HP5A 2NSXA 2VZUA 5DFAA 3VKKA 2DIJA 5M3WA 1VFMA 5FIPA 2W63A 2V3DA 3WF1A 1D3CA 4J3TA 2UY2A 3RJXA 2WNWA 1EOKA 2WBKA 5A8MA 3AZSA 4JHOA 4S3JA 1UWSA 2WHKA 1FP9A 2ZX6A 1JZ8A 2OYMA 2GJRA 1GUVA 1W1YA 5BXTA 2CBVA 3VOCA 2CCRA 1CXFA 2FGZA 4KMQA 1MW3A 2WZHA 2VX7A 1N82A 4B9ZA 2G8ZA 1XD0A 4CCDA 1E0VA 2RGLA 3W38A 5BXSA 2VR5A 4D6HA 1NWUA 3ARXA 3KL0A 1WNOA 1ITCA 3L4XA 3WQWA 3VIPA 3WUFA 2ZICA 2X0HA 2VL4A 4OBSA 5CLWA 3K8MA 2VX6A 3WD3A 1NWRA 4GO8A 2PWHA 4U3CA 4PCTA 1V6VA 4XX6A 1TR1A 1UWQA 5I24A 2A3AA 3QHMA 4CD6A 1GQJA 4RE4A 1JZ7A 1U2YA 2JIWA 3GZAA 1OD0A 1FFQA 1JYNA 5M03A 2W91A 2YDQA 2OWCA 4HZ7A 1LWHA 4RL3A 2RGMA 2ZUVA 1G1YA 1JF5A 3NUKA 3VMPA 3WNKA 3ZSTA 1GZJA 1DP0A 2J4GA 3N11A 2WC4A 4DUWA 3WEOA 4LYRA 1EDGA 1BGGA 1LJYA 2D22A 1V6WA 4W5UA 1UKTA 1UUQA 1M53A 3D3AA 5GNYA 1UWTA 3AS1A 2AAAA 3UERA 3W27A 4TX8A 2CBUA 2CHNA 1FH7A 1JYVA 4GQRA 3UETA 2VX5A 3BCFA 3QHOA 3A3HA 4LX4A 1ECEA 2NT0A 2WMKA 3EMZA 2GDUA 5D8ZA 4M81A 2WMIA 4D1JA 5A3HA 1DEDA 1BFNA 2WHLA 4UOZA 3W26A 3CHDA 2GVYA 2XYLA 1XSKA 4TTGA 1UZ4A 2QV4A 3GH5A 2XTKA 5CPSA 7TAAA 3PZQA 3GXDA 2WW5A 4QFUA 5E09A 2GK1A 4F8XA 1C7SA 1MW0A 1IT0A 1QI4A 3BMVA 1UWRA 2G4FA 3SCSA 3PZVA 2VCBA 1B0IA 4ZXLA 3AHVA 2WVTA 1UKPA 2XIIA 1IV8A 2DT1A 1ISYA 1R8LA 5LA0A 4QLJA 3WQ8A 1RP8A 1E1EA 4PN2A 1KWKA 3RJYA 1ISXA 4AXNA 2QPSA 1JI1A 3CIVA 4WKAA 4F79A 4R5EA 1V3JA 3E1F1 1BF2A 2QPUA 3BAYA 4BQ3A 3BSGA 1WDSA 4P8VA 5AC5A 1J0HA 4XZBA 4GO9A 1KXTA 4DWSB 1V6UA 4ZFMA 4GKLA 1UH4A 1CBGA 1EQPA 1EOMA 2EXOA 5F7UA 3GYCA 3ZIZA 3B8SA 2PI6A 1HJSA 3WF2A 3W4RA 3ARVA 3F5KA 3MANA 5M5DA 4W8AA 3CZJA 5A8OA 4TVDA 4AD2A 2E9MA 3U5YA 2GSJA 3OBAA 3WF3A 2ZUMA 2WPGA 1VFFA 2EJ1A 1VF8A 3VD3A 2WMGA 5C70A 3UG5A 3EMQA 2WMIB 3T2OA 2ZOXA 3IK2A 2XM1A 1J0KA 2CYGA 3VVGA 1RPKA 1FOBA 3B9DA 1W91A 5DEZA 1E72M 3VM7A 3VGDA 1UKQA 4LXFA 4UTFA 1GOKA 1B3ZA 4M80A 3SEPA 1KR1A 6CGTA 1NP0A 3DHUA 3GTNA 2GK1B 4QLLA 4W8LA 1UR4A 4Q22A 4MJ4A 3MUZ1 5AYIA 4D6GA 2V3GA 1JIBA 4P7RA 4R27A 3VDBA 3K8LA 1FA2A 2O92A 2JALA 1JNEA 1QBAA 3ARWA 4NRSA 3L4YA 2VZSA 2D0HA 1V6XA 4P8WA 1OD8A 1E6ZA 4ACYA 3PZMA 2GJXB 3AXHA 3TTQA 5A6SA 3VIKA 1GPFA 2QLYA 3EDJA 3HU7A 3U7BA 4J7RA 2DSUA 2QMKA 4EAMA 3WQ5A 1V6YA 2PF0A 4JFUA 1OT1A 3OLIA 1UYQA 2CBJA 3WNOA 3AIWA 4ACZA 1TFVA 4MTVA 2ZIDA 5EMYA 4LQ1A 3AXXA 4MDPA 2J8GA 1UQZA 4CD4A 2BHUA 2D24A 1NARA 1ZJBA 4P7OA 3AS0A 1UKOA 1EIBA 3IAQA 3CZEA 2WK2A 4Z2IA 5ECUA 1H0GA 1HKIA 1HT6A 1HL8A 5BRPA 2YLLA 3ZO9A 2GFTA 1FHDA 1UOKA 4ZE5A 2VZTA 3ZT6A 1UHVA 5EFDA 3TA9A 3CBWA 1BHGA 1HKJA 2O9OA 2BNJA 2YLAA 1JNDA 2E0PA 3NIYA 2B31A 1CPUA 2WVSA 2D0GA 2YL8A 1EO7A 1QW9A 1Q4NX 4JKMA 3KL3A 4MAZA 4LYPA 4L4OA 5CGMA 4CN4A 3MSDA 4FLOA 1GORA 3RO8A 1UA3A 3OB8A 1E3ZA 4AZBA 4PCSA 1HKMA 1CGYA 1QOXA 4JIEA 3VGHA 2Y24A 4PMRA 4WK9A 3M6DA 4W89A 2DSKA 1DWJM 4D72A 3ZR5A 2Y8KA 3CLWA 1IZKA 4PMQA 2CPUA 5HPCA 3U5UA 3MS8A 4MNKA 2DPEA 4FLQA 3BGAA 4BA0A 1ZBWA 5BWFA 4U5IA 3MMWA 1C7TA 4AZ7A 2VO5A 1PIFA 4W7UA 3W6MA 4D71A 1BTCA 1BG9A 4UQCA 5FL1A 3WENA 2XJ7A 2ZE0A 4AC1X 4CCCA 3NYDA 3RDKA 3VMNA 2W67A 1J0IA 4CGTA 1UR0A 3OIHA 4W7VA 4IUGA 1J12A 2WXDM 2ZUSA 5ABFA 4CD7A 4AZ5A 4W5ZA 1V0KA 2ZXDA 4H41A 3WDIA 2WWCA 3K46A 1JI2A 5A69A 2X05A 3VGFA 5KZ6A 1C3FA 1LF1A 1GQLA 1BAGA 4BQ2A 5I79A 3QGVA 2DT2A 2VZOA 3CPUA 2XVLA 4MDOA 3S2CA 4WJXA 1E0XA 3FXYA 1SR0A 4HMEA 1E6QM 4F9DA 1BYCA 3N04A 4M24A 3IJ7A 1WCGA 2CXGA 4UQAA 1E55A 1C90A 1X1NA 2YL5A 3VIGA 5TD4A 1ZB5A 4P7QA 3CUHA 3DYMA 4IPNB 1J0YA 3EDDA 5CQ1A 2WMJA 3THDA 4CVUA 2BV9A 3UG3A 4HOWA 2E4TA 4OKDA 2XGBA 3EMCA 1JFXA 3L4UA 3THCA 1F4HA 4URIA 3SURA 3CGTA 3L4TA 1PX8A 4M82A 1H4PA 3FAXA 4H8HA 3ARSA 1CXEA 1JZ5A 1GCYA 2VZVA 2J25A 4HP5A 1PIGA 3AMCA 1LQ0A 1XRVA 3M07A 2JIEA 3ZQ9A 1WO2A 4NZCA 4B15A 5E6ZA 1EDQA 1E4NA 1MW2A 1W3LA 4ZXOA 1GNXA 2VOTA 3AZTA 1CDGA 2HVMA 1NP2A 1W9XA 3VNZA 2MANA 5A8PA 4XV0A 3AYRA 2J74A 2WLYA 4AISA 3LMYA 4B9YA 2G3JA 3NCOA 2Y5EA 3TTYA 8A3HA 2ZUTA 4W8BA 1BYBA 1GW1A 3WFLA 3BLPX 5FOOA 4OOZA 1IZJA 1VBRA 1GOQA 5CXPA 4YHGA 3PTQA 2J7EA 3WH9A 2D23A 1PPIA 3W0KA 3APGA 3AIVA 3MUAA 4PMOA 5IHRA 1WE5A 1B3WA 3WDJA 1GJUA 1C93A 4KGJA 1JL8A 1D7FA 3AHZA 4PRWA 1H5VA 2X8RA 1CTNA 3MSGA 2NT1A 1B3XA 4WF7A 1Z32X 2VRQA 1SYTA 2BY3A 1BQCA 1WZKA 1J0JA 3TTOA 3RM9A 1JDDA 3MMDA 1OGSA 2DQXA 1MXDA 3GXIA 1E6RA 2UY5A 5CPQA 1OIMA 1V3KA 4W87A 1VENA 4MB4A 4BQ5A 3B9AA 2VTFA 4P8UA 4F66A 