1CIYA

Insecticidal toxin: structure and channel formation
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
577
structure length
577
Chain Sequence
YTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPSTIYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus thuringiensis CryIA(a) insecticidal toxin: crystal structure and channel formation.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Toxin
molecule keywords CRYIA(A)
total genus 182
structure length 577
sequence length 577
ec nomenclature
pdb deposition date 1995-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00555 Endotoxin_M delta endotoxin
A PF03944 Endotoxin_C delta endotoxin
A PF03945 Endotoxin_N delta endotoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.190.10 Mainly Alpha Up-down Bundle Delta-Endotoxin; domain 1 Pesticidal crystal protein, N-terminal domain 1ciyA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1ciyA03
2.100.10.10 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Pesticidal crystal protein, central domain 1ciyA02
3LPFA 4XUQA 3WF1A 1UMIA 2WABA 4DXSA 1W8NA 1UY4A 4DUWA 4MOAA 2X05A 5LA1A 2WO3A 1US3A 3CKHA 2Z4FA 4QDRA 4UI9L 1JZ3A 4E8DA 5FUIA 3J7HA 2ZXQA 3A23A 3W5NA 2X10A 3AC0A 2LW8A 3T09A 4KWUA 1ULOA 3MV11 2JD9A 4PF1A 5EIYB 2VZSA 1US2A 2W1QA 2J1RA 2VC9A 2W47A 4JX0A 3HNYM 3K4AA 5JMOA 1PX4A 1IQDC 2HLEA 2W94A 4OZOA 2VM9A 2QBXA 1W8OA 1UYZA 2W3JA 2XOMA 2XQXA 2WN3A 3OGVA 3GXUA 4RYDA 4XUTA 1PMJX 3I3EA 3GGLA 1W0NA 2CDOA 3MV01 3PUHA 4GWJA 3I2GA 1HN1A 4RN5A 1K42A 1GOFA 3GDBA 3DYOA 4P5YA 4BDVB 3T2QA 4YPJA 4LHSA 5JXIA 3HNMA 3A22A 2VMFA 3E1F1 1O59A 3MO4A 1RYYA 2J1VA 3LE0A 5B4XA 3HPNA 3VD5A 2VZPA 2DDUA 4A44A 1W9SA 2CDPA 3I2KA 1K12A 3I2IA 3VDAA 2WBKA 2PQSA 5HXMA 1GU3A 4ZZ8A 3I2HA 2C9KA 2BERA 3VD9A 1KGYA 2J1UA 5JR2A 3C7OA 1UYXA 2EIEA 4DEQA 1UZ0A 4XVHA 3NJVA 4ZXEA 5JUVA 3OBAA 3CZUA 3ETPA 1GOHA 5DMYA 1LNSA 4HG6B 2WO1A 4GZ9A 4CU9A 2W92A 3OGRA 3NNGA 3CIHA 1F4AA 3WNMA 2WZEA 3VD4A 1R64A 1SDDB 1EUTA 4TTGA 5IFPA 2Y6GA 4A3ZA 3WNPA 3ACHA 2B4KA 4DEVA 4QDSA 2XONA 3ZM8A 4CVUA 1XNAA 3CDZB 3D3AA 1D7PM 1O8PA 1K3IA 3HEIA 2OKXA 1CZVA 3I3BA 2QQMA 4LQRA 3SEPA 5CYYA 2ZEZA 1NX9A 4PQQA 3I97A 4IUGA 1I5PA 1W9WA 3FL7A 5JXGA 2DCKA 3DYMA 3JXSA 4CUCA 5IJRA 1JZ6A 4A45A 1W9TA 2VCCA 2VCBA 3MBWA 1T2XA 2WUHA 2BBAA 1MPXA 2W46A 1SHWB 3ACGA 1EUUA 2QQKA 3THCA 3U37A 2J1TA 3WNNA 4P00B 2E26A 3OG2A 1WCQA 1XC6A 2L9LA 3A21A 5G05L 4DXRA 3HOBA 2VZQA 3IAQA 4FI9A 4AAXA 3ABZA 2X09A 3SEEA 3C7FA 4W8JA 1BHGA 4DUXA 3WQBA 3SKJE 2W91A 2J1EA 2VZTA 3WNLA 1GQPA 1W99A 4D0QA 5B4NA 3I3DA 3BN6A 1H6XA 2XHNA 2WN2A 4ARXA 4OMCA 3WEZA 1JYNA 2ID4A 2QQNA 4QX3A 4ZY9A 2ORXA 3LQCA 4QDQA 2BGOA 4QX0A 3WNKA 1CIYA 3I2FA 4LKSA 4P02B 4LPLA 3ACFA 1UY2A 4XURA 3P6BA 2RV9A 5DPNA 1UWWA 1CZTA 3WF0A 4CU6A 3OB8A 4JKKA 5EJZB 1O8SA 2VCAA 3IIIA 2QQIA 3IB3A 4ARYA 4P08A 4QX2A 2EIDA 2J7MA 4Z2AA 3THDA 3MUY1 5C71A 3WSOA 1DP0A 1XNTA 2Y8KA 2EIBA 1SG3A 4CUBA 4L0PA 2JKXA 5JXHA 3BGAA 3T08A 2VO5A 3DYPA 1TG7A 2VMDA 2VQTA 1UX7A 3NJXA 2B9VA 3HNBM 1JZ4A 2VZRA 1L7QA 4OMDA 1WKYA 3ECQA 3T0AA 2E31A 1CZSA 1GMMA 3WF4A 1P8JA 3CQOA 2Y64A 4QB6A 2QQLA 4BXSV 2ZEXA 2W87A 3K4DA 2Y6JA 4QB1A 4A6OA 3FHQA 3P1IA 2WAOA 2BGPA 4KMQA 5F7UA 3X0UA 2QQJA 3IDAA 2DCJA 3LEIA 2YB7A 1OF4A 2VZUA 2E33A 3VD3A 1JZ8A 2Y6LA 5CZKA 1GUIA 2W1UA 5IYYA 2Y6KA 5LA0A 1NUKA 4XUPA 5DN2A 3WF2A 3VDBA 4QPWA 2V5DA 4W50A 5IHRA 4CU8A 4M4PA 2ORZA 2EICA 3HJRA 2C4XA 3T0BA 2WQ8A 1UXZA 4ZZ5A 1JZ5A 3ACIA 4OUEA 1UY0A 2VMCA 4KI5M 1JZ7A 3OEAA 2J22A 1GOGA 2W9XA 4D8MA 1GNYA 2JDAA 5LCWL 2ZEWA 1PX3A 2WYSA 4E8CA 5HPOA 2VQUA 4UOJA 5C70A 4BJ0A 3FHAA 3NRUA 2YFUA 4JKLA 3NQHA 3W5MA 2HYXA 1NKGA 4MGQA 4UAPA 4XUNA 3C8XA 2W1SA 3SKVA 2WAAA 1JHJA 1OT5A 2VZOA 1F4HA 1JZ2A 2VJXA 3F2ZA 2WZ8A 3T0DA 3MUZ1 2BZDA 2YC2A 3K75B 3T2PA 4W4ZA 2W5FA 4BK4A 3LEKA 2V4VA 2Y6HA 3LPGA 4AG4A 3DECA 3VD7A 5G04L 5A1AA 2ZEYA 3A7QA 3EB7A 1UXXX 2VL4A 2VMEA 2VR4A 3UNPA 3LEGA 4XZUG 2VZ3A 2W95A 4QB2A 1UYYA 3K77A 1DLCA 4CUAA 4PT6A 3C7EA 1JYXA 3PUIA 1TVGA 4GWIA 4M4RA 4TXWA 4ET7A 1L7RA 2J1AA 1OF3A 4CU7A 2WO2A 3C7GA 1UMHA 3CZJA 3IAPA 2VOTA 1DYOA 4A41A 1J83A 1UY1A 2JE8A 5LA2A 1YQ2A 3FN9A 2QQOA 3T2OA 2V72A 3EYPA 3UESA 1OD3A 4MADA 1ULPA 2RVAA 1K45A 2E32A 5JXJA 2KD7A 4A42A 1JYWA 1OH4A 2YFZA 1JU4A 1PMHX 5C7GA 1J84A 3UETA 5J1XA 2WDBA 3WNOA 4A4AA 3CMGA 2RJ2A 4DUVA 3VDCA 4DXTA 1UY3A 4MGSA 1H6YA 1CX1A 2J1SA 3C7HA 2YG0A 3OGSA 4QAWA 2VZ1A 4MO3M 5DQ0A 3GM8A 3K46A 2VTFA 1KEXA 3I2JA 4JKMA 3WF3A 3HN3A 4OYUA 4QX1A 2C26A 2VZVA 4BK5A 2W1WA 1NAEA 1JYVA 5IFTA 2YC4A 1JU3A 1XPWA 2R7EB 2LS6A 5EJ1B 3K4ZA 4JHZA 4XUOA 3OEBA 1JI6A 5I0DA
chains in the Genus database with same CATH superfamily
3LPFA 4XUQA 1MVQA 4KGGA 4NR1A 5BNPA 3P3PA 1CN1A 2RDQA 4EN7B 2WZR1 1HDKA 1YFXA 4DXSA 1UF2C 4XF1A 1UY4A 1D4M3 4MOAA 4I30A 2WO3A 3CKHA 2Z4FA 5LATA 2CGOA 2ZGKA 2X5IA 4UI9L 3LFIA 3PVEA 1DDLA 4BQ1A 1RUE2 3J7HA 4FFFA 2ZXQA 4L2NA 2ZHKA 2ENRA 1NZIA 2QQPA 4JVAA 3T09A 4XMIA 2WRAA 2WT2A 4XF0A 4B4PA 4O61A 1RXGA 2EF6A 1PGW1 3MV11 3PURA 5BNOA 4W65A 5J4TA 5FLIA 1OUXA 1YEWA 2GAUA 4Q4Y1 3WG1A 2G4IA 3IMMA 2ZABA 3N3HA 4KU7A 1Q8OA 4CDWC 2W47A 1VRH1 1PX4A 1IQDC 4RGGA 3ES4A 2D6PA 4R9DA 2W94A 2P34A 3POYA 4GB33 4OZOA 2B42B 4UW4A 3WCRA 2BVVA 1W8OA 2HWB2 3DXTA 2UU8A 5ACA3 1RUH2 4DY5A 2W3JA 3NV1A 2WS93 4HONA 1W39A 3GXUA 1W6PB 3UX0A 4XUTA 3I3EA 4DINB 4YFWA 3N9MA 2Q1FA 2CDOA 1DQ1A 3M7AA 1W3XA 3PUHA 1J4SA 1RUI1 1W8TA 1X36A 2FCUA 2RM23 1A8MA 2XBO3 2A7AA 1J3QA 3AZWA 2GH2A 1HN1A 3CNAA 4IV1C 4YVWC 5FZ1A 5JSOA 2W52A 1RUF2 4LEJA 2ZX2A 1LTEA 3WDXA 4YPJA 3ZXFA 4B4QA 5EFUA 5KC6A 2DCTA 4C1WA 1C1FA 3RRDA 1PVC2 2VOXA 2VMFA 5CVRA 1VBA2 2WQZC 1O59A 1V6JA 4UWDA 1QH7A 4YVWB 3MO4A 2BRTA 2C1FA 4LXLA 2J1VA 5FXXA 2IFRA 3LE0A 3ETQA 3VD5A 4IEZA 4XCBA 2YZ4A 4UXAA 4FT8A 3VKFC 2R1DA 4FOWA 3QLQA 1UOBA 1R083 2FZ2A 1VAKA 3P1OA 2G9GA 3HD8B 4JC1A 4ZQ0A 2C23A 2QTWB 4WVZA 2ZZJA 4BHPA 3FFQA 1A6CA 4IEXA 1SBFA 2WBKA 5HXMA 4AOCA 4FTEA 2O8PA 4DATA 3R0RA 4PDWB 1YJKA 4LA3A 5BNNA 3UKNA 3I2HA 1JHNA 5JLVA 2JZ4A 2BOIA 2ZKNA 4CP9B 3C7OA 4CCOA 3B9IA 1V6IA 2ARXA 5C4WC 3ZN6A 1LU1A 1PVXA 4URTA 4ZXEA 3LKYA 3OBAA 4DY3A 5EXOA 3E6CC 2WNVA 1FPN1 3O44A 3CL1A 3N7JA 3CZUA 3ETPA 1YJLA 2RMU3 