1WS4A

Crystal structure of jacalin- me-alpha-mannose complex: promiscuity vs specificity
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHVSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the energetics of jacalin-sugar interactions: promiscuity versus specificity
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 1ws4A00
3MIUA 5EXGA 5BN6E 1WS4A 3AQGA 3LLZA 3MITA 5J4TA 1WS5A 1JOTA 5J51A 2GTYA 4GX7A 1C3MA 1J4UA 4PIKA 4PIFA 2BN0A 1JACA 2GUEA 3R52A 3LL1A 1X1VA 1TOQA 1XEZA 4R6PA 3LL0A 2NUOA 3O44A 4R6OA 1M26A 2BMYA 3APAA 2GUXA 1TP8A 3VY6A 2GUCA 1UGWA 3VZGA 1XXQA 1KU8A 1UGXA 4AK4A 4DDNA 2JZ4A 1C3NA 4R6RA 3WOBA 3R50A 1VBPA 5JM1A 3P8SA 1J4SA 1UH0A 5J4XA 3LLYA 5J50A 5AV7A 2NU5A 1XXRA 1WS4C 1ZGSA 1OUWA 3MIVA 1VBOA 4PITA 3VZFA 1J4TA 4R6NA 1WS5C 1UGYC 4R6QA 1ZGRA 3LKYA 2HYRA 3R51A 4AKCA 4PIUA 2HYQA 1UGYA 4AKBA 4MQ0A 4WOGA 2GUDA 1C3KA 2BMZA 1KUJA 1UH1A 3LL2A 3LM1A 3VZEA 3VY7A 3WOCA 4AKDA 1UGWC 1PXDA
chains in the Genus database with same CATH superfamily
3MIUA 5EXGA 5BN6E 4QX0A 1WS4A 3AQGA 3LLZA 3MITA 5J4TA 1WS5A 1JOTA 1DLCA 5J51A 2GTYA 4GX7A 1C3MA 1J4UA 4PIKA 4D8MA 4PIFA 2BN0A 1JACA 2GUEA 3R52A 3LL1A 1X1VA 1TOQA 1XEZA 4R6PA 3LL0A 1JI6A 2NUOA 4ARXA 4QX1A 1W99A 3O44A 4R6OA 1M26A 2BMYA 3APAA 2GUXA 1TP8A 3VY6A 2GUCA 1UGWA 3VZGA 2C9KA 1XXQA 1KU8A 1UGXA 4AK4A 4DDNA 2JZ4A 1C3NA 3TOWA 2QP2A 4W8JA 4R6RA 3WOBA 3R50A 1VBPA 5JM1A 3P8SA 1J4SA 1UH0A 5J4XA 3LLYA 4MOAA 5J50A 5AV7A 4QX3A 2NU5A 1XXRA 1WS4C 1ZGSA 1OUWA 3MIVA 1VBOA 4PITA 3VZFA 1J4TA 4R6NA 1WS5C 1CIYA 1UGYC 4QX2A 4R6QA 1ZGRA 3LKYA 2HYRA 3R51A 4AKCA 4PIUA 1I5PA 2HYQA 1UGYA 3EB7A 4AKBA 4MQ0A 4WOGA 2GUDA 1C3KA 2BMZA 1KUJA 1UH1A 3LL2A 3LM1A 3VZEA 3VY7A 3WOCA 1VMOA 4AKDA 1UGWC 4ARYA 1PXDA
chains in the Genus database with same CATH topology
3MIUA 5EXGA 5BN6E 1WS4A 3AQGA 3LLZA 3MITA 5J4TA 1WS5A 1JOTA 5J51A 2GTYA 4GX7A 1C3MA 1J4UA 4PIKA 4PIFA 2BN0A 1JACA 2GUEA 3R52A 3LL1A 1X1VA 1TOQA 1XEZA 4R6PA 3LL0A 2NUOA 3O44A 4R6OA 1M26A 2BMYA 3APAA 2GUXA 1TP8A 3VY6A 2GUCA 1UGWA 3VZGA 1XXQA 1KU8A 1UGXA 4AK4A 4DDNA 2JZ4A 1C3NA 4R6RA 3WOBA 3R50A 1VBPA 5JM1A 3P8SA 1J4SA 1UH0A 5J4XA 3LLYA 5J50A 5AV7A 2NU5A 1XXRA 1WS4C 1ZGSA 1OUWA 3MIVA 1VBOA 4PITA 3VZFA 1J4TA 4R6NA 1WS5C 1UGYC 4R6QA 1ZGRA 3LKYA 2HYRA 3R51A 4AKCA 4PIUA 2HYQA 1UGYA 4AKBA 4MQ0A 4WOGA 2GUDA 1C3KA 2BMZA 1KUJA 1UH1A 3LL2A 3LM1A 3VZEA 3VY7A 3WOCA 4AKDA 1UGWC 1PXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MIU A;  5EXG A;  5BN6 E;  1WS4 A;  3AQG A;  3LLZ A;  3MIT A;  5J4T A;  1WS5 A;  1JOT A;  5J51 A;  2GTY A;  4GX7 A;  1C3M A;  1J4U A;  4PIK A;  4PIF A;  2BN0 A;  1JAC A;  2GUE A;  3R52 A;  3LL1 A;  1X1V A;  1TOQ A;  1XEZ A;  4R6P A;  3LL0 A;  2NUO A;  3O44 A;  4R6O A;  1M26 A;  2BMY A;  3APA