3ZT7A 2E8YA 3CMJA 2DSVA 3FW6A 2XPKA 1VEOA 5CZKA 4AIUA 3WL1A 3CHCA 4EKJA 1X6NA 3G6MA 2WWDA 4AMCA 3GM8A 3RPMA 3ARZA 5CG0A 2FH8A 4H8VA 1OBAA 4DWSA 1AVAA 4OUEA 4JAWA 3EDEA 3EDKA 1R85A 2FH6A 2ZUWA 2E3ZA 4MNMA 3VO0A 3POCA 1TA3B 2DDXA 1A3HA 1MYRA 5AY7A 5BYWA 5GQBA 4WIWA 2YA0A 1JXKA 1ZJAA 1XD1A 3UCQA 1US3A 4UQBA 2JFEX 1C8QA 3WFZA 4GI8A 3AYSA 4DM1A 1JAKA 3VD4A 1TMQA 3N17A 3AICA 4W86A 2XSAA 3WY1A 4A3HA 2J7DA 3SIMA 3VNYA 1GJWA 1V08A 3A4XA 2G3NA 2WC3A 4AD1A 1LG2A 3CZGA 1GHRA 1LL7A 1B1YA 2X0YA 5I2UA 1GOOA 5A6BA 5CLTA 4WSKA 4HZ8A 5LA1A 1HJVA 4GZEA 2XM2A 1E70M 3SCPA 4RE2A 2WZIA 1H0IA 1E40A 4B16A 2VCAA 3PZOA 4HZ6A 1B30A 3BAXA 4CCEA 2CERA 2VVNA 3F5LA 3VM5A 2VI0A 3HN3A 1B3YA 2GJPA 4FK9A 1Q6CA 3WF0A 2FGLA 1LWJA 1ESWA 1ITXA 1E15A 4QCEA 4UFMA 1Q6DA 2VX4A 1XH1A 1WDQA 1V03A 1QNPA 4GZIA 3GXFA 2BHZA 4UZSA 1KXQA 3M46A 3SUSA 1V02A 1QBBA 3BC9A 4D6EA 4GI6A 3K4AA 1MW1A 1UQYA 2X1IA 1E6SM 2Z1KA 4PMVA 3VMOA 1UR9A 3DYPA 1CIUA 2IXUA 3WDQA 1TZ7A 1PEZA 1CNVA 3AMDA 4AW7A 3F5JA 2QHAA 2W4XA 1AQMA 2F2HA 5LA2A 3FN9A 5HNNA 4UZUA 1DWGM 3A6OA 4D6JA 5CSUA 1V3LA 2QMJA 4PTMA 2YDSA 3VDAA 3W29A 3VD9A 3WDPP 5AC4A 2O9PA 1G0CA 2WHMA 2ZXQA 3ARUA 1PJ9A 2ZXAA 5FCZA 1CXHA 3ARYA 1GOMA 1UWUA 3K1DA 4Q7NA 3PZGA 4UFIA 1HVXA 3AMKA 2CESA 3L4WA 4B3KA 3WBAA 1UD2A 3ALFA 4W93A 3OGRA 3W25A 2D0FA 2UY3A 3BMWA 4ATDA 4AD4A 2PC8A 4UQEA 2J47A 4MNLA 3CMGA 1V3HA 1PAMA 2YBUA 4QP0A 2ZUNA 4ZE4A 1NOFA 4ZEPA 7CGTA 2A3EA 5JIWA 1VJZA 4TUFA 1UD4A 2GJXA 1K9FA 1H1NA 1BVNP 2CIPA 2FHCA 2VQUA 4Z2GA 3HJEA 4QLKA 1EO5A 1W1PA 4BF7A 1PZ3A 4GI9A 1JGIA 1WDRA 1NH6A 4PTXA 2UY4A 2XWEA 5GNZA 4AY1A 4P7LA 4FF5A 3FNDA 1E3XA 5E9AA 3VINA 2F8QA 2XUCA 4M1RA 2VMFA 4U3AA 1XCWA 4HPHA 3MU7A 2AMGA 3T2QA 5BRQA 4X0VA 1ODZA 1ZU8A 3LPFA 4ACZB 1EGZA 1XGZA 4BZYA 4V28A 2CKSA 4H2CA 4JCLA 3RM8A 2ZWYA 3SCTA 1XCXA 2W92A 1VFUA 1QHPA 2BHYA 2XWDA 3BAKA 3I3DA 2EQDA 3T08A 1TA3A 4CU6A 2WKLA 3LPPA 3CZKA 2DGAA 4GXPA 3AOFA 3G6LA 1B3VA 4PMYA 3SUWA 3FHAA 3WN6A 5IHSA 4CKQA 5A6KA 1YQ2A 2Y4SA 4HA3A 5BROA 9CGTA 1JZ2A 2CEQA 3NSMA 3EDFA 3VILA 3WELA 4Y7EA 3BSHA 1JZ4A 1JYWA 2BFGA 4FLSA 2DT0A 1Q6FA 3TP4A 2VVSA 2WCAA 1SFSA 2DSWA 4DWSD 1BYDA 3BLKA 5HDRA 4HMCA 4GZJA 3CH9A 3W81A 1US2A 1GOIA 1YHTA 4WKHA 1GQKA 4AIEA 1XV8A 1K9DA 2PWFA 3PZNA 8CGTA 1G5AA 3VTRA 4X9YA 2XHYA 3WSUA 2WVVA 2EPOA 1ZBKA 2XSBA 1P6WA 3GNPA 3L2LA 1XSIA 1J10A 2WVVB 3T09A 1CENA
chains in the Genus database with same CATH superfamily
1ZBVA 2QEZA 4H6KA 3BG5A 2XIJA 4DJFD 5FSEC 4LY8A 3C3UA 3EBVA 3VGGA 5PTDA 3LBMA 1UD3A 2CHOA 2XISA 2XN2A 2DH2A 3IPWA 4DAFA 3UCDA 4CNPA 5BOOA 4JTTA 4J2PA 1BEUA 3AIQA 4GJIA 3EA2A 5C0QA 1WZLA 1MSSA 1MEWA 2EG7A 2BOFX 3S46A 1F05A 1RD6A 3QQ1A 3C8NA 1QNQA 2G3IA 1F61A 3P67A 2NV9A 1KM5A 1GQNA 1KRMA 1UR2A 1P0EA 1SSGA 3GHRA 1US0A 1J8VA 4M6UA 3KBVA 4LFYA 3NVTA 1TPDA 4LB3A 4Y8EA 3CO4A 4FX6M 3U3HA 1ZS2A 3WO8A 1Q85A 1OF6A 1M04A 4MFEA 3ES8A 4O15A 4YTTA 2O0TA 4QTGA 1IT7A 4EF8A 1XLIA 1P6CA 4E2OA 1H7RA 5EU9A 4AIBA 1QNRA 4JFSA 2ZX7A 3WKZA 4KCVA 1DIVA 1UKSA 3FYYA 2NX1A 1JAEA 1B31A 4UFJA 3UWWA 3CYVA 1KV5A 5I78A 3CUGA 3IARA 1M1BA 2HSAA 2VEMA 1CWYA 1QI0A 2H6RA 3F4WA 1KFBA 4C6QA 3PZUA 1MVYA 4MOZA 2NWSA 4WSHA 5HINA 4PEKA 4AIOA 1S46A 2H9AB 3HPXA 3FJNA 4DZHA 1VFSA 3CUJA 4CN6A 3W2KA 4IMCA 3SECA 5I23A 3K8KA 5D9OA 1GOXA 4HPGA 4TV5A 3DHPA 3KOYA 4OZOA 4HSHA 4JZ5A 5I7GA 2J7BA 4ILSA 1WDPA 4HNTA 4EVZA 3ZVIA 4FNTA 4G7FA 2PU0A 3NQEA 4IQLA 3PWAA 1ITUA 3N25A 1L0PA 2A3BA 1ZLPA 4OBRA 3ZJ8A 1OINA 4CD5A 3W22A 3ECQA 4NJGA 5E6YA 3R1ZA 1IF2A 2VUYA 4LT9A 2WVUA 2QGYA 3O6AA 3REQB 3W1PA 6REQB 4YN5A 1VC4A 2OELA 3AUOA 2VWTA 3W37A 4V1XA 2Z1BA 3R25A 2Q8XA 5I07A 3SCWA 5EFFA 1UZHA 3SCVA 3V16A 3WD1A 2YZ5A 3OLEA 5DMYA 3TJ4A 1JULA 1QWKA 4GK8A 1TRDA 4QE4A 3N2OA 4GD0A 4DNHA 1LBMA 1QHOA 1KB3A 1REQA 2P50A 3APTA 2WSYA 1W9UA 4KGLA 2FYMA 4D6CA 3WH5A 2XG9A 4NG3A 1V4YA 2YFNA 3CZ8A 3PG8A 4PB5A 5AECA 2AL1A 4IGHA 3V0TA 3NDZA 3W87A 2JEQA 3W82A 3G2GA 2D2OA 2CETA 3G1RA 5TNVA 3VCNA 1VLWA 3OOQA 5ABGA 5FEWA 4KH2A 2R94A 1TKKA 4O57A 4ADSA 4GNVA 3I68A 4ML9A 1OJXA 4FXRA 3NEHA 2R24A 1CGWA 1NVMA 5C9UA 3OYZA 3UXIA 1WKEA 3CEUA 3BAJA 3RXZA 2YYTA 3TWAA 3OGSA 3R11A 3FOKA 3P14A 2IPWA 3N1AA 4LAMA 3LSCA 5GNXA 4ZQCA 1ISZA 2YJQA 2ZA3A 1TV4A 2J9XA 1XYMA 1W9PA 2JE8A 1UP0A 2Y7EA 4MB3A 4NYYA 4UWMA 1K9TA 3BQ6A 3CTTA 1Z89A 3G0SA 