1MQTB 1W0PA 2X5IB 1GWMA 4FPKA 1W6QB 2Y33A 2ZHLA 4I09A 5J98B 4AYUA 2PAEA 4E2SA 2BGCA 4GZ9A 2JDMA 1R1A3 1WGPA 2YBKA 3HAGA 4FOYA 4GXLA 1RUF1 2O02A 3NNGA 3RZMA 3CIHA 1DYPA 2HBUA 1R091 4NE9A 1UKGA 4R4ZA 1T6BX 3WDWA 4TTGA 4A3ZA 4BQYA 1X82A 1MZEA 1NXD1 4P9JA 1D0GA 4BLIA 4IEAA 2FZ1A 4DXZA 1LOCA 4G9SB 4I2OA 1PVC3 1W6OA 4OHYA 2XONA 3SH4A 1WZXA 3RWKX 3LLZA 1AL0G 2XJQA 2P3IA 5FK7A 3WW1A 3CDZB 1EP0A 2FQPA 3D3AA 1QXPA 1RUJ1 1FNYA 3KLSA 2WNUA 4NVPA 2PELA 1PO22 3U14A 5BV6A 4E4DX 3DCQA 4RQPC 5FMDA 2QQMA 3NW4A 1E5SA 1WW7A 3FUOA 4HK9A 1CAXA 1VBC1 3MYXA 3SEPA 5CYYA 1BMV2 4YG6A 5A1FA 3O5SA 2RMU1 3WOCA 3V0BB 4IEUA 1I5PA 3R4UA 3VBHA 4DHRA 2BQ0A 1HJFA 1C8M2 3FL7A 3AYDA 5FTTC 4BPZA 4RQPB 3N9LA 4BM8A 4JC3A 1W9TA 4CP9A 1AHSA 1ZZ9A 2VCBA 4AEDB 4UW6A 4GAZA 3JD72 2WUHA 1X33A 4XE9A 5DUWA 4NUBA 1CJDA 1LOEA 2W46A 3PJQA 4PDWA 5D21A 5FZDA 4EJRA 5KHJA 4AK4A 3WHUA 2ZBJA 1Q56A 3D5OA 3THCA 1RTVA 5IQPA 3H3UA 4P00B 3SCHA 3LLYA 4COYA 1UH1A 2E26A 4LO8A 5IAVA 4AI0A 1PGL2 1SPPB 1XC6A 2HYQA 5LK5A 5K8SA 1VP6A 2GDFA 4A2UA 5M0TA 5CBLA 3BIEA 2CAVA 1HXS3 3J7NA 5LBEA 2VZQA 1XU2A 2XWJB 3PU3A 2D93A 1CAWB 2X09A 4NHXA 4OLLA 3HBZA 3MEPA 2OQ6A 1OOPA 1POQA 1RUD1 1VBE2 3BU7A 4YW4A 3VBOB 3WQBA 1WS4A 4HN0A 2LALA 2AH2A 3NMBA 3EXUA 1ENXA 4JGZB 4JGYA 3AK0A 5F37A 2OZJA 2VQAA 1GQPA 1O5LA 1AXKA 4PJYA 3UZDA 2P17A 3F95A 2E51A 2VAUA 4GB31 1S1AA 5B4NA 4IV1A 3KWVA 3WDTA 4CDUB 4PHZA 3RQ0A 3NV3A 4OMCA 4GWNA 3WEZA 1AUYA 2ID4A 4LK6A 2ARAA 1SZBA 1W6PA 4QX3A 4MQ0A 2ORXA 2WL1A 2CAUA 1HRI1 4QX0A 2BGOA 3TN92 4AFBA 3I2FA 3KS7A 3ZFFC 1RJ8A 2WZPP 1AL23 1XJAA 4HVRA 3PMEA 1R1A1 1IS4A 2ZKLA 1LHNA 1UY2A 4LT5A 1PK6B 2AYHA 4XURA 5FZEA 3MITA 1TOQA 5DPNA 1UWWA 4DNKA 1STMA 5FIXA 5A7SA 4MGIE 3WF0A 3IQUA 3ZPOA 2VCAA 4CU6A 1RUOA 5T5PA 5JWPA 3QACA 1AR81 2ZGMA 1H2MA 3HVDA 4OQ9A 4ARYA 2Q8EA 4AK3A 3MZHA 3WQ1A 3WXPA 1N3QA 5FMCA 4B3NA 3ZSMA 5FY9A 3MW2A 4A7YA 4ISQA 2HWD3 1EV13 3S7EA 4ONUA 4FAGA 5DDJ3 5CFDA 3THDA 1UIKA 4H2AA 3FWEA 3MUY1 4RA0A 4OHZA 3ASIA 3RYRA 1V9U3 5L7OA 1W6MA 2IXJA 3KQ4B 3LA3A 5AVAA 4CA9A 1Y9MA 1SDWA 5F5AA 2XL9A 2IXCA 1ND3C 2Y8KA 2E53A 2EIBA 4DOUA 4YSFA 4PBPA 1E5RA 5SV8A 1LGBA 5JZGC 4L0PA 3JQWA 1HX6A 3VDDC 3VBRC 1F31A 1V0AA 5FYMA 1Z0HA 5EWSA 4YVSC 5DZEA 2AC1A 4IESA 5D2DA 2B9VA 2B46X 2X5IC 4HMZA 4UFHA 3L2YA 1WKYA 1BVP1 2P37A 4FOVA 4QX8A 5A1AA 2E31A 3U4SA 1CZSA 2WQ4A 3NKXA 1CQ9A 1XXNA 3WF4A 5KWRA 1P8JA 2DU0A 3L2HA 1ND3B 1W6MB 4NJ4A 4K21A 4XMAA 2HWC2 4Y24A 2R061 2W87A 4Z1VA 3J26N 4UFKA 3PHMA 3P5BA 5FPBA 2XKPA 1J4UA 3P1QA 4ZPIA 5KHGA 1ZRCA 3IT8A 4GMP3 3FHQA 3R4SA 3RDIA 3VV1A 2WAOA 3DGTA 1K5JA 5BY9A 5GZCA 2WA4A 2BGPA 1ASJ2 4MGKE 1N1VA 4YLZA 3AKPA 3MHRA 4Y1YA 5A3OA 2DCJA 1AX1A 1QJFA 2PHRA 2F6BA 2VZUA 4V2VA 1CAVB 4YW3A 5FZ9A 5T5OA 4IGPA 3RYPA 3WUDA 1LRHA 5F2WA 5ABJB 3RJ2X 1RUG3 1W9YA 2I45A 4MVTA 1ZBE2 2O0OA 4KNCA 5IYYA 2BEOA 1AYM1 1CPNA 2Y6KA 1H2NA 3VDDA 4KQ7A 1BEV2 2ZGUA 4XUPA 3SCGA 4KBZA 5FO7B 5L9BA 3WF2A 3AZYA 1F5FA 4C0HA 3UALA 5L7OB 4COUA 1EYBA 4QPWA 1BQPA 3SLIA 1DU3D 1S0FA 4YW1A 4CU8A 3SP5A 1DQ2A 5E8AA 4M4PA 4LLOA 1WMFA 2JG8B 2EICA 1RL3A 1JXNA 1OPMA 1LOFA 1UAIA 4HFSA 3TNPB 2WQ8A 4E27A 1JZ5A 2D5FA 4OUEA 5JI7A 3ZDVA 5CFDC 1QEXA 2XBO1 2PLV2 3G7DA 3GJAA 4AGRA 1W2NA 3TBDA 1FT9A 1GNYA 2ZZQA 1X8MA 5FP3A 3POWA 3CO2A 1PX3A 2WYSA 2XXZA 5FUPA 4HT1T 4JDMA 2N7GA 1GSLA 2VQUA 2YROA 4LHNA 2OYZA 4CRQA 4WZCA 4DB5A 5BNOC 1LB2A 3GYDA 3FHAA 1X50A 2YFUA 3J7MA 4R6RA 4K8RB 2HYXA 4OHXA 2VMHA 4MGQA 3ZO0B 5AFBA 1NY72 1C1LA 2A3YA 1YFYA 3KV6A 5IAXA 3HMYA 1RUI3 3WDVA 3ES1A 4FP2A 3BTYA 5CNAA 3ZN5A 1PO12 3QH6A 1O9CA 1F15A 2BQPA 5FMBA 2MNGA 3RNSA 5GZDA 2BTPA 1IHMA 4XABA 1JZ2A 3KV5A 1WCKA 2VMIA 2Q8CA 4DHQA 4CDUA 4F8AA 1WD4A 3MW3A 2ZGSA 1XSRA 1S2BA 2SBAA 2JDYA 2YC2A 4RS5C 5EP9A 1QJU2 1SLBA 2AR6A 3T30A 4J1WA 1W3VA 3FBYA 4W4ZA 1AR73 3L9JT 1H1AA 2Z42A 4NRMA 3ZSJA 4BK4A 3WOGA 3RFRA 2GZWA 2V4VA 4YW6A 4EWDA 2W2IA 5CISA 2A6ZA 1CGPA 4AKDA 1ONAA 1QQP1 2ARCA 4Q2FA 4QM9A 3UJOA 3SMNA 2VY0A 3VD7A 4QKBA 3ZIXA 4HBNA 5IUQA 3KMHA 2P2KA 2VW0A 1UO9A 2XJTA 1H4HA 2ZEYA 3B01A 3VN4A 2YU2A 3H1MA 1SFPA 3A0NA 4GJYA 3H8UA 5BUVA 1SPPA 5IVBA 4Z07A 3O14A 1KDMA 5EWZA 5GZGA 1Z7S3 5LRRA 1W8FA 4MUVA 3ZFEA 5JOWA 4Q29A 1XU1A 3LEGA 1XYOA 2FDHA 1CX4A 4FFGA 3C2UA 2ZGNA 1BK0A 1NZCA 1Q43A 4K40A 5LEJA 4P9WA 4V1PA 4PT6A 1RVF1 1MQTC 3B5LB 1QJU1 1ND2C 2ZX3A 1BCXA 1TVGA 2GU9A 4TXWA 2ZHMA 2WZR3 5GLTA 1AL22 3QH7A 2WO2A 3T4VA 3I2DA 2IVIB 2NM1A 3JQXA 1ULDA 2K0GA 1UMHA 3C7GA 2ZGQA 4QX7A 3IAPA 4ZONA 2JB4A 5IVJA 4NHMA 5DG1A 4XFGA 3ZYPA 4BU2A 1NLQA 2BNNA 1TQ5A 1MQTA 1UY1A 5K0UA 2VOVA 3M1HA 2JDHA 1VBB2 1Z7S2 3POBA 3OD4A 4M01A 4J1XA 3POSA 4XJAA 5GM0A 4E9KA 1Z7S1 1DCSA 2V72A 5EPAA 5FQ0B 5FYVA 5FP7A 5IVYA 3UESA 1IPSA 5J48A 3B7MA 1KUJA 3LA2A 1UZVA 4C90A 2JG9B 3PMSA 1K45A 5BNNB 1DHKB 4AI9A 4CP0A 3ZPYA 3SMOA 4BQ3A 3JZVA 1JYWA 5GLZA 3VKMA 1C8M3 4A3XA 4ITCA 2TEPA 5CA6A 3U0ZA 3HQUA 2VULA 4CPBD 1ZRDA 4WM7B 3ZKYA 1J84A 3VHNA 3WNOA 2W39A 3CMGA 4A4AA 2BNMA 3D8CA 5JPMB 1ALYA 3RSJA 2XJPA 3LDKA 4YGBA 4CP2A 1W0OA 4DUVA 3Q8CA 1YQ5A 1RUC1 1S2KA 4DDNA 3CQGA 2PXJA 1OSGA 2OPKA 1UY3A 1C5HA 3NV4A 3O0VA 4WM7C 2JWPA 2R063 4XW3A 4YZ1A 4W6WA 3VHRA 2J1SA 2OW4A 1C3KA 3C7HA 4Q4V2 4IW3A 2YG0A 4AXOA 1VLNA 2JIGA 3LSDA 5C3PA 1AR71 1AXZA 1PM4A 1RITA 5BNNC 5JCTA 1RMU1 1ZBE3 3H42B 4N9IA 4FOQA 3I49A 4AQTA 4UBGA 3I7DA 2WNVC 5GLUA 2VTFA 3O0XA 5A3WA 3MHZA 5FO9B 4LBQA 2P5BA 1JOTA 2RS51 5H9SA 5LVZA 5FZFA 5F5QA 1PGSA 1VR3A 4AKCA 4YW5A 1QJX1 1TMF1 1YQ6A 1O3RA 4RGAA 1S2EA 2OX0A 2YHJA 2IVJA 1DZQA 2GUCA 4V2WA 4NIAA 4BMEA 2YC4A 5DABA 2FHRA 2ZHNA 4K9SA 1XPWA 2R7EB 5EJ1B 1UOJA 1IKQA 2DU1A 1C57A 5FZGA 5F2SA 1ZM1A 3ZXKA 4AQ6A 1LEMA 4NOTA 4XUOA 3KZ4C 3OEBA 3M3IA 4Y5Z0 1LOFC 5I0DA 1X8EA 5AVPA 4G3YC 1BEV3 2UWCA 1ZNPA 4MX3A 3AKTA 5LY1A 4QQOA 4IETA 2HWE1 2JJ6A 4P5HA 4E2GA 3GBFA 2WABA 3GHMA 2QDRA 3VZGA 1O7FA 1RVF3 4NPMA 3SMHA 2AEYA 1US3A 1Y9GA 1ZRRA 2Q1ZB 3QOPA 4O9GA 1L3JA 1UPSA 4K7JA 4XXPA 2FBEA 2C24A 2LROA 4HKWA 2V73A 3MFAA 4UYBA 3ENRA 4C8DA 2VUCA 5CFCA 3R51A 2LW8A 4FO9A 5C8CC 4IV3C 3AMHA 3DKQA 3RZZA 4Q4X2 1V70A 1RHI1 4BG6A 4NAMA 3CF6E 3VBUA 2JD9A 3K3NA 1LECA 1QDCA 1A8DA 2HEWF 5FY0A 5F74A 1HQLA 1CJPA 2EAKA 4N43C 1O4TA 3FLPA 2BWCA 2QUOA 1PMIA 2CNAA 3KV9A 3N4MA 2VC9A 2JDPA 3OY8A 