A;  2GUX A;  1TP8 A;  3VY6 A;  2GUC A;  1UGW A;  3VZG A;  1XXQ A;  1KU8 A;  1UGX A;  4AK4 A;  4DDN A;  2JZ4 A;  1C3N A;  4R6R A;  3WOB A;  3R50 A;  1VBP A;  5JM1 A;  3P8S A;  1J4S A;  1UH0 A;  5J4X A;  3LLY A;  5J50 A;  5AV7 A;  2NU5 A;  1XXR A;  1WS4 C;  1ZGS A;  1OUW A;  3MIV A;  1VBO A;  4PIT A;  3VZF A;  1J4T A;  4R6N A;  1WS5 C;  1UGY C;  4R6Q A;  1ZGR A;  3LKY A;  2HYR A;  3R51 A;  4AKC A;  4PIU A;  2HYQ A;  1UGY A;  4AKB A;  4MQ0 A;  4WOG A;  2GUD A;  1C3K A;  2BMZ A;  1KUJ A;  1UH1 A;  3LL2 A;  3LM1 A;  3VZE A;  3VY7 A;  3WOC A;  4AKD A;  1UGW C;  1PXD A; 
#chains in the Genus database with same CATH topology
 3MIU A;  5EXG A;  5BN6 E;  4QX0 A;  1WS4 A;  3AQG A;  3LLZ A;  3MIT A;  5J4T A;  1WS5 A;  1JOT A;  1DLC A;  5J51 A;  2GTY A;  4GX7 A;  1C3M A;  1J4U A;  4PIK A;  4D8M A;  4PIF A;  2BN0 A;  1JAC A;  2GUE A;  3R52 A;  3LL1 A;  1X1V A;  1TOQ A;  1XEZ A;  4R6P A;  3LL0 A;  1JI6 A;  2NUO A;  4ARX A;  4QX1 A;  1W99 A;  3O44 A;  4R6O A;  1M26 A;  2BMY A;  3APA A;  2GUX A;  1TP8 A;  3VY6 A;  2GUC A;  1UGW A;  3VZG A;  2C9K A;  1XXQ A;  1KU8 A;  1UGX A;  4AK4 A;  4DDN A;  2JZ4 A;  1C3N A;  3TOW A;  2QP2 A;  4W8J A;  4R6R A;  3WOB A;  3R50 A;  1VBP A;  5JM1 A;  3P8S A;  1J4S A;  1UH0 A;  5J4X A;  3LLY A;  4MOA A;  5J50 A;  5AV7 A;  4QX3 A;  2NU5 A;  1XXR A;  1WS4 C;  1ZGS A;  1OUW A;  3MIV A;  1VBO A;  4PIT A;  3VZF A;  1J4T A;  4R6N A;  1WS5 C;  1CIY A;  1UGY C;  4QX2 A;  4R6Q A;  1ZGR A;  3LKY A;  2HYR A;  3R51 A;  4AKC A;  4PIU A;  1I5P A;  2HYQ A;  1UGY A;  3EB7 A;  4AKB A;  4MQ0 A;  4WOG A;  2GUD A;  1C3K A;  2BMZ A;  1KUJ A;  1UH1 A;  3LL2 A;  3LM1 A;  3VZE A;  3VY7 A;  3WOC A;  1VMO A;  4AKD A;  1UGW C;  4ARY A;  1PXD A; 
#chains in the Genus database with same CATH homology
 3MIU A;  5EXG A;  5BN6 E;  1WS4 A;  3AQG A;  3LLZ A;  3MIT A;  5J4T A;  1WS5 A;  1JOT A;  5J51 A;  2GTY A;  4GX7 A;  1C3M A;  1J4U A;  4PIK A;  4PIF A;  2BN0 A;  1JAC A;  2GUE A;  3R52 A;  3LL1 A;  1X1V A;  1TOQ A;  1XEZ A;  4R6P A;  3LL0 A;  2NUO A;  3O44 A;  4R6O A;  1M26 A;  2BMY A;  3APA A;  2GUX A;  1TP8 A;  3VY6 A;  2GUC A;  1UGW A;  3VZG A;  1XXQ A;  1KU8 A;  1UGX A;  4AK4 A;  4DDN A;  2JZ4 A;  1C3N A;  4R6R A;  3WOB A;  3R50 A;  1VBP A;  5JM1 A;  3P8S A;  1J4S A;  1UH0 A;  5J4X A;  3LLY A;  5J50 A;  5AV7 A;  2NU5 A;  1XXR A;  1WS4 C;  1ZGS A;  1OUW A;  3MIV A;  1VBO A;  4PIT A;  3VZF A;  1J4T A;  4R6N A;  1WS5 C;  1UGY C;  4R6Q A;  1ZGR A;  3LKY A;  2HYR A;  3R51 A;  4AKC A;  4PIU A;  2HYQ A;  1UGY A;  4AKB A;  4MQ0 A;  4WOG A;  2GUD A;  1C3K A;  2BMZ A;  1KUJ A;  1UH1 A;  3LL2 A;  3LM1 A;  3VZE A;  3VY7 A;  3WOC A;  4AKD A;  1UGW C;  1PXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...