3U2OA 2O56A 4WEVX 2I56A 3UPBA 3T05A 1REQB 3QFEA 5A8GA 3N73A 2Z2BA 1UR1A 1E5NA 2FB3A 2E5BA 3P0WA 3ZJ7A 2E6AA 4ZMGA 1G9HA 2G3MA 1XIIA 3OP2A 3ITCA 5CAKA 1EKOA 1TCMA 3LN3A 3WNPA 1T5AA 3ITLA 2ZX5A 4PBEA 5FACA 2Y5SA 5K9CA 1XIHA 2W66A 1VRDA 1QNSA 4A8IA 4I8YA 3VCCA 2CLLA 4Z0SA 1SFLA 5HNUA 4CUCA 2DUZA 1FTXA 4XKMA 4IFOA 1RBAA 1RSCA 5FF3A 4RW3A 7REQA 1X39A 2HBXA 3MYOA 2YZRA 3QV7A 4ZTXA 1F07A 2ZX8A 3ZZ1A 3SB0A 5BMXA 2J7GA 1C91A 1FQ0A 4LU0A 2G5WA 4RSRA 4HOZA 1TG7A 5BW6A 1RXOB 3DFYA 2WB5A 3BH4A 4U2ZA 5GJPA 3KRZA 3OLDA 1TE1A 3T4WA 3OGVA 4PULA 4QNWA 3OQ8A 4N6FA 3AU2A 4PUWA 3Q45A 2EO7A 1YPIA 1GGOA 3DUGA 4Z2LA 4LY4A 5A6BD 3IIXA 3THUA 1HG3A 3ZLHA 1ITQA 1CECA 4PRTA 4E8GA 5I5RA 3K5XA 2TSYA 4HK6A 2FZ9A 4PMDA 3UPWA 3OZMA 3W1TA 4GI4A 5C55A 5A94A 1Q6QA 1YTEA 3UEQA 3AYTA 8XIMA 3CL6A 2WLZA 3XIMA 2XH4A 3OYXA 1F3WA 1YDOA 3EOEA 3TMLA 5A2CA 4KWUA 5K7JA 3L2IA 3TYUA 4PMXA 2GWGA 4LV9A 4AYGA 4EPEC 3POHA 1U1HA 4J3SA 4UQDA 2VD9A 1KGXA 3SUUA 2WM0A 1TB3A 3CMFA 1UD8A 2C6QA 2YDRA 3F7JA 3V0SA 1B57A 4JEJA 1F3TA 4HU3A 3IGHX 1DJQA 4WDTA 1LYXA 5HMSA 2VP8A 3NG3A 3GAYA 1P0BA 4ZL1A 3W7LA 4EZFA 1SMDA 1W5MA 1BG4A 5A8QA 1XUUA 4DY1A 4JY9A 2WNNA 3BW2A 2JKAA 5H8PA 4LCSA 4WKFA 3GS6A 2DIEA 1XQLA 3WH8A 3TSDA 2BY2A 1R87A 1R3SA 1DHPA 2XZ9A 4GYPA 1WUEA 4KWVA 1P0NA 5HJYA 4NILA 3NPWA 4HA1A 5HULA 4MKNA 4R9XA 2FTPA 1I2RA 4F4RA 4XK2A 1AUSL 7ODCA 1O95A 4IL0A 1VFOA 4U5KA 4GFSA 5DCDA 4LAOA 3LG3A 3LI1A 3L67A 3J7ZH 3ICJA 2IKHA 1YTDA 4MKVA 4UFLA 3LLDA 3WJWA 3EB2A 3C86A 2D73A 2Q8ZA 3T07A 4ERIA 3QHNA 1LRQA 3NQ2A 1UZ1A 2YFOA 3LHTA 1K77A 5IDIA 1AQHA 3UJ2A 2BOEX 1U5JA 1KGUA 1DOSA 1VYSX 3OVGA 4WLCA 4ZR8A 1J4EA 1W32A 4Q8NA 1YXDA 5DT7A 4NSBA 4C65A 5CC6A 1KA9F 2FLIA 3QF0A 2DVTA 5D8WA 1QPRA 3EWZA 4IWWA 3EAUA 3O2LA 3GXMA 2PEVA 3GNOA 3WMSA 5DQPA 3B0YA 3C52A 4XIMA 1A5NC 4AZHA 5A2AA 3T2PA 5LXXA 2XIQA 4BQ4A 3SCNA 3WQDA 2AL2B 2AOSA 3F2DA 5JBDA 3RU6A 3FS2A 4XD4A 3W7MA 1DWIM 2V6AA 2V0TA 2ISWA 1QW7A 3C61A 2VURA 3MUXA 1QXLA 3WD2A 3C2YA 3GH4A 3ZLGA 5D2YA 3VIHA 3DECA 1AQ0A 4QDPA 3VX1A 2YXOA 2A3HA 1S3HA 1H11A 3WG6A 5FL0A 3UWEA 1JD7A 2R91A 2RDXA 2PTWA 3WJSA 2J7HA 1TPVA 2OKOA 3UR7A 3M43A 3NR0A 1C29A 4IH3A 1GKQA 2GVJA 1WB0A 2NW0A 5BZAA 1NWTA 3ERPA 3SUVA 3BO9A 1UR8A 3AJ7A 1E73M 1TPC1 4AEFA 4LS0A 3PPGA 1KBIA 1M6JA 1I1WA 2PFHA 4B92A 4ZO8A 1XGEA 4KRZA 1UMLA 1RA5A 1W3IA 4RJEA 1ONXA 3D5HA 4XTIA 4AG0A 1X7FA 3II1A 4IMFA 2CLMA 2E9LA 3NXFA 2EF9A 1KCXA 2ZXBA 4AQLA 2JF7A 1TWWA 1ZJHA 3TA6A 3QV6A 1FXPA 3KWXA 2Z1XA 1MFVA 3WEZA 1HJWA 3H2CA 1BVZA 5MHBA 1WDDA 4A35A 4LTSA 3A5VA 2TPSA 3QLLA 4FEZA 5HXMA 2BSLA 4N9DA 1BKHA 4JL2A 3GD6A 1W3JA 3FDKA 2E6DA 1ME9A 3V7PA 3USZA 1KGWA 4M6PA 3BOLA 3N13A 3QV8A 3FNVA 3QKEA 3WNNA 3PZ9A 4KRTA 3A4WA 1PX3A 3G1HA 2BVTA 2QF8A 4C6LA 4C7GA 5IDZA 3CHFA 4ATLA 2OYLA 1OSEA 2E77A 2BB0A 4WSJA 1JDCA 5CBIA 1IE7C 2YKKA 3ZT5A 1LG1A 4MG4A 4QITA 5U4NA 4WDUA 4ZTYA 2XN0A 3VGBA 1XIJA 3B8TA 3I7QA 2CLIA 3UBPC 1LLWA 3TW6A 1VPXA 1FP8A 2FFCA 3ARQA 3FA4A 3SBFA 3QEZA 4KQNA 2JEPA 2EG6A 3NO3A 1HIZA 4FNUA 1Z69A 4TOQA 4M56A 2XVNA 2HS6A 3PBUA 2RHGA 2HE8A 9RUBA 4MMWA 1UR3M 1OCBA 1XYFA 4UR8A 3V75A 1QTWA 1WQ5A 3E49A 4DPPA 1VFMA 2A1YA 1F9CA 3WF1A 5G4WA 2WJFA 1OC6A 2QDEA 2ZQ0A 3O6CA 1EOKA 4PUJA 1OX5A 1FCBA 2DP3A 4JHOA 3E74A 4S3JA 3HGOA 3U8GA 1JZ8A 2TRSA 3B8DA 4R88A 5AZ0A 5BXTA 2CCRA 1MW3A 4DVOA 1N82A 4HZMA 1XD0A 3JRKA 5EL1A 4CCDA 2XN1A 3W38A 3RLVA 2W9MA 4KCUA 3WLMA 3TYCA 4NT0A 4UNLA 2ONEA 1Z48A 3WUFA 4A3UA 4OBSA 3YPIA 2VX6A 4L5ZA 4AAJA 1NF0A 1POKA 1X38A 3HV9A 3NL2A 1EJSC 2Z0IA 3TYZA 1GQJA 1NFPA 4RE4A 1JZ7A 3R8GA 2JIWA 3BQ5A 3S5YA 3LNMA 1T41A 1WA3A 4NNCA 3W74A 4IJRA 4WDXA 5M03A 2W91A 2YDQA 1TX2A 1DXEA 4IMEA 3RPDA 5C7HA 1JF5A 5D32A 4B5TA 3VMPA 2H3BA 1PTDA 2J4GA 2WC4A 4DUWA 3CQ0A 2E9XB 4CCZA 1EDGA 1VGAA 3CIXA 4LBUA 4IMAA 3G1DA 3AS1A 4Z0JA 1M7JA 3VOJA 1JYVA 6PTDA 2VX5A 3A3HA 3VC6A 3EX3A 5D8ZA 2QV5A 3TDFA 1DEDA 1X1ZA 1KM0A 2ANUA 3SAZA 3PPCA 3W26A 3CHDA 5AC8A 3UJEA 2GVYA 4DXVA 1XSKA 4TTGA 4MUZA 3DU0A 3S5ZA 3W1NA 4IJCA 3GXDA 3H7RA 1N8WA 3EZ4A 3BMVA 1I2NA 3RU8X 3SCSA 4Z1DA 1Y5WA 4GLEA 3M47A 4NZ4A 1IV8A 3NL6A 3CPRA 4C5ZA 3RCYA 1VCVA 4QLJA 3WQ8A 4EACA 1RP8A 1E1EA 4PN2A 3G1VA 1N8FA 1U1UA 1JI1A 2OO0A 4R5EA 3RRAA 2QPUA 4H83A 1XDMA 5H6HA 3WK0A 2QT3A 3PS7A 1KXTA 5FAJA 4DWSB 1V6UA 2DZVA 1UH4A 2R1PA 3V3WA 1X98A 5B7YA 