5FZCA 5J31A 1EY2A 4KWKA 4AHYA 1NLSA 1REFA 3K4AA 1I3HA 2PTMA 1GR3A 2Q1MA 1RC6A 2WS92 5A3PA 3DKWA 1T6GC 4FXGB 4GIQA 2RDNA 5C9AC 2GTYA 1HIXA 4LO7A 2WT1A 5E89A 2VM9A 3DPRC 5FP9A 3LOBA 1AZDA 2WNUC 3KQRA 2XOMA 3MFCA 2WN3A 4FCAA 1OUWA 5I8SA 2H6BA 1EAH2 4JTNA 3N9PA 5ANQA 2ERFA 4RYDA 1PMJX 4R9CA 3GGLA 1W0NA 3BCWA 4BIOA 5AFEA 5HI0A 1C3NA 4S2GA 3O1RA 4RL7A 2A6WA 4FPGA 1O3TA 4XFHA 5JVVA 5KXEA 4RN5A 4N9HA 1GOFA 1AYN2 5DUUA 3DYOA 4QPGC 4BDVB 1UOFA 1TME3 3T2QA 4LHSA 4XF9A 4JDNA 4XBNA 1DQ6A 1W6OB 3LKJA 4AEMA 1BJQA 3INAA 2DCZA 2WNOA 3KGZA 2W0XA 5F9TA 3R52A 1N3PA 4AF9A 4QPGA 1U12A 4PLNA 3PIJA 3BTZA 1DZRA 3LB9A 4XEZA 1W9SA 1RMU2 2CDPA 1BBT2 1K5MB 3GF6A 1RUG1 1BKZA 2LM3A 3AKQA 3N7MA 4SLIA 1AR83 4HETA 1RUD2 4YRDA 3OUIA 1H9PA 2H0VA 1XQNA 2C5DA 2PQSA 4HXCA 4CDQB 2B9UA 5DAQA 1GU3A 3FJSA 1C5IA 4L99A 1GZWA 2B5HA 2C9KA 4LKDA 2DFBA 2RS12 2R042 5LX2A 2BERA 4YGDA 5FAXA 1KGYA 3VD9A 5IK7A 4DX0A 1HB4A 4DEQA 3I8TA 1UZ0A 4NHKA 1W2AX 5LASA 2BU9A 2WFPA 2Q8OA 1DQ4A 3OCPA 5JUVA 4Q26A 3VY7A 5F39A 1GOHA 3E97A 3EJKA 1LNSA 1QH6A 2WC2A 4HG6B 1KFUL 4F7ZA 4YARA 5HV4A 4KG8A 1W8UA 2WO1A 4FPHA 2DVBA 3TEWA 1WA6X 1YZ5A 3ST7A 2QZ3A 4KWJA 2HWF3 1F4AA 1ND2A 3AYAA 2WZEA 3WNMA 4DNYA 1C3HA 3H8RA 2F17A 2OIIA 4L11A 3POFA 5FREA 5FUNA 1SDDB 4N53C 4YVWA 5IFPA 2OT7A 3WNPA 1GP6A 4QQPA 1ZBA1 2ZGLA 4NHLA 1A4OA 4D7YA 1MR5A 5KHIA 4DEVA 4XFIA 3RZJA 5C9AA 1J3RA 3CJXA 2RS11 3ZM8A 4J6GA 4C1XA 1S0BA 2GMPA 1O8PA 1K3IA 2VD7A 2HWF1 5FYZA 4EN8B 1CZVA 2ADDA 2D3SA 3QCWA 4CEYB 3I3BA 5GZEA 4XIOA 1OXCA 3KD4A 2GC1A 2XJVA 3SITA 1FXZA 3WT3A 1NX9A 4PQQA 1LGNA 2QQUA 4XILA 2D40A 2QQWA 4NAOA 3POIA 4QX5A 3RZHA 1JOJA 3ILRA 3J9SA 1PK6A 4AKBA 3JXSA 3VB9A 2IUWA 4CUCA 5A6ZA 1FNZA 4NIGA 1EV11 5FY5A 2WWUA 5IJRA 3MDPA 4CCKA 2EXIA 5LWBA 2K9ZA 3KHCA 3VHPA 3GZTB 3MBWA 4QQLA 1QOOA 3P8SA 4IE0A 4R9AA 4HKCA 5JZGA 4GX7A 4O7XA 5H9PA 4F7RA 3VZEA 1BBT3 3C3VA 2QQKA 3AXEA 1TMF2 3U37A 3WNNA 3N35A 2E9QA 2JB8A 1U5ZA 2IXKA 1YXWA 1TME1 1AYN3 3WZ1A 4EN9B 1NOVA 1VB2A 4IHLA 1JN2P 3EFZA 3A21A 5DXDA 4EWAA 3ZYJB 5T50A 4R6OA 5FRAA 1DGRN 3IAQA 4GNTA 2ZS6B 1URXA 5K4LA 4B7EA 3I59B 5FZIA 5FMOL 1MS0A 4WVMA 3GCWA 4DUXA 4R6PA 2FMDA 4HZFA 4XETA 3SKJE 4A7KA 3S57A 2JEMA 1S0JA 2QJVA 5KR7A 4FTSA 5ACA1 4X6QB 1SFYA 1IZ3A 2X53S 2FDIA 5FYBA 4HSLA 3WP4A 5FY7A 2GMMA 1AVBA 4GJZA 4R8HA 3JUUA 3VZJA 1GV9A 3BN6A 5FY4A 2FMYA 5IK5A 2XHNA 4Y1ZA 1JYCA 1XNDA 4FPEA 4XFAA 5J51A 3POEA 1RINA 4K6BA 5FBZA 1KJLA 3U75A 5B2GB 2QQNA 4ORFA 1XE8A 4AL9A 1OQ1A 3A4UA 2J42A 4XIKA 2JG9A 4DHMA 3M4FA 1CIYA 4P02B 1NA1B 4XF4A 2DBNA 4HVQA 1JACA 3VLBB 5D3FA 5BNPC 2BFUL 3AP4A 5A6XA 1ZZ8A 3ACFA 5JOZA 2H6CA 5F3GA 1NCRA 2YMZA 3PDQA 3UGGA 3DF0A 5FV3A 5JIAA 3ATGA 4XQDA 2ZCWA 1YFUA 3VKNA 4EN0A 5EJZB 4CCDA 3TB0A 2UURA 2WA3A 3O12A 2YV8A 3OD0A 3POGA 4BOWA 2XGXA 5ACA2 3LD8A 4RR3A 1LHVA 1MZ6A 1IG3A 4FQ4A 4P08A 4E4SA 4UFJA 4DHTA 1B35A 1NT0A 2ZJCA 4YWAA 3UV9A 3AQGA 1AYN1 5LEKA 4XF3A 5F3IA 1J4TA 2ZX0A 2R49A 3E5UA 3B3QE 1QIQA 4CCMA 1B35C 3RWNA 4LTAA 3WG3A 2C1NA 1JUHA 3WSOA 2VNRA 4DMIA 4XHBA 1XXQA 1ZYBA 1G86A 4M3CF 3SHRA 1OLMA 5D1IA 2YPJA 1JH5A 4LO4B 3H8OA 4TLGA 4MGTA 1Y43B 1W6QA 1UGYC 3URFA 3T08A 4MGZE 2K46A 1G6NA 3IDBB 2VNVA 2HYRA 4DHNA 3DYPA 4P14A 4Y5SA 3PU8A 2VQTA 5IVVA 1UX7A 2ZMKA 3B93A 5FWJA 1LOGA 4WOGA 3HNBM 2DVAA 4XQWA 3MLJA 2VZRA 5A7WB 2FCVA 1B35B 1GZCA 1QY4A 1CVNA 1O4ZA 1XYNA 1TMF3 1GMMA 3MIDA 3NV2A 4E4ZA 1G9DA 1RUC2 3ZYIB 4CDXB 3CQOA 1OQDA 2EAAA 4QB6A 4PLOA 2WWSA 5IWFA 4BXSV 5A32A 3CHXA 1X7NA 2XVKA 2VBBA 4Q0VA 4Y4YA 2D98A 3K4DA 3UT0A 2Y6JA 1J59A 3Q8AA 2JG8C 5C3OA 4TWTA 3CU8A 1IPJA 4JRLA 2VQ0A 5JMCA 1W04A 2MPFA 4JGZC 4KMQA 1QNWA 3X0UA 2O8QA 3VGIA 1UZZA 2CU5A 2C63A 2QQJA 2RS52 3BOWA 3IDAA 4QPIB 3LDBA 1OF4A 4Y33A 3W21A 4CP1A 5C8CA 2E33A 3M3QA 4BB3A 1RUC3 3VD3A 1ZZ6A 4OHWA 3WW3A 3NL1A 1ENRA 2Y6LA 4NO4A 5LHOA 5KXCA 2W1UA 4BQ2A 4META 5HV0A 3CEWA 4UFMA 2GALA 2XHKA 1NUKA 2PMWB 4LNVA 5C9AB 1TEIA 3VHOA 3ZXAC 2D5HA 3I3QA 2EXJA 5A70A 2XL7A 2A3WA 1TME2 3K51A 1GLHA 2PAMA 3PL0A 5CAZA 2ORZA 5IT6A 3ZVXA 3TWIA 2DUQA 5BN6E 1LULA 4Q4X1 4U36A 1WD3A 1VBB3 3ACIA 3W59A 1JZ7A 1YCIA 3OEAA 2J22A 2W9XA 1FV3A 1ZGRA 1ZA4A 1D2QA 1SMVA 2JDAA 3R05A 1UGWC 1UQXA 3V65A 4COVA 2RS53 2UYBA 5FYCA 1KFXL 1QOTA 1W6NB 3GZAA 3N9OA 5BY5A 4I0WB 1AXYA 5HPOA 5FOJB 4FXKB 5C70A 5L9VA 2BMYA 4Z8BA 3NRUA 5A3TA 5E1RA 5F32A 1NCQB 3OGGA 4AI8A 2GN7A 5FXWA 1O6UA 1MS9A 3C8XA 2XH6A 3SKVA 4QHBA 2JE7A 1VBE1 5DUVA 3LFMA 3SH5A 3MLLA 1LOAA 1OT5A 2VUDA 5LY2A 4YFZA 2VZOA 4AFMA 4LULA 4B7KA 1CAUA 2WZ8A 3KT1A 4GMP0 4AVTA 2QP2A 1UX6A 1S0IA 2DVDA 2JKBA 2VU9A 1N1TA 3KVAA 1SEFA 2VG9A 4QPYA 2YGMA 3PTYA 1XRUA 3VUOA 3K75B 1V6KA 5EYYA 5FZ3A 1WLTA 4ES8A 2W5FA 3WINE 1UZYA 1O3SA 1Q8QA 1S55A 4WM8B 3PUAA 3B69A 2BBVA 3ACLA 1SBDA 1HB1A 3T0MA 1XOYA 1OFSA 2DVFA 2OA2A 2WLPA 3VDDB 3HT2A 1ND2B 5FZ4A 1UXXX 1LCLA 2VL4A 4LBNA 2VR4A 4CDXC 1FOD2 1MS3A 2Z79A 2XUMA 4OHVA 5A33A 4OQ8A 1RVF2 3OUJA 1WCSA 2HWE3 1VMJA 3O7OA 3ZXGA 4M3CB 5A3LA 2VPVA 1LHWA 4XZUG 1C8M1 5CIRA 2VZ3A 1RGSA 4EZ4A 4BWOA 3D82A 4EWEA 5DAWA 4YG0A 5FYSA 3BI3A 1DLCA 3JD73 1TZOA 1GBGA 1H8TB 1D4M1 3O1VA 4IEWA 3AP7A 4GWIA 4Q0QA 1PO21 2XDVA 4M4RA 2PHDA 3ZXDA 2J1AA 1OF3A 4BQXA 4ET7A 2QDNA 5C3SA 3AX4A 2PQQA 4GQ7A 3B94A 5CG9A 1BEV1 2VOTA 2TBVA 4D69A 4WVVA 1CAUB 1RUG2 1DYOA 4FPLA 5FZMA 1VMHA 5HBAA 5FXZA 1J83A 4FAHA 2HWC3 2JE8A 2XQRA 1YI7A 3DUIA 5LRSA 1YQ2A 4XJWA 3FN9A 2HWE2 1VB4A 2QQOA 1GICA 5FPXA 4BISA 5AC93 3TEZA 2OQ7A 5T55A 3VBUB 2A71A 3ON7A 4R9BA 3SXWA 1F2NA 1PO23 1Z78A 3EYPA 4GH4C 2XPJA 4DRVA 1XNBA 2OXBA 3IM0A 2WFF1 4Q4V3 5F8PA 2B8MA 4ISRA 4AFDA 1WCDJ 2FCTA 3IWZA 2HJIA 2RVAA 2E32A 1H1IA 3UKTA 2WINB 3NAPA 1OHFA 1QKQA 1PMHX 4JTOA 3SH3A 4D6QA 2XG3A 4N7IA 1KU8A 4AEKA 2PHUA 4KWLA 3UETA 3D4KA 4LBOA 5HF3A 2WDBA 2WLQA 5A3MA 4B1MA 3MIGA 2D6MA 1TNRA 3LA7A 3RJRA 4DXTA 2KA3A 1E5IA 3BYWA 1BXHA 1W2OA 3GNEA 4QXHA 1ASJ3 4S2DA 2V09A 1KITA 2VCMA 4GKYA 1QQP3 3WP6A 5LW9A 2ATFA 3VBSC 1UMZA 3OTFA 1APNA 1BK1A 1GFF2 4Q4Y3 4RS5A 3VBUC 2JIJA 1UOGA 2ETEA 3APBA 3JB8A 2RR13 3MI8A 1CESA 3NNFA 4JDOA 2BVBA 2VZ1A 4MLOA 4Q4V1 5CFDB 1NCQA 4IE4A 3WW4A 3P1RA 4IGOA 2HWF2 4ASLA 3AZXA 5FPUA 3K46A 5DUXA 4LORA 2PHFA 3FLTA 4YZ5A 2AENA 1W6NA 4JQRA 3RMYA 4N43B 4QKDA 3I3MA 2VGDA 3UYJA 2C26A 1OOPC 2R30A 