1IOJA

Human apolipoprotein c-i, nmr, 18 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apolipoprotein
molecule keywords APOC-I
publication title Conformation of human apolipoprotein C-I in a lipid-mimetic environment determined by CD and NMR spectroscopy.
pubmed doi rcsb
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04691 ApoC-I Apolipoprotein C-I (ApoC-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.260.30 Few Secondary Structures Irregular G Protein Gi Gamma 2 G Protein Gi Gamma 2 1iojA00
1IOJA
chains in the Genus database with same CATH superfamily
3CIKG 1GP2G 3V5WG 3AH8G 5HE1G 4MK0G 4KFMG 1GOTG 1TBGE 1GG2G 4PNKG 1IOJA 2PBIA 1OMWG 3PSCG 3PVWG 3SN6G 3KRWG 5HE3G 3KRXG 1XHMB 2BCJG 2TRCG 5HE2G 5HE0G 1B9YB 1B9XB 1A0RG 1HFES 5TDHG 5KDOG 3PVUG
chains in the Genus database with same CATH topology
1IOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOJ A; 
#chains in the Genus database with same CATH topology
 3CIK G;  1GP2 G;  3V5W G;  3AH8 G;  5HE1 G;  4MK0 G;  4KFM G;  1GOT G;  1TBG E;  1GG2 G;  4PNK G;  1IOJ A;  2PBI A;  1OMW G;  3PSC G;  3PVW G;  3SN6 G;  3KRW G;  5HE3 G;  3KRX G;  1XHM B;  2BCJ G;  2TRC G;  5HE2 G;  5HE0 G;  1B9Y B;  1B9X B;  1A0R G;  1HFE S;  5TDH G;  5KDO G;  3PVU G; 
#chains in the Genus database with same CATH homology
 1IOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...