4RPQA 4LUJA 1EQPA 2EAWA 4ALDA 4IXHA 3VK5A 1HJSA 4PA8A 1IXOA 3HZ3A 4UBPC 1IXPA 2P53A 3IJQA 3F5KA 3MANA 4QDWA 3W2LA 3CZJA 3TFXA 4TVDA 3OBAA 2PMQA 4K1WA 2WPGA 4OV9A 1VFFA 1YE6A 2Y62A 3VD3A 2A3LA 3B4UA 3IGSA 3UG5A 4H00A 1QAPA 2QGHA 3EX4A 1ZAHA 1IEWA 3VVGA 3L0NA 3B9DA 1W91A 4DBEA 4IGMA 4IZGA 2PRLA 4MKSA 3P84A 1SW0A 5F2MA 3VGDA 1UKQA 3H23A 4IP7A 3UZXA 1GOKA 4M80A 3SEPA 1KR1A 3GTNA 1M9HA 4WY0B 4O54A 3PANA 3DG3A 5AYIA 1VBHA 4JGDA 3V36A 3NTYA 4HPJA 3DIPA 4AFYA 1P0DA 3NM1A 1QBAA 1GPWA 4NRSA 3VKBA 2VZSA 2D0HA 3OJGA 1E6ZA 1PYMA 4ACYA 1MO0A 2GYIA 5FJUA 3S42A 4M1BA 4NKCA 5D2WA 1P1XA 3U4AA 4DJDC 4JYEA 4RZ4A 2C19A 4KIRA 3NQVA 4J7RA 2DSUA 2NX9A 1HUVA 2RDWA 1DJGA 2X2GA 4JFUA 4ROQA 2PA6A 4JTDA 2VR2A 4FXJA 3AIWA 4ACZA 4LVBA 4MTVA 3G8RA 4O1FA 4TO8A 2FZBA 2GDQA 3TN3A 4CD4A 2ZKMX 4H6QA 1ZJBA 4AHOA 4X9SA 4YCOA 5KETA 3KOFA 3K2GA 1Q65A 1EIBA 4JPGA 3L68A 5ECUA 1YEYA 2YLLA 3ZO9A 2GFTA 1FHDA 1UOKA 4FX7A 2PDQA 4J2MA 4Q8MA 2VZTA 3ZT6A 5K3VA 4GYPC 1XLDA 5EFDA 5T26A 1XLBA 2FVLA 1XLAA 1BHGA 3B0PA 4IGNA 5I3KA 5JXQA 2YLAA 2G95A 1JNDA 1W0MA 4MPQA 3FK4A 2YL8A 1EO7A 4GVIA 2AGKA 3KL3A 1Q2RA 4L4OA 2C13A 2FKPA 4RXFA 4FXFA 1PO9A 4PCSA 1TPB1 1DQXA 4IQEA 5HNRA 2Y7FA 2CZVA 4TX9A 4R34A 5G1TA 3GVRA 2Y70A 4DJFC 1HGWA 4PMRA 3W7IA 1Z7AA 3MY9A 4D72A 3LX9A 2Y8KA 1E51A 5HPCA 4JTGA 3CO8A 3MS8A 3M0KA 3KOZA 2YXXA 2A7PA 2OT0A 4U5IA 3MMWA 1RZMA 3LHUA 4LUSA 4AZ7A 4HYVA 1PIFA 4W7UA 3TC3A 4JTHA 3TN4A 5AN7A 1ZRQA 3WENA 3EEGA 3BLDA 4AC1X 2CLEA 1I2QA 3NYDA 1NDZA 2JGQA 3RDKA 2W67A 3S9IA 4REQB 2E5CA 5AOUA 4W7VA 3LCXA 2CZEA 1YNQA 3GTFA 5XINA 3O07A 1FVPA 3NOEA 3HPFA 4AZ5A 4DX3A 1I8JA 1F8MA 3GIYA 3WDIA 1JI2A 4JNYA 1EP2A 4FXSA 3FXGA 4A05A 4I9TA 4MDOA 1E0XA 4BI7A 4F28A 1SR0A 3UP8A 4R9OA 2NZLA 1YBQB 4O1EA 4Z1YA 1WCGA 2PODA 1BTMA 4KEZA 3ABZA 2TYSA 1E55A 3B8UA 1X1NA 5FAGA 3JVAA 2J6XA 4NIRA 4P7QA 3D0CA 3DYMA 1BSLA 2V63A 4NYUA 4RK8A 3GTIA 5CQ1A 5DY2A 2BV9A 1E0TA 3QV9A 2VFGA 1PUDA 3L4UA 3UW6A 1G4SA 1F4HA 1OX4A 1R6WA 1EYEA 1R3QA 5AFDA 1RY8A 1PS9A 1H4PA 2Z24A 4DN1A 2IQTA 1TQJA 3S5SA 3W7HA 4NASA 1GCYA 3TQPA 4Y9NA 2VZVA 4DRSA 3GTHA 4HP5A 1LWIA 3GX9A 2NVCA 5H91A 3Q65A 5F1VA 3JU2A 4MFDA 1QATA 3LCHA 3WK1A 4HNNA 4UTHA 1E4NA 1W3LA 2B4GA 3AZTA 4FI4A 4O12A 4QG9A 5EMMA 4F48A 2OEMA 3LBCA 1NP2A 2VFEA 4GKTA 4Z17A 2MANA 1TIWA 3W00A 3PFMA 1UPMB 2R14A 5M1TA 4LBRA 2WLYA 1FWRA 4JYDA 4XD6A 3SRDA 4RPPA 1XICA 3PB2A 3WZ0E 2G3JA 4GABA 5CZ0A 3TTYA 3VYLA 8A3HA 3T4CA 3WFLA 4HCDA 3BLPX 1IZJA 4G8TA 3BV4A 4NY2A 4ONVA 4YHGA 1TUFA 5I3JA 2D23A 4WJEA 3MUAA 3M0LA 3T55A 3WDJA 1GJUA 3ITVA 4UCGA 4LNYA 3UXKA 3AHZA 4PRWA 1H5VA 4HPNA 3BDKA 4TIMA 4H9YA 4EXQA 2G97A 2O55A 3URQA 1A5SA 3S2QA 1Z32X 3W9ZA 3TC6A 2V5LA 1CX9A 3O1NA 4RW5A 5DXYA 1XG3A 1RK6A 3UWQA 2ZDRA 2POTA 5CPQA 2DQXA 2JGYA 1V3KA 4AHQA 1B54A 4XZMX 3EPOA 4F66A 3E96A 5CG7A 1U22A 2E8YA 3CIWA 4XKYB 4GA8A 1VEOA 4AIUA 1ELSA 1YADA 1X6NA 3MCMA 4C6DA 2WWDA 4AMCA 3RPMA 4MF4A 3ZWTA 3OTRA 4C1NB 1OBAA 1AVAA 1EEPA 1QOPA 4K37A 4O16A 4UTWC 3POCA 2DDXA 3WQEA 1SFJA 1A3HA 5BYWA 1S2VA 3BCJA 5GQBA 2PTYA 4UQBA 2JFEX 2OO6A 3OVPA 1FWBC 4B2DA 3WFZA 1V5XA 4DM1A 1H62A 3N17A 3LCLA 4LRTA 4W86A 3LCGA 3SW6A 2E25A 1L6GA 3VNYA 1V08A 3MCNA 1LG2A 3OU8A 3RR4A 3WLKX 1GHRA 1B1YA 2X0YA 3LTPA 1LQAA 3A9IA 3GQYA 4WSKA 5LA1A 3I65A 2YSWA 4GZEA 4RV8A 3SCPA 3R10A 2QCFA 3E12A 4RE2A 2WZIA 3LCWA 3VNJA 3RK8A 1K3UA 3C8FA 3CPGA 5BWAA 1XYBA 3O3RA 1NTHA 5K4XA 4I6KA 5LKYA 1R2RA 2W79A 1Q6CA 2PZ0A 4WCJA 3A3XA 3M5XA 2GQ9A 1Q6LA 3ZYZA 4PFMA 1E15A 3T7VA 3VZXA 2FPVA 3BTNA 1SO6A 1Q6DA 3Q94A 3S2NA 5AC7A 3UQNA 2AKZA 3B9NA 3GDLA 4XD3A 1MUMA 3FLUA 4PC8A 1WOBA 1SZRA 3M46A 1IXNA 1EX1A 1UQYA 1E6SM 1WYIA 4XZNX 1F76A 2PURA 2AKMA 3U4FA 4DBSA 2QJMA 4HQVA 1FWEC 3ITOA 1YNPA 4C6BA 4XQ6A 3F5JA 3H4GA 1A50A 4F0SA 9XIMA 1KC7A 5SWUA 4KT2A 5CSUA 4BWLC 1V3LA 4MLRA 2FZMA 2YDSA 4FNPA 1G7VA 1FDYA 3WQFA 3IIVA 2HDJA 2WHMA 1VKFA 1QRQA 3MI6A 5K2ZA 1A53A 3KHJA 5FCZA 3ARYA 1EEXA 4Q7NA 2GVLA 4UFIA 3CC1A 1SVDA 2CESA 4E4UA 4HT3A 1UD2A 3ALFA 4W93A 3Q4DA 3BMWA 3M0XA 1MRQA 2QULA 3FX4A 3T0TA 1NDYA 1PCWA 2OOFA 2PDKA 1AFSA 3BG9A 2J47A 4MNLA 1V3HA 3DG6A 3HURA 1NOFA 2PP1A 4JHMA 4TUFA 2VWSA 4RDVA 3NOYA 3UYCA 1BVNP 3S1VA 1JPHA 3HJEA 4QLKA 1PZ3A 4GI9A 1JGIA 4L7ZA 5GJNA 3FNDA 3VINA 2F8QA 1GYLA 1IEVA 3F4DA 3GVVA 3MKVA 3M5YA 2GJNA 3N6HA 5BRQA 2ZRYA 