4CCJA 2VZVA 4XC9A 1WS4C 2NZ9A 4FL5A 3BIWE 3M70A 1A38A 1YQCA 2BTVC 3VL8A 4XTMA 1JOBA 1HRV3 4PI0A 1KS4A 4Y4RA 2R0FA 3O1TA 3LWCA 1KS5A 3IBMA 4JHZA 5FKBA 2TNFA 4KG0A 4XPVA 4EQVA 2BUKA 3AM2A 4YM0A 1QU0A 3AKRA 3J8F1 3IDCB 2JECA 2BP6A 2VVEA 5A32B 3BTAA 3M3CA 3WF1A 4YZ2A 1AR82 1UMIA 4D7SA 1NY71 3TEXA 1VBB1 4WBBA 2IXIA 1VE0A 1OLRA 1W8NA 4IEPA 4DUWA 2RDSA 2X05A 1XE0A 5LA1A 1VBOA 3UGFA 4JGZA 1MS5A 4PLMA 3W20A 2R1BA 3RI8A 2UWBA 1POV3 3FX3A 1ACCA 3R6SA 3WG4A 4E8DA 1OOPB 3VBOA 3OF1A 2F4LA 4QLIA 2Y38A 3W5NA 4Q4Y2 2UY8A 2X10A 3WP5A 2HWD1 5DZGA 3D0SA 4JV4A 3LW1A 5A7OA 5IW0A 3U78A 1ULOA 1W28A 2PYTA 2P3JA 4XYXA 5FYIA 5F6LB 2RHPA 1W03A 4IEYA 1V6OA 1WLDA 4LLFA 5GKAC 2E7AA 4BH9A 5HCAA 4PF1A 5K0UB 5EIYB 2R32A 1US2A 1RUE1 1LOBA 3ZIWA 2WNVB 3KF3A 5JPNB 3CU7A 1VBE3 4JX0A 3HNYM 5CB7A 1ODMA 1YYNA 2TUNA 4M0NA 1F8VA 2ZGOA 1AR72 4MGYE 3G6JB 2HLEA 4HN1A 4HSJA 4LBLA 4IE7A 4LOSA 4AEDA 1H30A 2AZ5A 3H0OA 4J6SA 1IS3A 1X9PA 4LE4A 1UYZA 2DBIA 4UBHA 5KC5A 2CL2A 2XQXA 2XUEA 4XTPA 4UF0B 1VALA 3IDEA 3ZSEA 1S0DA 4DQAA 2UYAA 3MV01 4GWJA 4MZUA 3EQEA 4OI1A 4D94A 5J36A 3KGLA 4DIQA 4R6QA 1XE7A 3OPZA 3GDBA 4P5YA 5A3NA 1VRBA 4HKOA 5FCCA 3P3NA 4B4RA 1HQWA 3IPVA 1GYKA 2DYCA 2VUAA 4WVWA 5JXIA 3O1OA 4PITA 3MPPG 2RS33 5J37A 2HWC1 4HPKA 1Y7BA 3E1F1 5LA9A 3M3EA 3RZKA 1GKBA 1X1VA 4M0HA 1RYYA 1HRV2 3K2OA 3HPNA 3M2MA 1ENSA 2JXAA 4LKFA 2H0BA 3ROUA 3MICA 5DAPA 4CCNA 1MZ5A 2D3RA 4BIFA 1ZGSA 1LKNA 4NIIA 3I2KA 4IV3B 1VBC2 1K12A 2R6QA 3TEYA 4L92A 3IZOA 5HCBA 5FPVA 1Q8PA 3IIAA 4HKLA 3RDHA 3S5QA 5FZ7A 5C3RA 4RGKA 4ZZ8A 1RUI2 3WD5A 3FMGA 1E5HA 1JW6A 1UGWA 4IEOA 4RR3C 2E63A 1QHDA 5I0SA 2J1UA 4GA9A 5JR2A 1IG0A 1UYXA 4GMP1 4S2FA 1RUH1 1ULCA 1S0EA 2XR4A 3ILNA 4XDOA 4AI2A 4URAA 4YGCA 1L7LA 3VBOC 3B9CA 3OGJA 1FATA 1O9FA 1PIV3 2YBSA 1H2LA 3M51A 2C0ZA 3ZMNA 1VBC3 4FTBA 5KBFA 4Q4W2 2EVXA 5FZ8A 1SLAA 5FDBA 4CU9A 2W92A 3OGRA 1QOSA 2XWBB 3R50A 1JOPA 1A37A 1PNFA 1XBFA 2GNBA 2Y26A 3AJYA 3IN9A 2WO7A 3M3OA 4PIYA 4OUSA 1R64A 4UT5A 5T54A 1LAJA 4RSUA 3FUQA 3JCIA 3T2TA 1PGW2 3MIHA 5K9YA 1I5ZA 4JDDA 2B4KA 4QDSA 1QJY1 1ZVFA 2G9FA 1OUSA 4FFHA 4JGYC 4X8NA 1U5YA 1OD5A 5E6HA 5FWEA 4CVUA 4NIDA 4XFCA 1R1A2 2OKXA 2A6YA 3HEIA 2A3XA 4XHXA 3BODA 2Y60A 3ZSKA 4AI3A 1LHOA 1R1ZA 1TE1B 4N8MA 1MEC3 4BQWA 1LR5A 1SLLA 1OFNA 1SFNA 5FP4A 4ATFA 3NKTA 3U9XA 4IUGA 3WR0A 4C91A 2I2SA 5C8CB 1ZRFA 1Y4WA 1EV12 2RMU2 3JU9A 3Q8EA 4RHV3 4TYSA 4FVVA 4AFAA 1ZREA 2O1QA 1XXRA 2JDUA 2Y6FA 3AMNA 1DQ5A 1OI6A 1QWRA 4HOOA 4WV8A 3O1PA 2BBAA 4Q1RA 4RS5B 4Y26A 1ZZBA 2XBO2 1SHWB 3ACGA 3VBSA 1WBFA 2EIGA 4PI2A 4JQTA 4ATEA 3EHKA 5LZ6A 1EUUA 5CKMA 5J09A 2J1TA 3OBTA 3ZXEA 4Z2WA 3H8XA 2JICA 2RDRA 1Q3EA 1W8HA 4H3WA 3OG2A 4WZFA 1D4VB 3MLKA 1R092 4INDA 4MXVA 4XCAA 4Y20B 3GALA 5FY8A 1NA1C 4ES9A 2L9LA 3USUB 3WHTA 4EROA 1V9U2 1QJEA 1RUJ3 5G05L 5A6QA 1PZ9A 1XSQA 1SBEA 3ABZA 1OVPA 1W05A 3NAPB 2VNOA 3SEEA 4CTEA 1BHGA 3ALQA 5CKNA 3CBNA 3J8F2 4XJ9A 1UNBA 3CLPA 4HPKB 4NIHA 4QMAA 2WS91 3P1NA 5L7OC 1OA2A 2WYFA 5CEHA 2J1EA 3FBMA 2VZTA 3VZLA 3WG2A 3OPTA 4COWA 3LOIA 4QKNA 4WRQA 1AL21 1K5MA 5EXGA 2PN5A 4OCTA 4XOGA 4EN6B 2ADEA 3MPBA 3OBRA 3AXDA 3HQRA 3FLRA 2CYFA 3ZYRA 2WKKA 2WN2A 5LBFA 3UBWA 3VBRA 5BNPB 1HB3A 1OLME 3D6EA 3PUSA 4NHYA 4AGVA 3LQCA 4Y20A 5J7MA 4QDQA 4FPYA 5JSPA 3WNKA 4B8EA 2HYKA 1S2XA 4LKSA 3AKSA 1RUH3 5HCFA 1SLIA 3Q8FA 3O1MA 3HIFA 1AF9A 1W2TA 1XNKA 5FZLA 1LESA 3LF7A 1FX5A 2IXHA 4B1LA 1DGWA 3BKZA 3KCXA 2RV9A 3Q8BA 4LKEA 1BBT1 3RPQA 1LJ7A 2A6VA 3ZR6A 5FYTA 3WVJA 4PIZA 1O5UA 2JG9C 5JOYA 1U0AA 2LUWA 3OJBA 3ZFEC 5I8TA 3PJYA 3I54A 1HXS1 2QQIA 3AP9A 3WDUA 3IB3A 1DLLA 2ILMA 3LSEA 1FMD1 1H2KA 4H7MA 1RB8G 1ZX5A 2LRPA 3HT1A 4MXWB 2OS2A 2BV4A 2GC3A 3CJIC 4O9EA 1MS8A 5BPXA 1NA1A 2J7MA 5FYHA 4ZU5A 4Z2AA 4Q27A 2E7QA 3WV6A 5F3EA 1OLQA 1OKOA 1WMEA 3NO8A 2PFWA 3MF9A 1M06G 3RGBA 4BQ5A 3H7JA 3O1UA 1OA4A 5D8AB 1DGRA 2SLIA 2YXSA 4BXFA 5C71A 1ULFA 1CD3G 3CQCA 1D0HA 1HW5A 4FPOB 1LHUA 2QE3A 1SG3A 1OMIA 2VXRA 5K0UC 3NWKA 4CUBA 3HN1A 4HVOA 4TZDA 3WCSA 4YNIA 2ZGPA 2CWMA 4K3UA 5JXHA 1POV0 2IZWA 1LODA 1QJX3 2RJKA 5CFCC 2YU1A 3EMRA 2ZAAA 1EAH3 1FAYA 2VNGA 3H3LA 5FZOB 4G4FA 2XLAA 4FR3A 2VMDA 4XZPA 5T3NA 3NJXA 1MEC1 1UU6A 5C4WA 4CEWB 1JODA 4ZKTB 1L7QA 3KB5A 3CJIB 5HCHA 5AV7A 3S0MA 4XACA 3MGUA 2D6OX 3T0AA 2V4AA 4YZ4A 2JX9A 2RS13 2CV6A 4NWWA 1QXJA 4MV2A 5ERLA 1PNGA 1J58A 4L8QA 3RVHA 1IB1A 2O8OA 2Y64A 3NNJA 4LBKA 2A5ZA 2ZEXA 4DHOA 3JB4C 4NRPA 1PK6C 2O14A 2CHHA 5FZKA 3WUCA 5JAXA 1GP5A 4KGQA 4OI2A 3LEMA 5FO8B 4P9LA 3TN91 4XJUA 1FOD1 1UU4A 4QB1A 2ET1A 4A6OA 5A7NA 1RHI3 1I1EA 3CJIA 2VTXA 4IEVA 3RI9A 3TRSB 1D2SA 4Q8KA 5J4XA 4COZA 5F7UA 5C6CA 1AJKA 2QKDA 3TYJA 2YB7A 3LEIA 3WQ0A 2QZ2A 3BVCA 5KHKA 1CAXB 4IV3A 4F3JA 4CDUC 4IV1B 4R6NA 2HH9A 4OFGA 4BMBA 2OVUA 1XB9A 4GWMA 1QGLA 2JD4A 1GUIA 5EJ3A 5C3QA 3LL1A 3ZLIA 4GD4A 4W6YA 1O91A 5LA0A 3BUCA 5FK8A 3VBHC 1Y9QA 1UPIA 2PHXA 1Q5OA 2ZX1A 1COV1 5DN2A 3SQOA 3MIBA 3ZFFB 4P9IA 3D0JA 5L36A 1WLWA 3AVSA 5IHRA 4UW3A 1UU5A 3IPVB 4M3CE 5I0TA 4L97A 1QJX2 3E6YA 4QWNA 2MEV2 3HJRA 3E5XA 4LUMA 4RD7A 5APAA 4OI0A 4LIUA 3DV8A 4FPFA 4Z92B 1UXZA 1WS5A 4CSWA 3U1XA 3WP3A 1DFQA 1AR62 2P3YA 5IVCA 5L19A 4LR4A 4P9YA 4XFBA 2KR2A 3NNLA 5FPLA 3JD71 4QGNA 1I9RA 2Q4SA 3DPRB 1WMXA 4X8PA 2YPDA 5LCWL 1UN1A 5J96B 2WT0A 1R082 1AR63 1U5IA 3J4UH 3ZN6B 5I93A 5DDJ2 3VZKA 3AP5A 3W5MA 5J3UA 4IDZA 1NKGA 2NP0A 1IQAA 4ZU4A 2A1XA 4AVAA 2VW1A 4XUNA 3GBGA 4HK8A 1NXMA 1V6MA 4CXWA 1JYIA 3KHBA 4Q1PA 2W1SA 5FLJA 1BMV1 3ELNA 4XFFA 2A6XA 2G19A 2WAAA 1PM7A 1JHJA 1YWKA 1CONA 3WDYA 3V64A 1F4HA 2VJXA 3F2ZA 5CU1A 3ZFGC 1QDOA 3KSCA 5BTVA 1NCRB 1UYPA 1EPZA 4BCUA 5A33B 5F1RA 3T0DA 4GH4B 2ZA9A 3MUZ1 4ZS2A 1QJBA 5T5JA 2BZDA 2KM2A 1PO11 5JOXA 4OVEA 2XJRA 3T2PA 1DG6A 4QGLA 1HKDA 3LEKA 2Y6HA 1MZFA 1H8VA 1VBA3 3LPGA 4MHUA 3ZFFA 1J1LA 4FQZA 4AG4A 1MS1A 4Y3OA 1OC1A 3LCPA 2GP3A 1DZTA 3DECA 3RYKA 2E7TA 1ODNA 3ORJA 2OUJA 5G04L 2CGPA 1I6XA 3A7QA 5E16A 3QD6A 3EB7A 2VMEA 3LIGA 4TN7A 5IK4A 1VBPA 3FZ3A 2NMOA 1NG0A 5E88A 4K20A 2V7DA 1LEDA 2DUPA 2W95A 4TSVA 3VBSB 3AJZA 2P4EA 3J8F3 1NCRC 4JAAA 3TAYA 4CDWA 1XYPA 2DFCA 2WSUA 4HLTA 2ZAHA 1SACA 1UW8A 2R043 3GCXA 3C7EA 5FZHA 2RE9A 5CG8A 3ZYFA 4DPNA 1JYTA 1QNYA 3PUIA 4AVBA 5D2AA 1X9TA 3H1WA 4QU1A 2E6VA 3NSTA 3KM5A 2BDRA 4DO0A 4B29A 1M4WA 3I2OA 2Q30A 3RS6A 3PVOA 1V00A 3THPA 1DQ0A 3RMXA 5LU1A 4LE3A 5KXBA 1YRZA 3VBFC 2C1JA 5F6KA 3T2OA 1VJ2A 4DZGA 2XJUA 4QD2A 5FYUA 3ZYBA 1YO8A 4AAPA 2BN0A 5EZWA 3VKOA 1GZ9A 5FY1A 4CEWA 5C4WB 1C4RA 5FLHA 1G8WA 1OD3A 2BR9A 4MADA 4A6SA 3GBWA 1ULPA 1DYKA 4LBMA 5IK8A 3GZUC 1UL9A 2VBDA 1OH4A 2GSYA 4GALA 2ZMLA 3TOJA 4Q0UA 5J1XA 1NYWA 1NE6A 2K2SA 5BYNA 4R4XA 2RJ2A 2VVFA 3VDCA 4I0AA 4LBQD 3H9AA 5D8AA 4GKXA 4MGSA 1H6YA 2D6NA 3KV4A 4QPIA 5CADA 2NMNA 4U2AA 2VOWA 1GP4A 3OGSA 1WCUA 1VRH2 1OPOA 3OUHA 2Z5WA 4MO3M 5L9RA 2QNKA 2BMZA 4DAUA 5FZ6A 4HL0A 1QJZA 4NRQA 1RUJ2 1Q8VA 5FJKA 4CDWB 5LB6A 4RHV2 4GULA 2BOJA 3SCFA 1KEXA 1RUD3 1UCXA 3I2JA 4JKMA 5FYYA 3H3ZA 1PIV2 3HN3A 3MW4A 4OYUA 4UF0A 4QX1A 2QVSB 4CDXA 1AR91 2W1WA 1A34A 1NAEA 1JYVA 1KD7A 1CWPA 1N3OA 3Q9OA 1GWKA 5J50A 3E6DA 5F5CA 2NPIA 1JU3A 1H8TA 3ZN4A 4AR2A 5JIUA 3K4ZA 1WW6A 2Q8DA 1RUNA 1W8ZA 1YFWA 2WR9A 3DXUA 4ASMB 4ZU7A 3LAGA 4DHPA 1LENA 2R073 2Y34A 3W58A 1JI6A 4AEJA 2YYOA 1QQP2 2WSVA 3N7KA 3MIEA 1KRIA 1CPMA 5FOBB 4XDQA 5SV5A 4Q4X3 2W08A 1N47A 3S30A 1QJU3 2ZX4A 4D6RA 3PLQA 3VL9A 1MEC2 5F5IA 4YW2A 4Q4W3 4QDRA 4WM7A 5LK7B 4XBQA 5IVEA 2YC0A 3BB6A 5JR7B 1JZ3A 1QMJA 1PZ7A 5FUIA 3A23A 1OH3A 3RZGA 1DBNA 1HRI2 4RFT0 3AC0A 3USUA 2R062 1AYM3 3ZFGB 4KWUA 4MG2A 3EO6A 1ZA7A 5FQ0A 4YZ3A 1GZWB 2RR12 1GNHA 4XBLA 5C5UA 4DS0A 5AC92 1WWYA 4K1ZA 5I0UA 2VZSA 3DPRA 1SLTA 1VBA1 3GHNA 2W1QA 4YM3A 2J1RA 3IKWA 1PVC1 3X29B 1JMUB 1GNZA 1VBD1 4XAAA 4Y5TA 4LOTA 1YIFA 5JMOA 4CCEA 4QHZA 2WFF2 3PVNA 4I0BA 4MH0E 4N7YA 2YGLA 3BU0A 4LBJA 1UH0A 2NUOA 4IERA 4QXBA 4XXAA 2DV9A 3H50A 2QBXA 5LBBA 4CXXA 3JBG2 3U11A 5A7QA 5C8WA 2NYYA 2DVGA 1ENQA 1C3MA 1W06A 3OGVA 2OZ6A 1N1SA 1ZBA2 4QU2A 4MYEA 2GN3A 2RS32 3ZR5A 4JHTA 2B05A 4AWDA 5LU2A 3I2GA 2VUJA 1K42A 1YUDA 3EBRA 3OSDA 4LA2A 5KXDA 3WOBA 1GZTA 2B39A 5FZ0A 3ZMOA 2C6SA 2D43A 3AFKA 4Y1XA 2JENA 2EXHA 2Q0AA 1KJRA 2QQVA 3A22A 3HNMA 1PGL1 4N84A 4LMFA 3NNMA 1XEZA 2W68A 5A6YA 4SBVA 5B4XA 5DDJ1 2VZPA 3GZEA 1WUVA 2CWSA 1GQHA 2DDUA 2P3KA 4CYDA 1R081 4N90A 4Y22B 4A44A 2R041 4AVVA 2Z2SB 2ARBA 3E5QA 4PIFA 4R52A 3P1SA 2GC2A 2RJLA 3I2IA 4BLJA 3AP6A 4ZDRA 1OKQA 2ZGTA 3VDAA 2D6LX 3MIFA 3SPRA 1MS4A 1YQ8A 4N43A 5JSRA 2HBTA 2RS31 4XQ4A 3U07A 1HJGA 1OQEA 1GWLA 1YI9A 2NU5A 2NLRA 4LK7A 3WW2A 5FP8A 5A1LA 1FMD3 3OOXA 4BA6A 2EIEA 4QQHA 3MIUA 2D7FA 2WZR2 4L9BA 2YY1A 2VOKA 1IKPA 4XVHA 1COV2 3NJVA 3TN93 3ZX7A 4KH9A 2DUOA 1IPKA 4EZHA 5DMYA 2BPA2 1O3QA 4Q0PA 3ZSLA 2AEZA 4Z82A 1UGXA 1VBD2 1WA4A 3BALA 1PO13 2FDKA 3OYWA 3P1PA 3POJA 4EE2A 1FPN2 3OPWA 3ZFGA 3T3YA 4JGYB 3VD4A 2IWGB 4Y22A 5DAXA 2BNOA 4I02A 1EUTA 3FE5A 3VKLA 3ZXLA 2Y6GA 2JG8A 4IL7A 2P1BA 2VH9A 2VECA 2HEVF 3ACHA 2Z69A 4QXKA 1EAH1 4WM8C 3VBRB 4H14A 1FPN3 4CCCA 2R0HA 5BXXA 1DGWX 4M3CA 1XNAA 4KL1A 1URJA 1R093 1D7PM 4MXWA 4OZXA 1C28A 2FDJA 4Y1VA 3APAA 2DWRA 3IMNA 4I01A 4IEQA 4QT6A 2PLV3 3S7IA 4LQRA 4YG3A 3AYEA 4AVCA 1UZWA 1QJY2 1VPHA 2EA7A 2ZEZA 1CAVA 3I97A 5FJHA 1J1TA 4I3PA 1DIWA 1W9WA 4AVSA 2UY9A 2BYVE 3GJBA 3WX5A 5JXGA 2DCKA 3DYMA 4NPRA 4YVSB 1RIRA 4CPBA 2AUYA 3WQ7A 3MIVA 2C74A 5H9RA 1JZ6A 4A45A 4AI1A 2VCCA 3QBQA 1NQJA 4RR3B 4YM2A 1T2XA 3I4IA 1MPXA 1SQ4A 1V9U1 1JTZX 1NLRA 4HANA 2FD8A 1BYHA 3AMMA 4FSJA 2I07B 2R071 4DHSA 1UKRA 3PVBB 4XJZA 4AZZA 2B45X 3RZLA 3AXYC 1IS5A 1G9CA 4NROA 4S2HA 1WCQA 3B00A 3J7LA 2CSGA 3N7LA 3OBZA 4CZSA 5HXVA 4NWVA 4DXRA 2Y0IA 3HOBA 5DG2A 4FI9A 5GALA 3ZDSA 4AAXA 4D3WA 5I91A 1HRI3 3FFZA 1FYUA 1REDA 2ZMNA 3C7FA 4LO6B 4W8JA 2G1MA 4OUMA 1F9KA 4N7GA 3UKVA 4BQ4A 2AGSA 3NKGA 5FBJA 1CR7A 2W91A 3O1SA 4O46A 3WNLA 3ZFEB 4BYYA 1W8WA 1HXS2 2DCYA 2PAKA 1W99A 4D0QA 1FOD3 1ULEA 3I3DA 1WS5C 5EYXA 2XJSA 1YIPA 1H8TC 2A70A 2DURA 1H6XA 5LBCA 2CY6A 4ARXA 2RR11 4AE2A 1JYNA 3I59A 2XB6C 4ZY9A 3S6PA 3HBKA 1OURA 2WJSA 1A78A 2P6HA 4CEWC 4NMIA 5FZBA 1OBNA 2GUDA 2XLGA 3KCCA 1HN0A 5A7PA 3PTRB 2MHFA 4LPLA 4N53A 3VBFB 2EALA 2G9ZA 4LIVA 2D6KA 3DN7A 3NJZA 5DAVA 1DGLA 1SLCA 2OUHA 3P6BA 3PUQA 4FBFA 1CZTA 3OB8A 4JKKA 4KBBA 4QM8A 1O8SA 4JCKA 5JZGB 3HQXA 5EQUA 3IIIA 5GLVA 3AZVA 1BLZA 1NQDA 2ES3A 4N53B 2PHWA 4NN0A 4ZHNA 1MACA 2EXKA 1F35A 5D8AC 3V56A 2DTWA 4ZS3A 1A3KA 4QX2A 1B09A 2EIDA 2NN8A 3ITQA 4IQPA 3WLUA 3E6BA 4CEYA 4K1YA 3BPSA 3NJYA 4ZXKA 3USSA 3LL2A 2VTXJ 5EHDA 3UK9A 4KU8A 2ET7A 5F3CA 3RG0A 1AR92 1DP0A 2BJSA 1XNTA 4XAEA 4AGGA 4IXLA 2GNMA 3T0LA 2R16A 2GUXA 1G9AA 3UGHA 2JKXA 4RHV1 1SCRA 2PHTA 3BGAA 2HWB1 2OPWA 1GANA 1YC61 3N36A 3PNAA 2VO5A 1IS6A 1JUIA 4PBOA 1SCSA 4LO5B 1MVEA 5A80A 1TG7A 2FDGA 1WMDA 1G7YA 2ZTNA 1G9FA 4X6RB 2VE1A 3ZXJA 1AX0A 4AQSA 2ZACA 3AL5A 1S0CA 1HRV1 1JBCA 4UFIA 4E4HA 1VMFA 1JZ4A 1UGYA 4OMDA 2Q5TA 1V6NA 3AYCA 3ECQA 4AHZA 1ZRIA 2CTVA 3M50A 1RUF3 3SMLA 3VY6A 2WH0A 3HR9A 4FPJA 3T4HB 3W9AA 1QJY3 1VBD3 4IE6A 4MSVA 1ZZ7A 2QQLA 5TSWA 4PIUA 4QXCA 3H7YA 1K5MC 2HEYF 2CGNA 2GP5A 4LBQB 3SMMA 4PQ9A 1PXDA 4DRRA 4QGMA 3ME2A 4Q5OA 2QFEA 1YNAA 3VBFA 3ZYGA 5ISLA 4AHXA 3P1IA 1OA3A 4P9GA 2GNDA 4LHKA 3SMKA 5DZFA 3NAPC 5JDBA 1WBLA 4LJHA 1ST8A 4PDWC 1HV0A 1BZWA 4YGEA 1RUE3 1VIWB 4BE3A 2XVLA 3VBHB 1RJ7A 1POV1 1WW5A 4LHLA 5FKCA 1W9FA 3N9QA 4Q4W1 1H9WA 2Y0OA 1Y3TA 4D6SA 4E2QA 1JZ8A 1HV1A 5CZKA 1V6LA 1FMD2 5ABJA 2AACA 1IGOA 1YLLA 2IXLA 2ZGRA 3PIGA 4QPGB 5ANNA 2QCSB 3KF5A 4QQ2A 3VDBA 1M26A 4UW5A 1AR61 4W6XA 3UJQA 2V5DA 2V5YA 1VAMA 2XKOA 4W50A 2MEV1 5A3UA 2UWAA 2FDFA 2HWD2 4FPCA 5ABJC 3R4DB 2DTYA 3AMQA 2C4XA 3ILFA 2X8KA 3T0BA 3LGRA 3OYWB 4ZZ5A 3V0AA 3BTXA 4AFCA 1UY0A 2VMCA 4KI5M 4GH4A 3S5AA 1GOGA 4Y3BA 2HKXA 1S4CA 4D8MA 1AR93 1H4GA 2RM21 2ZOEB 5L73A 4DFSA 3MF6A 1ND3A 2ZEWA 1YWTA 1LU2A 2IFWA 2JE9A 4WVMB 1WW4A 4Y1UA 4E8CA 1IOAA 1UD1A 2VVDA 3N9NA 2I74A 1COV3 4UOJA 1REEA 2PLV1 3K3OA 4BJ0A 1G9BA 1H0BA 4JKLA 4IGQA 3NQHA 1PZ8A 3VZOA 2VW2A 5JI9A 5GLWA 3ZOIA 2X29A 4UAPA 4YYOA 4C0BA 2YDEA 1KDKA 4FP3A 4ASKA 4YVSA 3KT7A 4XJ8A 4P9XA 2VMGA 4NPLA 1ZBA3 2VXJA 1VAVA 1UIJA 4CCLA 1O4YA 5GJ6A 1OVSA 5C33A 3O8IA 2BWAA 3JBG3 3WNXA 4QPIC 1AYM2 4PF5A 5EV7A 3T1MA 1RMU3 1ZBE1 3WY6A 1D4M2 1ULGA 3KVBA 5CFCB 5I0RA 2BFUS 3JBG1 4CXYA 4QHOA 1PIV1 3FHIB 4XDPA 1HLCA 1QJAA 3ZHEB 2KXLA 4EV0A 1TNFA 1ASJ1 1VMOA 5K7PA 2JDNA 1F5JA 3AMPA 2F4PA 2WFF3 4Q0SA 3HWJA 1AX2A 3M8LA 4JZRA 5I8YA 4A7ZA 2XVGA 1E57A 2JDZA 3UNPA 1W90A 1HQNA 1BVVA 