1ODZA 1OFEA 2Z2UA 4V28A 3GW0A 2CKSA 4M6QA 1XCXA 1F2JA 1VFUA 4Q7BA 2BHYA 3R0KA 2XWDA 3OW1A 1TA3A 2P8CA 1SPQA 3NQFA 2WKLA 3MSRA 4PGLA 4GIRA 4OFCA 2ZDSA 2UZ9A 4MY9A 4UMAA 4R7WA 3N14A 3AOFA 2DU2A 3T9PA 4HA3A 4LSBA 2J13A 1BVWA 1JZ2A 3TE9A 2CEQA 3QY7A 3GR8A 2R1MA 3EDFA 1OABA 5C9XA 2Y63A 2B7OA 3GLCA 5LIUX 1JYWA 4C6OA 2Z26A 1IR1A 3NL3A 4N4QA 4GQ0A 3LBOA 1RY0A 2IMRA 1GOIA 2V5BA 1XV8A 1K9DA 1L9WA 1BXNA 3BUVA 3SGUA 2EPOA 4DI9A 3QXBA 2C1HA 4NZ3A 2WVVB 3T09A 3K4DA 2WCSA 2VEPA 3NPXA 3QQWA 2I9UA 3L4ZA 3OZPA 2KAUC 3IAPA 1S5MA 2HROA 3FEQA 3EX1A 6ENLA 1U30A 1TUXA 1YPFA 3VPLA 3WNLA 4GQQA 3KDOA 3LY0A 3N34A 5E70A 3DERA 4GHRA 3CHEA 4H3DA 2VQTA 4HYWA 1B2YA 4XZWA 3W3OA 4X61A 3WH6A 2YR1A 4H8UA 3I3EA 1M3UA 4E8CA 3O6YX 2ACQA 4Q33A 2G96A 4PYSA 3TZNA 1AG1O 1B90A 1G7UA 4LYKA 3LPOA 1CGUA 4GISA 3C5QA 4FZIA 4PTDA 4ML4A 2PUZA 3EYPA 4GC4A 4XZHA 2EPKX 1SJAA 4AWUA 3CJPA 5D4YA 3IUDA 4UTTA 4D1IA 1ONEA 3P5YA 3S8HA 3FFSA 2YCKX 3QFWA 4GG9A 2ZCGA 2YBVA 3VOFA 5D2VA 2Y2WA 1PZ1A 3FVMA 3S6TA 4IM4A 5DBTA 3GG7A 2J62A 1RQEA 3NO1A 4C1NA 2EPMX 5FI8A 4U31A 4Y9OA 4D6IA 1ZJIA 2XFYA 2CLOA 2VFDA 4JY8A 4PTWA 1U5VA 3ITTA 3ZMRA 5BU9A 1E0UA 3KM8A 1OCNA 1KQYA 2EHHA 3EWWA 3GVQA 4UMBA 3IIPA 2XFFA 3KHDA 1UOZA 3QKZA 2DW6A 1ISVA 2ATMA 2ZTJA 1S2UA 7A3HA 3AS3A 4S23A 3C2FA 2XFWA 3NFUA 3H2NA 3SM0A 1SJCA 4LUTA 2A3CA 3MHUA 1VBJA 4AVFA 1E4LA 2BY0A 3MCOA 3GTXA 3SY8A 4GYKA 2FFIA 2A2IA 1BD0A 2DUAA 1FCQA 3AXIA 3F4CA 4C7FA 3HQOA 4W88A 2AQWA 3DX5A 2J75A 2CWXA 4FF7A 2D3LA 2GDVA 3GRIA 4DJDD 3L4VA 3ABQA 3M9YA 2G50A 4RE3A 3O05A 5M17A 3W02A 1Y5VA 2JQXA 3VDCA 2V38A 1AMYA 2TAAA 1RQBA 2RJGA 4GY7A 1Y7VA 4NRRA 4WVXA 1FWJC 4FB7A 3SCOA 1HQTA 2QCGA 3WF4A 2IXVA 1E6XM 1YXYA 1FDJA 1OX6A 1Z6KA 1DWAM 1SQ7A 2IPJA 1H3GA 3TMQA 2WJZA 3GBEA 3AIEA 3QR0A 3V4BA 3FAWA 1L6SA 1XLEA 3ARTA 2HK0A 3ATZA 3MZNA 1Y5XA 1OHLA 4HU0A 5HA7A 2PRHA 4OUIA 4Q8QA 4FMVA 5F2GA 3CUFA 3C6CA 1CCWB 1RCOB 4DPQA 4AYSA 1L2UA 3KLKA 4I6VA 4C6MA 2BY1A 4GJ1A 3WJYA 1LBFA 4CEUC 3SQMA 3TK7A 2VRJA 3S1WA 5JBFA 2Y61A 1D2KA 1XKJA 2HNEA 1H2JA 3WD4A 1FH8A 3TROA 4GUFA 2QF7A 4NP7A 4K38A 4MB1A 3S5NA 4U10A 3ANWA 3SADA 4GPNA 4KKXA 2J7FA 4Y8FA 3BZGA 3JUGA 3ZFHA 3W7GA 4K1GA 3CLMA 4YU1A 1PZ2A 3D3FA 2HMCA 3UT0A 1BWLA 4GY1A 1RP9A 5E0FA 1PHWA 1SJDA 4EP8C 5E5CA 2GUYA 4WY0A 2D1ZA 3AMGA 4DO7A 4NJIA 4KCTA 4AXKA 1SGJA 3M16A 2OEJA 3UXAA 3S3GA 1WZAA 5ABTA 4AD5A 2O9TA 3LNPA 3AHTA 2G41A 5D38A 3W7OA 1LRTA 3E6EA 2VELA 3WJZA 1XFBA 3CASA 1TMLA 3J7HA 4UTUA 1QI5A 4Q3MA 3RR1A 4US5D 1Z9AA 2QDGA 3UNTA 3BLFA 1LRNA 1FWWA 3B0XA 2JBMA 1XIEA 4NX0A 2EBNA 1TZZA 3KX6A 1QCWA 1CLXA 3EX6A 3LB0A 5CEWA 3UESA 4PCFA 4V1YA 3B8IA 4DUXA 2WQDA 4C6KA 3A3WA 3BJTA 5AHMA 4EANA 4CLMA 2DJXA 3S6DA 1UZDA 4A3YA 1W1TA 2V81A 3H54A 1T96A 1W31A 2YIHA 2CZDA 1MQRA 2V5DA 3G8EA 3E0IA 3PC0A 3C0QA 3H7UA 2HPMA 3ZOAA 3N29A 5F2IA 4QEEA 3LU2A 4RLIA 5KZDA 1HKWA 4O19A 2Y8UA 2FGBA 3HMCA 3RMEA 4AZIA 4LGXA 4MJMA 4UNIA 2OEKA 4HA4A 3S4TA 2VDHA 3DHFA 1XH0A 4O52A 4UB9A 4Y9AA 1MXGA 3AZRA 4DYEA 1F73A 1RV8A 4UQ9A 5A95A 5C9ZA 3M64A 3FYOA 1S5TA 2GSHA 5C2GA 3FDGA 1QHZA 3CT7A 1DE5A 5IBXA 3SRHA 2J9ZA 2CLHA 3WQPA 1TIMA 2JF6A 4PTVA 2OYKA 3VNDA 2B0MA 4MB5A 2GGGA 3ANUA 3LEPA 2OGYA 4IIFA 3RGTA 1VLIA 1GHSA 4KFOA 4N0RA 4S3KA 3O8AA 3MO7A 3I3BA 1QW8A 1LL4A 2VC6A 1JDAA 2DEPA 4IIBA 4QGCA 1MWOA 1CLKA 4R7OA 2I5GA 1VBUA 5KSWA 1QPKA 4K3ZA 5ABEA 4MJ2A 3KBMA 1SZEA 1RBOB 2YW4A 1HZYA 5CPMA 4F2BA 1KKRA 2WHJA 3EWXA 1MFUA 1TV7A 3FV9A 3NEVA 4QAIA 4OU1A 1VB9A 1LOSA 2X49A 3OG3A 4KIEA 3CV1A 3UY7A 3AMLA 3FSUA 1EHAA 5JQ9A 1S2CA 1MNZA 1JZ3A 2P10A 4DM2A 3RN6A 1N2VA 2GQ8A 1G01A 2WSRA 4YIWA 2P8BA 4HNCA 1EJXC 4N9EA 2OLAA 5ABHA 3DYOA 3ONBA 2ZA1A 3C3NA 4GUIA 2ZBTA 2BGQA 1XYCA 2I17A 2Z1VA 2PWDA 3OZYA 4LWWA 2IUZA 3E0FA 3KL5A 1H7PA 5CZSA 4J5NA 3GW3A 5BCAA 3KZSA 1ME8A 1NFGA 1CXIA 1KKOA 4V2XA 4C6JA 1VEPA 2O7SA 3WLIA 3DFPA 1XFCA 3EOLA 3MUCA 4PUNA 4MPKA 4K8EA 3MI3A 2QCDA 3UVAA 3MV01 3B04A 3EEZA 2OQHA 4LUTB 3U2EA 4WDWA 3B9EA 1UBSA 4XG1A 1SR9A 3IJ9A 3DFHA 3NPVA 3W88A 4YTRA 4RDWA 3ISIX 2W61A 3FVDA 1KQZA 1KRBC 4UR9A 4AZCA 3QZAA 4IG2A 4QR6A 3PM6A 4QDMA 3RAOA 5B80A 3QSTA 3FCPA 4AWSA 1EC8A 5C71A 1UUOA 3W2UA 4U28A 1XLGA 4PSRA 4C91A 3LXAA 3QW4B 3W1XA 1E5JA 2I1OA 3LTYA 4KPLA 1YKWA 3B97A 3R94A 3NGJA 1TQXA 2OZTA 3HPZA 5CC3A 1UP2A 4Q4QA 1F6PA 1JDFA 2WC7A 4O1DA 3VIJA 