1ZZCA 2ZPXA 3O0WA 4H55A 3H1YA 4J25A 4QB2A 2BW8A 2DF7A 3VZNA 1C8NA 1UYYA 3U4XA 3K77A 5FR3A 1N1YA 5FMOS 4CUAA 4E2EA 2PA7A 2GUEA 3ZYHA 1GQGA 1JYXA 2O98A 1L7RA 4AQ2A 2GC0A 1CIWA 1J3PA 2NPMA 1NCQC 2A73B 2IC1A 4JRAA 4CU7A 3BOPA 1H1MA 1EPWA 1FI2A 3CZJA 3VZFA 4FFIA 2RG4A 4CDQC 2GNTA 4EYUA 4PIKA 4YW7A 1FV2A 4A41A 3DEMA 2WNEA 2WWJA 4TLFA 2C9AA 1AJOA 5LA2A 5FFOC 5H9QA 2PHLA 1TP8A 4FJ3A 3B02A 4OI4A 1JS9A 5BNQA 4CUGA 5FPZA 3I4RA 2P6CA 4LUKA 5A7WA 5BNOB 1LGCA 5FXVA 3VZMA 5FZAA 3AL6A 3K48A 4RQPA 4YM1A 2R072 2MEV3 1W2UA 4UFLA 2A75A 3BPZA 5CKQA 5JXJA 2KD7A 2XLFA 4QKFA 4A42A 1CAWA 3AZZA 1O9EA 1JU4A 2YFZA 2XMLA 5FZOA 5C7GA 1KXGA 4IE5A 2D97A 3FC0A 5EXAA 4AHWA 3NVCA 4BZ4A 3T1LA 4Q8LA 4M00A 5IATA 1RXFA 1RHI2 2GH8A 2WIIB 3V0AB 4O65A 1DF0A 4OULA 1YHFA 2B7YA 1VRH3 3LDRA 3ZKUA 3TNQA 4CE8A 1U5XA 2YUEA 2YBPA 3SC7X 3SISA 3LZZA 3TOWA 2NQYA 2D3PA 1CX1A 4Y32A 2VBPA 4AW7A 4RFRB 3AFGA 5T52A 4DHUA 4Y5IA 4QAWA 3U10A 5JM1A 5DQ0A 4CEYC 2D44A 1HB2A 3GM8A 3KCYA 5KHHA 3KT4A 3SNMA 3IQVA 1NE4A 1WLCA 3A0KA 4N7UA 4F83A 2RM22 5C5TA 5AC91 1PHMA 3AB0A 5GZFA 3LM1A 4H7LA 3V0BA 3WF3A 4CDQA 1KQRA 3THTA 4K8FA 3AVRA 2JDKA 1QF3A 3IQJA 4LITA 3LL0A 4I3GA 2AREA 1S0GA 4MHRA 2HWB3 4BK5A 4PCRA 5IFTA 3UL2A 3LIHA 4GB32 2WNUB 1QXRA 1Q8SA 4AEDC 5T5LA 2LS6A 4D7TA 5IVFA 5D3EA 2LTNA 4PIXA 5FPAA 1XNCA 2GMEA 4WM8A 3OY8B 1O9DA 3DL3A
chains in the Genus database with same CATH topology
3LPFA 4XUQA 3WF1A 1UMIA 2WABA 4DXSA 1W8NA 1UY4A 4DUWA 4MOAA 2X05A 5LA1A 2WO3A 1US3A 3CKHA 2Z4FA 4QDRA 4UI9L 1JZ3A 4E8DA 5FUIA 3J7HA 2ZXQA 3A23A 3W5NA 2X10A 3AC0A 2LW8A 3T09A 4KWUA 1ULOA 3MV11 2JD9A 4PF1A 5EIYB 2VZSA 1US2A 2W1QA 2J1RA 2VC9A 2W47A 4JX0A 3HNYM 3K4AA 5JMOA 1PX4A 1IQDC 2HLEA 2W94A 4OZOA 2VM9A 2QBXA 1W8OA 1UYZA 2W3JA 2XOMA 2XQXA 2WN3A 3OGVA 3GXUA 4RYDA 4XUTA 1PMJX 3I3EA 3GGLA 1W0NA 2CDOA 3MV01 3PUHA 4GWJA 3I2GA 1HN1A 4RN5A 1K42A 1GOFA 3GDBA 3DYOA 4P5YA 4BDVB 3T2QA 4YPJA 4LHSA 5JXIA 3HNMA 3A22A 2VMFA 3E1F1 1O59A 3MO4A 1RYYA 2J1VA 3LE0A 5B4XA 3HPNA 3VD5A 2VZPA 2DDUA 4A44A 1W9SA 2CDPA 3I2KA 1K12A 3I2IA 3VDAA 2WBKA 2PQSA 5HXMA 1GU3A 4ZZ8A 3I2HA 2C9KA 2BERA 3VD9A 1KGYA 2J1UA 5JR2A 3C7OA 1UYXA 2EIEA 4DEQA 1UZ0A 4XVHA 3NJVA 4ZXEA 5JUVA 3OBAA 3CZUA 3ETPA 1GOHA 5DMYA 1LNSA 4HG6B 2WO1A 4GZ9A 4CU9A 2W92A 3OGRA 3NNGA 3CIHA 1F4AA 3WNMA 2WZEA 3VD4A 1R64A 1SDDB 1EUTA 4TTGA 5IFPA 2Y6GA 4A3ZA 3WNPA 3ACHA 2B4KA 4DEVA 4QDSA 2XONA 3ZM8A 4CVUA 1XNAA 3CDZB 3D3AA 1D7PM 1O8PA 1K3IA 3HEIA 2OKXA 1CZVA 3I3BA 2QQMA 4LQRA 3SEPA 5CYYA 2ZEZA 1NX9A 4PQQA 3I97A 4IUGA 1I5PA 1W9WA 3FL7A 5JXGA 2DCKA 3DYMA 3JXSA 4CUCA 5IJRA 1JZ6A 4A45A 1W9TA 2VCCA 2VCBA 3MBWA 1T2XA 2WUHA 2BBAA 1MPXA 2W46A 1SHWB 3ACGA 1EUUA 2QQKA 3THCA 3U37A 2J1TA 3WNNA 4P00B 2E26A 3OG2A 1WCQA 1XC6A 2L9LA 3A21A 5G05L 4DXRA 3HOBA 2VZQA 3IAQA 4FI9A 4AAXA 3ABZA 2X09A 3SEEA 3C7FA 4W8JA 1BHGA 4DUXA 3WQBA 3SKJE 2W91A 2J1EA 2VZTA 3WNLA 1GQPA 1W99A 4D0QA 5B4NA 3I3DA 3BN6A 1H6XA 2XHNA 2WN2A 4ARXA 4OMCA 3WEZA 1JYNA 2ID4A 2QQNA 4QX3A 4ZY9A 2ORXA 3LQCA 4QDQA 2BGOA 4QX0A 3WNKA 1CIYA 3I2FA 4LKSA 4P02B 4LPLA 3ACFA 1UY2A 4XURA 3P6BA 2RV9A 5DPNA 1UWWA 1CZTA 3WF0A 4CU6A 3OB8A 4JKKA 5EJZB 1O8SA 2VCAA 3IIIA 2QQIA 3IB3A 4ARYA 4P08A 4QX2A 2EIDA 2J7MA 4Z2AA 3THDA 3MUY1 5C71A 3WSOA 1DP0A 1XNTA 2Y8KA 2EIBA 1SG3A 4CUBA 4L0PA 2JKXA 5JXHA 3BGAA 3T08A 2VO5A 3DYPA 1TG7A 2VMDA 2VQTA 1UX7A 3NJXA 2B9VA 3HNBM 1JZ4A 2VZRA 1L7QA 4OMDA 1WKYA 3ECQA 3T0AA 2E31A 1CZSA 1GMMA 3WF4A 1P8JA 3CQOA 2Y64A 4QB6A 2QQLA 4BXSV 2ZEXA 2W87A 3K4DA 2Y6JA 4QB1A 4A6OA 3FHQA 3P1IA 2WAOA 2BGPA 4KMQA 5F7UA 3X0UA 2QQJA 3IDAA 2DCJA 3LEIA 2YB7A 1OF4A 2VZUA 2E33A 3VD3A 1JZ8A 2Y6LA 5CZKA 1GUIA 2W1UA 5IYYA 2Y6KA 5LA0A 1NUKA 4XUPA 5DN2A 3WF2A 3VDBA 4QPWA 2V5DA 4W50A 5IHRA 4CU8A 4M4PA 2ORZA 2EICA 3HJRA 2C4XA 3T0BA 2WQ8A 1UXZA 4ZZ5A 1JZ5A 3ACIA 4OUEA 1UY0A 2VMCA 4KI5M 1JZ7A 3OEAA 2J22A 1GOGA 2W9XA 4D8MA 1GNYA 2JDAA 5LCWL 2ZEWA 1PX3A 2WYSA 4E8CA 5HPOA 2VQUA 4UOJA 5C70A 4BJ0A 3FHAA 3NRUA 2YFUA 4JKLA 3NQHA 3W5MA 2HYXA 1NKGA 4MGQA 4UAPA 4XUNA 3C8XA 2W1SA 3SKVA 2WAAA 1JHJA 1OT5A 2VZOA 1F4HA 1JZ2A 2VJXA 3F2ZA 2WZ8A 3T0DA 3MUZ1 2BZDA 2YC2A 3K75B 3T2PA 4W4ZA 2W5FA 4BK4A 3LEKA 2V4VA 2Y6HA 3LPGA 4AG4A 3DECA 3VD7A 5G04L 5A1AA 2ZEYA 3A7QA 3EB7A 1UXXX 2VL4A 2VMEA 2VR4A 3UNPA 3LEGA 4XZUG 2VZ3A 2W95A 4QB2A 1UYYA 3K77A 1DLCA 4CUAA 4PT6A 3C7EA 1JYXA 3PUIA 1TVGA 4GWIA 4M4RA 4TXWA 4ET7A 1L7RA 2J1AA 1OF3A 4CU7A 2WO2A 3C7GA 1UMHA 3CZJA 3IAPA 2VOTA 1DYOA 4A41A 1J83A 1UY1A 2JE8A 5LA2A 1YQ2A 3FN9A 2QQOA 3T2OA 2V72A 3EYPA 3UESA 1OD3A 4MADA 1ULPA 2RVAA 1K45A 2E32A 5JXJA 2KD7A 4A42A 1JYWA 1OH4A 2YFZA 1JU4A 1PMHX 5C7GA 1J84A 3UETA 5J1XA 2WDBA 3WNOA 4A4AA 3CMGA 2RJ2A 4DUVA 3VDCA 4DXTA 1UY3A 4MGSA 1H6YA 1CX1A 2J1SA 3C7HA 2YG0A 3OGSA 4QAWA 2VZ1A 4MO3M 5DQ0A 3GM8A 3K46A 2VTFA 1KEXA 3I2JA 4JKMA 3WF3A 3HN3A 4OYUA 4QX1A 2C26A 2VZVA 4BK5A 2W1WA 1NAEA 1JYVA 5IFTA 2YC4A 1JU3A 1XPWA 2R7EB 2LS6A 5EJ1B 3K4ZA 4JHZA 4XUOA 3OEBA 1JI6A 5I0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPF A;  4XUQ A;  3WF1 A;  1UMI A;  2WAB A;  4DXS A;  1W8N A;  1UY4 A;  4DUW A;  4MOA A;  2X05 A;  5LA1 A;  2WO3 A;  1US3 A;  3CKH A;  2Z4F A;  4QDR A;  4UI9 L;  1JZ3 A;  4E8D A;  5FUI A;  3J7H A;  2ZXQ A;  3A23 A;  3W5N A;  2X10 A;  3AC0 A;  2LW8 A;  3T09 A;  4KWU A;  1ULO A;  3MV1 1;  2JD9 A;  4PF1 A;  5EIY B;  2VZS A;  1US2 A;  2W1Q A;  2J1R A;  2VC9 A;  2W47 A;  4JX0 A;  3HNY M;  3K4A A;  5JMO A;  1PX4 A;  1IQD C;  2HLE A;  2W94 A;  4OZO A;  2VM9 A;  2QBX A;  1W8O A;  1UYZ A;  2W3J A;  2XOM A;  2XQX A;  2WN3 A;  3OGV A;  3GXU A;  4RYD A;  4XUT A;  1PMJ X;  3I3E A;  3GGL A;  1W0N A;  2CDO A;  3MV0 1;  3PUH A;  4GWJ A;  3I2G A;  1HN1 A;  4RN5 A;  1K42 A;  1GOF A;  3GDB A;  3DYO A;  4P5Y A;  4BDV B;  3T2Q A;  4YPJ A;  4LHS A;  5JXI A;  3HNM A;  3A22 A;  2VMF A;  3E1F 1;  1O59 A;  3MO4 A;  1RYY A;  2J1V A;  3LE0 A;  5B4X A;  3HPN A;  3VD5 A;  2VZP A;  2DDU A;  4A44 A;  1W9S A;  2CDP A;  3I2K A;  1K12 A;  3I2I A;  3VDA A;  2WBK A;  2PQS A;  5HXM A;  1GU3 A;  4ZZ8 A;  3I2H A;  2C9K A;  2BER A;  3VD9 A;  1KGY A;  2J1U A;  5JR2 A;  3C7O A;  1UYX A;  2EIE A;  4DEQ A;  1UZ0 A;  4XVH A;  3NJV A;  4ZXE A;  5JUV A;  3OBA A;  3CZU