1FKXA 3QLDA 3LHZA 5CPNA 4IIEA 1A5AA 1WKFA 3TC7A 4ZENA 3DXIA 1ISWA 3Q67A 1M03A 3ANVA 3H12A 6XIAA 1D8CA 4ECLA 4GYJA 3G1AA 4S3FA 3CL8A 4EWJA 3RX4A 4J27A 1T6MA 4V27A 3AWNA 1CZ1A 4OIFA 3VC5A 5CC5A 1E4IA 4YTSA 1C92A 4GNJA 1DBTA 4MIMA 4NAFA 3TU9A 1UJQA 2OVLA 5EBUA 3OBEA 2DZXA 2QCDB 4YVPA 3IVUA 1Z3NA 5AHNA 5BOEA 5K9XA 1UWAA 5XIMA 3W73A 3N18A 2DH3A 4LEFA 1ZUAX 4ZQNA 3N15A 3PTMA 4LS2A 1T40A 4O4WA 4IPJA 5EKYA 3MI2A 5G5IA 3CH0A 2PWEA 3RMJA 1A5UA 3B4YA 1WAWA 1TX0A 1OADA 3PK7A 4QE1A 1AH4A 1GQIA 3P6LA 1NFBA 3DHDA 4Y96A 4E3TA 3ONCA 2NUXA 2IQ0A 4Z1CA 3ZJKA 3GH7A 3PAJA 3REQA 3VU2A 3VNIA 4E8DA 6REQA 5JBEA 3R12A 2WYSA 4O11A 1YBQA 2C0HA 2NXIA 2WSKA 1V3IA 3EKZA 4GUJA 3LZ3A 3KCLA 4NI8A 3PNZA 3EWBX 2BG5A 2OLHA 1JGMA 4ORMA 3V0UA 3OG2A 4US6A 4GVHA 5DF0A 3SSJA 2OSYA 2CKRA 2QNEA 3VKJA 1XC4A 2ZE3A 3GU2A 2PDBA 2D3NA 2VNCA 1AA1B 3SSZA 3BWWA 1PV8A 5F4XA 3VIIA 3HB9A 4UOQA 4EE9A 4AWEA 2OPJA 3F03K 1AMKA 4HGXA 4E2BA 1TPEA 6ALDA 2ZC8A 4CN1A 5LZLA 2DQWA 4JCMA 3V1PA 5KEZA 4PR4A 3VNMA 2WZMA 3T0BA 1G94A 3F1QA 1ZL1A 3TW7A 4RNJA 2QR6A 3NQ6A 1V0LA 3STGA 2HJPA 1ZAIA 3BL3A 4I9AA 7XIMA 1NWSA 1UH3A 2X30A 3AFBA 4HU8A 4H7ZA 2A6NA 1W1ZA 5JH2A 4OOUA 1QMLA 3TYAA 1GWJA 1XXXA 3RILA 1OCJA 4NUWA 1J0ZA 4N7QA 3I6EA 3O0FA 3WLQA 4JFWA 5CGQA 6TAAA 2CC0A 2V82A 1SO3A 4QJ3B 1DXIA 4RZ5A 5I77A 1HP5A 1A80A 2IW0A 5FIPA 1D3CA 3R43A 4J3TA 4HNLA 4Q4OA 3R8RA 3IVTA 2WBKA 3AZSA 4XISA 1NDVA 1FKWA 4H9VA 1DJXA 3AALA 1UWSA 2WHKA 1J5TA 3W2NA 2GJRA 3GB6A 2CBVA 2FGZA 3A24A 2WZHA 1KM3A 4HN4A 4FR6A 3NYZA 1QPQA 3GG8A 4QG8A 2R13A 4B5VA 2GQ3A 1NF7A 2VR5A 3L9CA 3ARXA 3PJTA 3L4XA 3WQWA 2PDCA 4O28A 3N4AA 3WD3A 1NWRA 5J04A 4GO8A 4U3CA 1V6VA 2YCJA 2YCLA 2Z28A 2R6OA 4XO7A 4K39A 4XAPA 3G1SA 4J40A 3SI9A 4CD6A 4B5WA 3RO6A 3UY8A 1U2YA 3ORWA 3GZAA 2DW7A 1AODA 1FFQA 1KFLA 1K4GA 1LDCA 2F9RA 4FS8A 1LWHA 4LUIA 1R3YA 5C2XA 1G1YA 2HVOA 4G9PA 3NUKA 3WNKA 3I7RA 1DP0A 4A22A 3N11A 2XINA 3EKGA 3WEOA 4AC7C 2D22A 1BGGA 1LJYA 5IBXC 2WOQA 4GC3A 4W5UA 3MP5A 2OOGA 1ZFJA 1M53A 3D3AA 3CEPA 2AAAA 4XUGA 1JCLA 1XINA 4TX8A 1FH7A 2Q09A 4GQRA 4HIBA 3UETA 3BCFA 4LX4A 3QHOA 1ZP3A 1FWNA 1ECEA 2NT0A 2WMKA 4D1JA 1KLZA 4JIPA 4ADTA 1JCJA 3E2RA 2XYLA 1UZ4A 3GH5A 3LMZA 5CPSA 7TAAA 4RUBA 1L2QA 2X42A 2WW5A 2GK1A 4F8XA 1C7SA 1MW0A 1IT0A 1A5CA 4EPBC 5FJIA 2D2GA 4CQAA 5EGRA 3N2BA 1PTGA 4KERA 4AMAA 2XIIA 3BOXA 2Z2AA 3B03A 1P7TA 2ZRWA 4GBUA 3HGJA 2OJPA 3HFYA 4BHYA 4LVFA 4AXNA 1EWDA 4WKAA 1OFBA 4F79A 1TWSA 4OBTA 4PODA 3LS9A 4BR1A 1CB2A 1PE1A 4Q6XA 4P8VA 1J0HA 4GO9A 4ZFMA 4GKLA 2ZZ5A 3BW4A 5D02A 1CBGA 2NSOA 2FTYA 4GGBA 4L61A 1EOMA 2EXOA 3GFXA 2PI6A 5F2LA 3WF2A 3W4RA 2DY3A 1K8XA 1XIBA 3T44A 5M5DA 5CJNA 4W8AA 5A8OA 2A79A 3PPFA 1E1CB 2BWGA 2LSMA 4LJ3A 2D69A 4AH7A 4HNUA 3CWHA 3KVJA 1M7OA 3EMQA 4ZODA 2ZOXA 1N7KA 5EMJA 4B4HA 1J0KA 1RPKA 4Y90A 1JJKA 2CLPA 3UVIA 3AUJA 1L6YA 5DEZA 4V33A 1ZNNA 3OIXA 2BASA 1B3ZA 4M5PA 3EW0A 5E93A 6CGTA 3DHUA 4X3ZA 4W8LA 3CQHA 3STCA 4IIHA 3W7QA 3S1XA 4R27A 2C79A 1RA0A 3GIQA 3UJFA 4L6OA 1IZCA 3UR2A 4JD4A 1V6XA 4P8WA 1OD8A 3HG3A 2GJXB 4NXSA 4DJED 3O0KA 4KEUA 5JU6A 3KVLA 4TU1A 3VIKA 2QLYA 2Y0FA 2W3ZA 4IX2A 1IHIA 3HU7A 3U7BA 2QMKA 2E9XD 2CZFA 1N8IA 3HGRA 3APYA 1V6YA 4Q8TA 3TLQA 3OLIA 2ZRXA 3W7NA 3G1FA 2CBJA 3WNOA 1S2WA 3M5ZA 4C6IA 3W7PA 4LQ1A 3DFNA 3GKAA 1W1IE 4LUYA 4G1KA 2A7RA 2XH7A 4YS1A 3NZQA 5HWNA 4P7OA 1F5ZA 1EYWA 1QASA 3PSWA 1UKOA 2Q9QB 1JDEA 1X96A 2P5NA 1HT6A 1OYCA 1HL8A 5LNWA 3UG8A 3C2RA 3UFYA 3CUXA 5AC6A 3CBWA 1I2PA 2PC4A 5CZTA 2XH0A 3FA3A 1ADSA 3E0LA 4Q8VA 4HCLA 3TAOA 4A2SA 1LQ2A 2WVSA 2D0GA 1UC4A 1QW9A 4JTJA 2GVEA 3L21A 3GC2A 4RDYA 2HNHA 4XAGA 5CGMA 4L1WA 1K8YA 3MSDA 3RO8A 1UA3A 1E3ZA 1M65A 3VGHA 1EFZA 3QMTA 3M6DA 2RAGA 3R0DA 4W89A 2JK2A 3TR9A 3CLWA 4PMQA 2CPUA 3MSYA 3WBYA 3U5UA 3W85A 4R53A 3BGAA 4AHPA 2YGYA 1ZBWA 5BWFA 1X8FA 4Q8WA 4L9XA 3RHGA 3ABXA 2VO5A 5H8MA 3W6MA 4LC8A 1BTCA 5FL1A 1PDYA 2XJ7A 2ZE0A 4DNMA 2BMBA 1J0IA 5D09A 1FWIC 1MEIA 4IUGA 2ZRUA 5LNUA 3WYZA 4W5ZA 1V0KA 2ZXDA 4H41A 3UZYA 2ZC1A 3I7SA 4UNKA 3CL7A 3AU6A 1ZSXA 4JX5A 5A69A 4ZB5A 3UZWA 1GQLA 2KZHA 4POCA 5I79A 3UF9A 4JTUA 1DJNA 3R2GA 2QVHA 3OPSA 3TN6A 2VZOA 1SUXA 5G2HA 1E9IA 1TV2A 4XAZA 1QPNA 1WKDA 1E6QM 4F9DA 4DBDA 3IJ7A 5T9CE 1S38A 1JCXA 3MVIA 3KZPA 3NQMA 4ZZ9A 2YL5A 1R3WA 3ABOA 3VIGA 4AY7A 4TV6A 4C60A 3W75A 4IPNB 4N4PA 