A;  3ETP A;  1GOH A;  5DMY A;  1LNS A;  4HG6 B;  2WO1 A;  4GZ9 A;  4CU9 A;  2W92 A;  3OGR A;  3NNG A;  3CIH A;  1F4A A;  3WNM A;  2WZE A;  3VD4 A;  1R64 A;  1SDD B;  1EUT A;  4TTG A;  5IFP A;  2Y6G A;  4A3Z A;  3WNP A;  3ACH A;  2B4K A;  4DEV A;  4QDS A;  2XON A;  3ZM8 A;  4CVU A;  1XNA A;  3CDZ B;  3D3A A;  1D7P M;  1O8P A;  1K3I A;  3HEI A;  2OKX A;  1CZV A;  3I3B A;  2QQM A;  4LQR A;  3SEP A;  5CYY A;  2ZEZ A;  1NX9 A;  4PQQ A;  3I97 A;  4IUG A;  1I5P A;  1W9W A;  3FL7 A;  5JXG A;  2DCK A;  3DYM A;  3JXS A;  4CUC A;  5IJR A;  1JZ6 A;  4A45 A;  1W9T A;  2VCC A;  2VCB A;  3MBW A;  1T2X A;  2WUH A;  2BBA A;  1MPX A;  2W46 A;  1SHW B;  3ACG A;  1EUU A;  2QQK A;  3THC A;  3U37 A;  2J1T A;  3WNN A;  4P00 B;  2E26 A;  3OG2 A;  1WCQ A;  1XC6 A;  2L9L A;  3A21 A;  5G05 L;  4DXR A;  3HOB A;  2VZQ A;  3IAQ A;  4FI9 A;  4AAX A;  3ABZ A;  2X09 A;  3SEE A;  3C7F A;  4W8J A;  1BHG A;  4DUX A;  3WQB A;  3SKJ E;  2W91 A;  2J1E A;  2VZT A;  3WNL A;  1GQP A;  1W99 A;  4D0Q A;  5B4N A;  3I3D A;  3BN6 A;  1H6X A;  2XHN A;  2WN2 A;  4ARX A;  4OMC A;  3WEZ A;  1JYN A;  2ID4 A;  2QQN A;  4QX3 A;  4ZY9 A;  2ORX A;  3LQC A;  4QDQ A;  2BGO A;  4QX0 A;  3WNK A;  1CIY A;  3I2F A;  4LKS A;  4P02 B;  4LPL A;  3ACF A;  1UY2 A;  4XUR A;  3P6B A;  2RV9 A;  5DPN A;  1UWW A;  1CZT A;  3WF0 A;  4CU6 A;  3OB8 A;  4JKK A;  5EJZ B;  1O8S A;  2VCA A;  3III A;  2QQI A;  3IB3 A;  4ARY A;  4P08 A;  4QX2 A;  2EID A;  2J7M A;  4Z2A A;  3THD A;  3MUY 1;  5C71 A;  3WSO A;  1DP0 A;  1XNT A;  2Y8K A;  2EIB A;  1SG3 A;  4CUB A;  4L0P A;  2JKX A;  5JXH A;  3BGA A;  3T08 A;  2VO5 A;  3DYP A;  1TG7 A;  2VMD A;  2VQT A;  1UX7 A;  3NJX A;  2B9V A;  3HNB M;  1JZ4 A;  2VZR A;  1L7Q A;  4OMD A;  1WKY A;  3ECQ A;  3T0A A;  2E31 A;  1CZS A;  1GMM A;  3WF4 A;  1P8J A;  3CQO A;  2Y64 A;  4QB6 A;  2QQL A;  4BXS V;  2ZEX A;  2W87 A;  3K4D A;  2Y6J A;  4QB1 A;  4A6O A;  3FHQ A;  3P1I A;  2WAO A;  2BGP A;  4KMQ A;  5F7U A;  3X0U A;  2QQJ A;  3IDA A;  2DCJ A;  3LEI A;  2YB7 A;  1OF4 A;  2VZU A;  2E33 A;  3VD3 A;  1JZ8 A;  2Y6L A;  5CZK A;  1GUI A;  2W1U A;  5IYY A;  2Y6K A;  5LA0 A;  1NUK A;  4XUP A;  5DN2 A;  3WF2 A;  3VDB A;  4QPW A;  2V5D A;  4W50 A;  5IHR A;  4CU8 A;  4M4P A;  2ORZ A;  2EIC A;  3HJR A;  2C4X A;  3T0B A;  2WQ8 A;  1UXZ A;  4ZZ5 A;  1JZ5 A;  3ACI A;  4OUE A;  1UY0 A;  2VMC A;  4KI5 M;  1JZ7 A;  3OEA A;  2J22 A;  1GOG A;  2W9X A;  4D8M A;  1GNY A;  2JDA A;  5LCW L;  2ZEW A;  1PX3 A;  2WYS A;  4E8C A;  5HPO A;  2VQU A;  4UOJ A;  5C70 A;  4BJ0 A;  3FHA A;  3NRU A;  2YFU A;  4JKL A;  3NQH A;  3W5M A;  2HYX A;  1NKG A;  4MGQ A;  4UAP A;  4XUN A;  3C8X A;  2W1S A;  3SKV A;  2WAA A;  1JHJ A;  1OT5 A;  2VZO A;  1F4H A;  1JZ2 A;  2VJX A;  3F2Z A;  2WZ8 A;  3T0D A;  3MUZ 1;  2BZD A;  2YC2 A;  3K75 B;  3T2P A;  4W4Z A;  2W5F A;  4BK4 A;  3LEK A;  2V4V A;  2Y6H A;  3LPG A;  4AG4 A;  3DEC A;  3VD7 A;  5G04 L;  5A1A A;  2ZEY A;  3A7Q A;  3EB7 A;  1UXX X;  2VL4 A;  2VME A;  2VR4 A;  3UNP A;  3LEG A;  4XZU G;  2VZ3 A;  2W95 A;  4QB2 A;  1UYY A;  3K77 A;  1DLC A;  4CUA A;  4PT6 A;  3C7E A;  1JYX A;  3PUI A;  1TVG A;  4GWI A;  4M4R A;  4TXW A;  4ET7 A;  1L7R A;  2J1A A;  1OF3 A;  4CU7 A;  2WO2 A;  3C7G A;  1UMH A;  3CZJ A;  3IAP A;  2VOT A;  1DYO A;  4A41 A;  1J83 A;  1UY1 A;  2JE8 A;  5LA2 A;  1YQ2 A;  3FN9 A;  2QQO A;  3T2O A;  2V72 A;  3EYP A;  3UES A;  1OD3 A;  4MAD A;  1ULP A;  2RVA A;  1K45 A;  2E32 A;  5JXJ A;  2KD7 A;  4A42 A;  1JYW A;  1OH4 A;  2YFZ A;  1JU4 A;  1PMH X;  5C7G A;  1J84 A;  3UET A;  5J1X A;  2WDB A;  3WNO A;  4A4A A;  3CMG A;  2RJ2 A;  4DUV A;  3VDC A;  4DXT A;  1UY3 A;  4MGS A;  1H6Y A;  1CX1 A;  2J1S A;  3C7H A;  2YG0 A;  3OGS A;  4QAW A;  2VZ1 A;  4MO3 M;  5DQ0 A;  3GM8 A;  3K46 A;  2VTF A;  1KEX A;  3I2J A;  4JKM A;  3WF3 A;  3HN3 A;  4OYU A;  4QX1 A;  2C26 A;  2VZV A;  4BK5 A;  2W1W A;  1NAE A;  1JYV A;  5IFT A;  2YC4 A;  1JU3 A;  1XPW A;  2R7E B;  2LS6 A;  5EJ1 B;  3K4Z A;  4JHZ A;  4XUO A;  3OEB A;  1JI6 A;  5I0D A; 
#chains in the Genus database with same CATH topology
 3LPF A;  4XUQ A;  1MVQ A;  4KGG A;  4NR1 A;  5BNP A;  3P3P A;  1CN1 A;  2RDQ A;  4EN7 B;  2WZR 1;  1HDK A;  1YFX A;  4DXS A;  1UF2 C;  4XF1 A;  1UY4 A;  1D4M 3;  4MOA A;  4I30 A;  2WO3 A;  3CKH A;  2Z4F A;  5LAT A;  2CGO A;  2ZGK A;  2X5I A;  4UI9 L;  3LFI A;  3PVE A;  1DDL A;  4BQ1 A;  1RUE 2;  3J7H A;  4FFF A;  2ZXQ A;  4L2N A;  2ZHK A;  2ENR A;  1NZI A;  2QQP A;  4JVA A;  3T09 A;  4XMI A;  2WRA A;  2WT2 A;  4XF0 A;  4B4P A;  4O61 A;  1RXG A;  2EF6 A;  1PGW 1;  3MV1 1;  3PUR A;  5BNO A;  4W65 A;  5J4T A;  5FLI A;  1OUX A;  1YEW A;  2GAU A;  4Q4Y 1;  3WG1 A;  2G4I A;  3IMM A;  2ZAB A;  3N3H A;  4KU7 A;  1Q8O A;  4CDW C;  2W47 A;  1VRH 1;  1PX4 A;  1IQD C;  4RGG A;  3ES4 A;  2D6P A;  4R9D A;  2W94 A;  2P34 A;  3POY A;  4GB3 3;  4OZO A;  2B42 B;  4UW4 A;  3WCR A;  2BVV A;  1W8O A;  2HWB 2;  3DXT A;  2UU8 A;  5ACA 3;  1RUH 2;  4DY5 A;  2W3J A;  3NV1 A;  2WS9 3;  4HON A;  1W39 A;  3GXU A;  1W6P B;  3UX0 A;  4XUT A;  3I3E A;  4DIN B;  4YFW A;  3N9M A;  2Q1F A;  2CDO A;  1DQ1 A;  3M7A A;  1W3X A;  3PUH A;  1J4S A;  1RUI 1;  1W8T A;  1X36 A;  2FCU A;  2RM2 3;  1A8M A;  2XBO 3;  2A7A A;  1J3Q A;  3AZW A;  2GH2 A;  1HN1 A;  3CNA A;  4IV1 C;  4YVW C;  5FZ1 A;  5JSO A;  2W52 A;  1RUF 2;  4LEJ A;  2ZX2 A;  1LTE A;  3WDX A;  4YPJ A;  3ZXF A;  4B4Q A;  5EFU A;  5KC6 A;  2DCT A;  4C1W A;  1C1F A;  3RRD A;  1PVC 2;  2VOX A;  2VMF A;  5CVR A;  1VBA 2;  2WQZ C;  1O59 A;  1V6J A;  4UWD A;  1QH7 A;  4YVW B;  3MO4 A;  2BRT A;  2C1F A;  4LXL A;  2J1V A;  5FXX A;  2IFR A;  3LE0 A;  3ETQ A;  3VD5 A;  4IEZ A;  4XCB A;  2YZ4 A;  4UXA A;  4FT8 A;  3VKF C;  2R1D A;  4FOW A;  3QLQ A;  1UOB A;  1R08 3;  2FZ2 A;  1VAK A;  3P1O A;  2G9G A;  3HD8 B;  4JC1 A;  4ZQ0 A;  2C23 A;  2QTW B;  4WVZ A;  2ZZJ A;  4BHP A;  3FFQ A;  1A6C A;  4IEX A;  1SBF A;  2WBK A;  5HXM A;  4AOC A;  4FTE A;  2O8P A;  4DAT A;  3R0R A;  4PDW B;  1YJK A;  4LA3 A;  5BNN A;  3UKN A;  3I2H A;  1JHN A;  5JLV A;  2JZ4 A;  2BOI A;  2ZKN A;  4CP9 B;  3C7O A;  4CCO A;  3B9I A;  