1LM1A 4GBDA 3THDA 4IFRA 4CVUA 1JCMP 4HOWA 1LT7A 4OKDA 1W5NA 3EMCA 1JFXA 2EPHA 2ZA2A 3W86A 3BGJA 3SURA 2IS7A 3CGTA 1ZGDA 3GXNA 1EGVA 2XSXA 1A3XA 3H21A 5FJJA 3TX9A 4E38A 3IJIA 3HMJG 3O7UA 4US5A 1JZ5A 1JCNA 1WOAA 3ZLFA 3AMCA 1LQ0A 1O4UA 2WM1A 1PL9A 4B15A 5E6ZA 1EDQA 4LAKA 3SGZA 4ZXOA 3LQLA 1SZFA 1GNXA 2ODOA 2VOTA 4JTFA 1W9XA 3VNZA 3TBOA 1EP3A 4JIRA 1XYLA 3CV6A 3STEA 4KCWA 3VXGA 1ZZMA 4AISA 1J93A 1VS1A 2OLSA 2ZUTA 4E2DA 1BYBA 4OOZA 1VBRA 1GOQA 3M1ZA 4OVXA 3R7MA 3E0WA 3W0KA 3APGA 4PMOA 5IHRA 1B3WA 4KGJA 4ZO6A 3QTGA 3SJNA 3MVTA 2JKPA 2WJEA 2FJUB 3V5CA 3GAKA 3H53A 4PTNA 1BQCA 1WZKA 3LGEA 1J0JA 4C6NA 5EYWA 3E9AA 2PDWA 4ZO7A 4B5SA 4CQBA 1OGSA 4ROPA 3DDMA 3GXIA 1MXDA 1E6RA 2EKCA 2V5KA 4DJFA 4W87A 2VTFA 3QC0A 4P8UA 3OHMB 4H6EA 2FZNA 2QCMA 1WBHA 1U83A 5IM51 3C0JA 4IQDA 4IX0A 1GJPA 5CG0A 4HTBA 1S1RA 4FOUA 2FH8A 4H8VA 3TTEA 1XDJA 2RFGA 2QS8A 4MNMA 4O1BA 3VO0A 1GYNA 1TA3B 4QROA 1ICQA 2OKTA 4FHAA 3UGRA 4K6AA 3UCQA 1US3A 4LRSA 5FEPA 3NURA 4DJEC 5HR6A 3AICA 1DJIA 3CQIA 3BPWA 3WY1A 4A3HA 2J7DA 3SRKA 1RLCL 2ABBA 3A4XA 3GU9A 2WC3A 3MKCA 3STFA 3CZGA 2X1SA 2QAPA 1LL7A 3MWCA 3TAKA 3H2OA 1RJQA 1Q6RA 2XM2A 3BLLA 2QDDA 2ZVIA 4UTWA 1GVSA 5E9XA 5KTLA 2F84A 1E40A 1EC9A 4CNUA 4GGHA 1C9DA 4LV4A 4CCEA 2CERA 3L5LA 4HB7A 3VM5A 3KS5A 3PVFA 2GJPA 2NWRA 3CQJA 2FGLA 1DQUA 4YTUA 1I0DA 1FHVA 4GACA 5GVJA 4QCEA 5LHEA 3LGGA 4GX9A 1XP3A 4RNHA 3GC5A 1WXYA 1T8XA 1QNPA 1B5TA 3GXFA 2BHZA 2EKGA 1GTHA 2H8ZA 3BC9A 3E3HA 1ENUA 1ICPA 3KW3A 3K4AA 1MW1A 1NSJA 3TNBA 2Z1KA 1XLCA 3L0GA 2HBBA 1JPIA 1UR9A 3C2VA 4F2UA 4DYJA 3BOFA 3FIGA 1ZCOA 3JZUA 1CNVA 4R7JA 4XD5A 4ZSTA 5REQA 1EZWA 2XH2A 3EOSA 3BURA 2QD0A 3TVAA 2F2HA 2HXTA 2DVUA 3EB3A 1GYMA 1W5PA 4UZUA 1DWGM 1FBAA 3GIPA 3U2ZA 2QMJA 1I0BA 1PIIA 1IXQA 3W29A 4O0ZA 5AC4A 1JVNA 3RF9A 4LOCA 3OQEA 1PJ9A 1GEHA 5FF4A 2ZXAA 1CXHA 1GOMA 3WLHA 3K30A 3K1DA 3WLLA 1V93A 3PZGA 2GOKA 3MJMA 4CQDA 1HVXA 2QDHA 3PJUA 2ZZ6A 3NVDA 3AMKA 2MNRA 4LVDA 3MT1A 2SFPA 2PCQA 4B3KA 4HK5A 4A3QA 3OGRA 3W25A 2PCEA 4Q4RA 3W1MA 4ATDA 4AD4A 2YPIA 1IYXA 3AJXA 4XSLA 3TJLA 5HATA 3EKLA 2IPFA 2W6RA 4QJ4B 4QP0A 2ZUNA 4ZE4A 7CGTA 2A3EA 1WBJA 4GUGA 3NO5A 3QJAA 1XPYA 1H1NA 1VHNA 3GUGA 4DZ5A 2C14A 4INFA 4BF7A 3ZXWA 2VFIA 1P4CA 3R0UA 4S38A 3SRFA 1WDRA 5E0KA 3G3DA 3LGDA 4PTXA 4AY1A 2BVWA 4FF5A 2V5JA 3BW3A 5E9AA 3I4KA 3NDOA 4DI8A 3C56A 1TJPA 4M1RA 3T78A 3QSRA 5HK4A 4HPHA 3MU7A 2AMGA 2C3ZA 3R8HA 1BQGA 2FPYA 2REQA 1FX6A 4GVGA 1EGZA 2Z6IA 5DRIA 3SY5A 3D6NA 5HNTA 4H2CA 3A64A 1JCYA 4JCLA 3RM8A 4L4LA 2J27A 4BWLA 2NUWA 5FF0A 3RCMA 2B81A 1DIOA 3U48A 3BAKA 5HQMA 2PTDA 3I3DA 5LIYX 1IIHA 4CU6A 1YLVA 1FWTA 4P2VA 3LPPA 5H2ZA 4GJJA 1CQUA 1VFTA 3GXTA 4ZCWA 3HQ1A 4F2TA 2E68A 3CHVA 5GJMA 4LS1A 2GUBA 3V18A 1Q8JA 2Y4SA 1W6TA 4RR4A 5AYYA 1ZTVA 1I4NA 2P3EA 3ITYA 3VILA 1E1CA 4FAMA 4PE8A 1Q6FA 3TP4A 1NJJA 1SFSA 4J9JA 3BLKA 4H9ZA 1A3WA 4HMCA 1LOLA 3CH9A 3PJXA 2X0SA 4PCPA 1Y65A 4AIEA 4NL1A 3LXBA 3VE7A 2X1TA 3ZVHA 1UIPA 1G5AA 3WMLA 2EGZA 1EUAA 3WSUA 2WVVA 1XR2A 4BEUA 2XSBA 1P6WA 5FSDC 3GNPA 1GT8A 1XSIA 1H50A 1A5MC 1CENA 3GFZA 2RDUA 4HA0A 3TONA 2IPGA 2HISA 3PZTA 2V2DA 1KW1A 1KBKA 2HWGA 4GVFA 2WBGA 1QFEA 4K8HA 1V0MA 5D9PA 5F4WA 1UW9A 3DI1A 1W8GA 5LYRA 4NI3A 4PSPA 1LBLA 4PMNA 1V0NA 1KXHA 3DESA 3LPGA 4HD5A 3DBPA 3F2BA 5U7SA 4AZCB 3MA8A 8RUCA 4NJJA 3ARPA 4Y9MA 4YHEA 3MTWA 3KFTA 3IIOA 2E7FA 4IG2B 4K2SA 1BWKA 1TCDA 3SUTA 6A3HA 2OWWA 2VC7A 1HXJA 4Z42C 4W7WA 4MJZA 3M7WA 2YW3A 3FHQA 4DO5A 4L4PA 2ZRVA 3BAWA 4J3XA 3F4NA 1MDLA 4BS0A 3OEXA 3WQCA 1KCLA 3BLIA 3MJYA 2CWNA 1EP1A 1MZHA 2OX4A 1CGVA 1JZ6A 2HCVA 5FA5A 4H7VA 4MLJA 1W9BM 5CH9A 5DRCA 1LUCA 3WLPA 2OZ3A 5D03A 4O50A 4OE7A 1C8XA 2V69A 2EPLX 1QNOA 4LEQA 4JN6A 5HJXA 1G6CA 4GWEA 1WP6A 2YB4A 3NJ3A 2V3EA 3CUZA 4HOXA 3UR8A 4ZA0A 1EA9C 4UCFA 3IWPA 3CK5A 2PDNA 1MQPA 1CXLA 4MAVA 2OSXA 2GSEA 1K9EA 5IFTA 4H9MA 5BXPA 3UCCA 2C91A 3P8IA 3N3MA 1BWVA 3HTWA 2QXWA 5HMDA 3EWDA 2ISDA 2YA2A 2AMXA 3HGSA 3NM3A 3OLGA 4H1ZA 1XQKA 1NOUA 2VM8A 4XTDA 1C8VA 5L9FA 3EXSA 1FHLA 3UWUA 3WJXA 4DUVA 5A6LA 3BANA 3WUBA 1KBJA 1VZWA 2ALRA 1ECQA 1KFKA 3LTSA 3KBJA 3CZLA 4P61A 3TR2A 4KRUA 1W1VA 2DT3A 3PBGA 3VGEA 3DC0A 2W5FA 1NU5A 2PB1A 3PNUA 3A22A 3RCNA 5FF7A 4JQ1A 1R2SA 4MZYA 4XVEA 4GNKB 1WKYA 1KCKA 4V15A 1O5KA 3UZJA 3LD5A 5TBOA 1MRAA 3TNOA 1JPDX 4HHHA 5CC7A 1VFHA 1A5OC 2WAGA 2X09A 4PBGA 4F0KA 3IJ8A 2WMHA 4F9JA 1BLIA 4MZ8A 3F2CA 4HPXA 4NQ1A 4LANA 2YBTA 1XC6A 4BF5A 3W7RA 1JCTA 5AKQA 4KEVA 2J9YA 2E8ZA 5IFPA 1LROA 2E9BA 1AQFA 4JXCA 3EWYA 1BSIA 3GDKA 4WY0F 5FJTA 4AWTA 1Q6OA 3PTKA 3MO4A 1Q13A 2QUNA 1UH2A 3A4AA 2Q02A 3BARA 4TXEA 3UZ5A 3LSBA 1HO4A 3FYPA 3U7VA 4HHLA 1Q8AA 1H41A 3AISA 4FLRA 2I14A 1M7PA 3RFAA 1W2PA 3W72A 4AD3A 1AL8A 1PVNA 1ICSA 2CW6A 5E0CA 2CITA 4S2CA 3KTSA 4NU7A 3H6OA 1CT5A 1XI3A 2AGTA 1LP6A 1EWEA 3R13A 1U33A 1K7FA 1W2VA 4NXKA 4Q4KA 3MC5A 1A4MA 4GQBA 3S0CA 2B7PA 1XLLA 3P0XA 4XBJA 1TTQA 2YA1A 3F4VA 1V7AA 3WMCA 3FEMA 1MQQA 4HJFA 2I5QA 4GY0A 4QQUA 5BXRA 3WBWA 4HBKA 4AB4A 1GONA 3KLLA 5C54A 4H04A 3IUIA 1VIWA 4LW7A 1DXFA 3GR4A 4H2HA 3AS2A 3PF3A 2ACRA 1OB0A 4N6EA 1Q7QA 3IRSA 3HF3A 3LI0A 2OZ0A 2YL9A 4G7EA 1RVKA 1QPOA 2WANA 3NDYA 1LL6A 1X1OA 3WUGA 1ADDA 4TQTA 1TWZA 3W1AA 3R4IA 4AZGA 3LK6A 1QK0A 3N4EA 2OU4A 3WDHA 1QU4A 5DELA 1P48A 4JFTA 3WLOA 4E2VA 3OO2A 4EXBA 2PF8A 1LORA 3KS6A 1K03A 1E9LA 3H22A 3O16A 4DB7A 1I1XA 4YWSA 5BNKA 2A5HA 2VR4A 4HN8A 4JIIX 2VGFA 5H8UA 5MKGB 3U6WA 4FIQA 3PN8A 1S5NA 3PWGA 3A5FA 3N2TA 4RXGA 4S2BA 3S2MA 5C7VA 1TWDA 2DJLA 4IF2A 3THAA 4OECA 4EXAA 4G5DA 3H4WA 1ODUA 1XRSA 1C9WA 4CQCA 5JUVA 3MMTA 1R5YA 3AIUA 4HK7A 2V5CA 2QUTA 4IUOA 4ZGYA 3NZ1A 4HJWA 3RX3A 2QCCA 1VPYA 3T40A 2Z4GA 1D3GA 3BMXA 3COTA 3GNRA 2ZWZA 1M01A 1YMYA 2IKIA 1YNYA 1HGYA 1J18A 1BF6A 1HNYA 3KEHA 3PZIA 1OM0A 3N2MA 1UWIA 1UIOA 4PFHA 1H09A 3DG7A 1W1A1 2Q3OA 1NQKA 4JKLA 1A5KC 1XBZA 2EPNA 3GNXA 1K8CA 2H8XA 3GK0A 1G4PA 4R33A 3ME3A 4AZ6A 4JL1A 4MWAB 1S1PA 3HBLA 3TBNA 2PD5A 1V51A 1FWHC 1ZALA 1J11A 5A6JA 2FDMA 1M7XA 2DZUA 3G3MA 1QNVA 3UR5A 1OWQA 2VCCA 4PUEA 1G4EA 1XRFA 1BGAA 4DF1A 1GKPA 1E1FA 1A0DA 4PUUA 3T0AA 1DWFM 2PDMA 5CBJA 2VGIA 2QW5A 4H9TA 1O6IA 1SFTA 3N4FA 3P5ZA 1DTUA 1PBGA 3TTSA 2HZGA 1NQ6A 1GG1A 2R82A 1UA7A 3M0ZA 4I9JA 1W3NA 4XAYA 1TPFA 4GH1A 3IK4A 2YXGA 4O53A 1C8YA 3WDRA 5JIPA 3MMUA 3ZS4A 3TKFA 4UFHA 1L8NA 2VOMA 3ALGA 3QZ6A 3BSMA 1X7IA 1KO0A 2CZ5A 3G18A 1JF6A 1EBHA 1D8WA 4PEEA 4IMDA 2PTZA 1H49A 4WOZA 4JTEA 4LUSB 4EPKA 2Z1SA 2WMFA 3NSXA 2RKXA 5A6AA 1R7OA 1R3VA 1NM9A 1CXKA 1PKYA 2C16A 1PSCA 4PMUA 3GC4A 3HOJA 1P0KA 2H90A 3W24A 1CLVA 2PDUA 3S83A 3NWRA 5DMNA 1ZENA 1EJRC 4ICNA 3EX2A 1XLFA 1H61A 4G56A 4KWSA 3OA5A 3REEA 3S2LA 2B7QA 3WD0A 4X60A 4H7CA 2Y1HA 3HQPA 1DWHM 1YYAA 2NQJA 2J88A 3CNYA 4E4PA 1TV3A 4P7NA 2GGJA 1I75A 3INPA 3H2FA 3EXTA 1UC5A 1Q6GA 3GVGA 3N2XA 1HL9A 2PLCA 3AO0A 4TVCA 2EJAA 2X4AA 1OFRA 1E0WA 3GNNA 2HTMA 2VJXA 3UXLA 2WV8A 1TZ9A 4CVWA 3BXWA 3ES7A 1OYBA 3T0DA 2ZZ3A 1SM9A 1LZOA 3CB8A 4U2YA 4NX5A 2B7NA 2VC9A 3W1RA 1OG6A 1NOWA 4QRNA 2F2KA 3ARRA 5DO8A 1KRCC 1QVBA 4A8RA 2WZEA 3LRKA 4WGHA 1KFJA 2VRKA 3L5MA 5XIAA 5HPOA 4OJYA 4AUBA 4Q6JA 1RD5A 3M0JA 2X2YA 2E40A 3E5BA 4NHVA 2PDPA 4KW7A 1R86A 2C1IA 2ASHA 4XUYA 4BCEA 4FOJA 1U5HA 1HX0A 4HU4A 2F61A 1EH9A 2XVGA 3VIMA 4NAFB 2WO5A 5F4SA 1NY1A 3PR2A 3KP1A 4ZFCA 3ZWSA 5TAOA 3QR3A 4IPLA 4LAUA 3G1YA 3GDBA 4D6FA 1B9ZA 4PH6A 3BICA 2FHFA 1NDWA 3LRLA 1TYGA 3CQKA 3AYVA 2XIBA 1XL9A 4QHRA 1W9DM 1Q66A 3SN4A 1BYAA 3VDHA 1VAHA 1MUCA 3QC3A 5D9MA 1WAUA 5ECVA 1VBGA 4C7DA 4ATWA 4UFKA 5GPRA 5BMWA 5AYBA 4QAWA 1PKNA 4WQ6A 2G0WA 1E4MM 1FHUA 2A4AA 4QEHA 1T7LA 2HBAA 3LYEA 4M29A 5A1AA 4LNCA 2J78A 1HKVA 4S3BA 4DJDA 2VEKA 3H8AA 4BFAA 3XINA 1E6NA 5HUOA 1V77A 4PMZA 1OT2A 3A4JA 1TVNA 3VKAA 2E1WA 3W28A 4O13A 4M51A 3EXRA 4JKKA 1OFQA 3PJWA 4XO6A 2VGBA 4A3RA 4IPPA 1GVRA 4LAZA 5EG5A 1VCFA 5EB8A 3UGVA 3K1GA 4HKPA 2WZTA 1JFHA 5CSSA 3D46A 3PPHA 2JKEA 2PWVA 1RAKA 3MKKA 4UTKA 4FSDA 3URBA 2J79A 4I5XA 2RH9A 3RIKA 3KWSA 4HSOA 2QYGA 4LCQA 3H4XA 2V2HA 3GDRA 2HJQA 3P80A 4IP5A 1Q2SA 1SMAA 2D20A 3MV11 1DIKA 3UA3A 1KTCA 2W62A 3EPMA 2OT1A 3TYBA 1PXGA 4QNEA 1KR0A 3W7CA 3SN0A 2PDFA 2PDGA 3M5VA 3W53A 1JXJA 2PPGA 3QBUA 3LLFA 2J7CA 3QGKC 3QOKA 4TVUA 3DI0A 3S6OA 1FH9A 3ZSSA 4G1NA 4CQ8A 3NSNA 2XFRA 1XBXA 1FWGC 2A85A 3C4UA 1I2OA 2NSXA 3N6QA 2FZDA 5KINA 2VZUA 5DFAA 4IOTA 1BRLA 2W63A 2UY2A 1TTJA 3RJXA 1R9XA 3B8VA 5A8MA 1D7KA 1XKYA 3UZZA 2ON3A 2V30A 1OVDA 4OO7A 2HQAA 1X97A 2ZX6A 1GVFA 4Q4SA 1IQ8A 2E6YA 3VOCA 1FDZA 4KMQA 5D05A 2I57A 2VX7A 5JVLA 4B9ZA 1GKRA 4L9YA 2Z00A 1E0VA 3KBSA 1ME7A 1OZQA 4L6DA 2Z7GA 4D6HA 1WNOA 3B0VC 4M0XA 6XIMA 3VIPA 4AX7A 2VL4A 3M0MA 4L65A 5CLWA 3K8MA 4FPSA 3CXOA