1V6I A;  2ARX A;  5C4W C;  3ZN6 A;  1LU1 A;  1PVX A;  4URT A;  4ZXE A;  3LKY A;  3OBA A;  4DY3 A;  5EXO A;  3E6C C;  2WNV A;  1FPN 1;  3O44 A;  3CL1 A;  3N7J A;  3CZU A;  3ETP A;  1YJL A;  2RMU 3;  1MQT B;  1W0P A;  2X5I B;  1GWM A;  4FPK A;  1W6Q B;  2Y33 A;  2ZHL A;  4I09 A;  5J98 B;  4AYU A;  2PAE A;  4E2S A;  2BGC A;  4GZ9 A;  2JDM A;  1R1A 3;  1WGP A;  2YBK A;  3HAG A;  4FOY A;  4GXL A;  1RUF 1;  2O02 A;  3NNG A;  3RZM A;  3CIH A;  1DYP A;  2HBU A;  1R09 1;  4NE9 A;  1UKG A;  4R4Z A;  1T6B X;  3WDW A;  4TTG A;  4A3Z A;  4BQY A;  1X82 A;  1MZE A;  1NXD 1;  4P9J A;  1D0G A;  4BLI A;  4IEA A;  2FZ1 A;  4DXZ A;  1LOC A;  4G9S B;  4I2O A;  1PVC 3;  1W6O A;  4OHY A;  2XON A;  3SH4 A;  1WZX A;  3RWK X;  3LLZ A;  1AL0 G;  2XJQ A;  2P3I A;  5FK7 A;  3WW1 A;  3CDZ B;  1EP0 A;  2FQP A;  3D3A A;  1QXP A;  1RUJ 1;  1FNY A;  3KLS A;  2WNU A;  4NVP A;  2PEL A;  1PO2 2;  3U14 A;  5BV6 A;  4E4D X;  3DCQ A;  4RQP C;  5FMD A;  2QQM A;  3NW4 A;  1E5S A;  1WW7 A;  3FUO A;  4HK9 A;  1CAX A;  1VBC 1;  3MYX A;  3SEP A;  5CYY A;  1BMV 2;  4YG6 A;  5A1F A;  3O5S A;  2RMU 1;  3WOC A;  3V0B B;  4IEU A;  1I5P A;  3R4U A;  3VBH A;  4DHR A;  2BQ0 A;  1HJF A;  1C8M 2;  3FL7 A;  3AYD A;  5FTT C;  4BPZ A;  4RQP B;  3N9L A;  4BM8 A;  4JC3 A;  1W9T A;  4CP9 A;  1AHS A;  1ZZ9 A;  2VCB A;  4AED B;  4UW6 A;  4GAZ A;  3JD7 2;  2WUH A;  1X33 A;  4XE9 A;  5DUW A;  4NUB A;  1CJD A;  1LOE A;  2W46 A;  3PJQ A;  4PDW A;  5D21 A;  5FZD A;  4EJR A;  5KHJ A;  4AK4 A;  3WHU A;  2ZBJ A;  1Q56 A;  3D5O A;  3THC A;  1RTV A;  5IQP A;  3H3U A;  4P00 B;  3SCH A;  3LLY A;  4COY A;  1UH1 A;  2E26 A;  4LO8 A;  5IAV A;  4AI0 A;  1PGL 2;  1SPP B;  1XC6 A;  2HYQ A;  5LK5 A;  5K8S A;  1VP6 A;  2GDF A;  4A2U A;  5M0T A;  5CBL A;  3BIE A;  2CAV A;  1HXS 3;  3J7N A;  5LBE A;  2VZQ A;  1XU2 A;  2XWJ B;  3PU3 A;  2D93 A;  1CAW B;  2X09 A;  4NHX A;  4OLL A;  3HBZ A;  3MEP A;  2OQ6 A;  1OOP A;  1POQ A;  1RUD 1;  1VBE 2;  3BU7 A;  4YW4 A;  3VBO B;  3WQB A;  1WS4 A;  4HN0 A;  2LAL A;  2AH2 A;  3NMB A;  3EXU A;  1ENX A;  4JGZ B;  4JGY A;  3AK0 A;  5F37 A;  2OZJ A;  2VQA A;  1GQP A;  1O5L A;  1AXK A;  4PJY A;  3UZD A;  2P17 A;  3F95 A;  2E51 A;  2VAU A;  4GB3 1;  1S1A A;  5B4N A;  4IV1 A;  3KWV A;  3WDT A;  4CDU B;  4PHZ A;  3RQ0 A;  3NV3 A;  4OMC A;  4GWN A;  3WEZ A;  1AUY A;  2ID4 A;  4LK6 A;  2ARA A;  1SZB A;  1W6P A;  4QX3 A;  4MQ0 A;  2ORX A;  2WL1 A;  2CAU A;  1HRI 1;  4QX0 A;  2BGO A;  3TN9 2;  4AFB A;  3I2F A;  3KS7 A;  3ZFF C;  1RJ8 A;  2WZP P;  1AL2 3;  1XJA A;  4HVR A;  3PME A;  1R1A 1;  1IS4 A;  2ZKL A;  1LHN A;  1UY2 A;  4LT5 A;  1PK6 B;  2AYH A;  4XUR A;  5FZE A;  3MIT A;  1TOQ A;  5DPN A;  1UWW A;  4DNK A;  1STM A;  5FIX A;  5A7S A;  4MGI E;  3WF0 A;  3IQU A;  3ZPO A;  2VCA A;  4CU6 A;  1RUO A;  5T5P A;  5JWP A;  3QAC A;  1AR8 1;  2ZGM A;  1H2M A;  3HVD A;  4OQ9 A;  4ARY A;  2Q8E A;  4AK3 A;  3MZH A;  3WQ1 A;  3WXP A;  1N3Q A;  5FMC A;  4B3N A;  3ZSM A;  5FY9 A;  3MW2 A;  4A7Y A;  4ISQ A;  2HWD 3;  1EV1 3;  3S7E A;  4ONU A;  4FAG A;  5DDJ 3;  5CFD A;  3THD A;  1UIK A;  4H2A A;  3FWE A;  3MUY 1;  4RA0 A;  4OHZ A;  3ASI A;  3RYR A;  1V9U 3;  5L7O A;  1W6M A;  2IXJ A;  3KQ4 B;  3LA3 A;  5AVA A;  4CA9 A;  1Y9M A;  1SDW A;  5F5A A;  2XL9 A;  2IXC A;  1ND3 C;  2Y8K A;  2E53 A;  2EIB A;  4DOU A;  4YSF A;  4PBP A;  1E5R A;  5SV8 A;  1LGB A;  5JZG C;  4L0P A;  3JQW A;  1HX6 A;  3VDD C;  3VBR C;  1F31 A;  1V0A A;  5FYM A;  1Z0H A;  5EWS A;  4YVS C;  5DZE A;  2AC1 A;  4IES A;  5D2D A;  2B9V A;  2B46 X;  2X5I C;  4HMZ A;  4UFH A;  3L2Y A;  1WKY A;  1BVP 1;  2P37 A;  4FOV A;  4QX8 A;  5A1A A;  2E31 A;  3U4S A;  1CZS A;  2WQ4 A;  3NKX A;  1CQ9 A;  1XXN A;  3WF4 A;  5KWR A;  1P8J A;  2DU0 A;  3L2H A;  1ND3 B;  1W6M B;  4NJ4 A;  4K21 A;  4XMA A;  2HWC 2;  4Y24 A;  2R06 1;  2W87 A;  4Z1V A;  3J26 N;  4UFK A;  3PHM A;  3P5B A;  5FPB A;  2XKP A;  1J4U A;  3P1Q A;  4ZPI A;  5KHG A;  1ZRC A;  3IT8 A;  4GMP 3;  3FHQ A;  3R4S A;  3RDI A;  3VV1 A;  2WAO A;  3DGT A;  1K5J A;  5BY9 A;  5GZC A;  2WA4 A;  2BGP A;  1ASJ 2;  4MGK E;  1N1V A;  4YLZ A;  3AKP A;  3MHR A;  4Y1Y A;  5A3O A;  2DCJ A;  1AX1 A;  1QJF A;  2PHR A;  2F6B A;  2VZU A;  4V2V A;  1CAV B;  4YW3 A;  5FZ9 A;  5T5O A;  4IGP A;  3RYP A;  3WUD A;  1LRH A;  5F2W A;  5ABJ B;  3RJ2 X;  1RUG 3;  1W9Y A;  2I45 A;  4MVT A;  1ZBE 2;  2O0O A;  4KNC A;  5IYY A;  2BEO A;  1AYM 1;  1CPN A;  2Y6K A;  1H2N A;  3VDD A;  4KQ7 A;  1BEV 2;  2ZGU A;  4XUP A;  3SCG A;  4KBZ A;  5FO7 B;  5L9B A;  3WF2 A;  3AZY A;  1F5F A;  4C0H A;  3UAL A;  5L7O B;  4COU A;  1EYB A;  4QPW A;  1BQP A;  3SLI A;  1DU3 D;  1S0F A;  4YW1 A;  4CU8 A;  3SP5 A;  1DQ2 A;  5E8A A;  4M4P A;  4LLO A;  1WMF A;  2JG8 B;  2EIC A;  1RL3 A;  1JXN A;  1OPM A;  1LOF A;  1UAI A;  4HFS A;  3TNP B;  2WQ8 A;  4E27 A;  1JZ5 A;  2D5F A;  4OUE A;  5JI7 A;  3ZDV A;  5CFD C;  1QEX A;  2XBO 1;  2PLV 2;  3G7D A;  3GJA A;  4AGR A;  1W2N A;  3TBD A;  1FT9 A;  1GNY A;  2ZZQ A;  1X8M A;  5FP3 A;  3POW A;  3CO2 A;  1PX3 A;  2WYS A;  2XXZ A;  5FUP A;  4HT1 T;  4JDM A;  2N7G A;  1GSL A;  2VQU A;  2YRO A;  4LHN A;  2OYZ A;  4CRQ A;  4WZC A;  4DB5 A;  5BNO C;  1LB2 A;  3GYD A;  3FHA A;  1X50 A;  2YFU A;  3J7M A;  4R6R A;  4K8R B;  2HYX A;  4OHX A;  2VMH A;  4MGQ A;  3ZO0 B;  5AFB A;  1NY7 2;  1C1L A;  2A3Y A;  1YFY A;  3KV6 A;  5IAX A;  3HMY A;  1RUI 3;  3WDV A;  3ES1 A;  4FP2 A;  3BTY A;  5CNA A;  3ZN5 A;  1PO1 2;  3QH6 A;  1O9C A;  1F15 A;  2BQP A;  5FMB A;  2MNG A;  3RNS A;  5GZD A;  2BTP A;  1IHM A;  4XAB A;  1JZ2 A;  3KV5 A;  1WCK A;  2VMI A;  2Q8C A;  4DHQ A;  4CDU A;  4F8A A;  1WD4 A;  3MW3 A;  2ZGS A;  1XSR A;  1S2B A;  2SBA A;  2JDY A;  2YC2 A;  4RS5 C;  5EP9 A;  1QJU 2;  1SLB A;  2AR6 A;  3T30 A;  4J1W A;  1W3V A;  3FBY A;  4W4Z A;  1AR7 3;  3L9J T;  1H1A A;  2Z42 A;  4NRM A;  3ZSJ A;  4BK4 A;  3WOG A;  3RFR A;  2GZW A;  2V4V A;  4YW6 A;  4EWD A;  2W2I A;  5CIS A;  2A6Z A;  1CGP A;  4AKD A;  1ONA A;  1QQP 1;  2ARC A;  4Q2F A;  4QM9 A;  3UJO A;  3SMN A;  2VY0 A;  3VD7 A;  4QKB A;  3ZIX A;  4HBN A;  5IUQ A;  3KMH A;  2P2K A;  2VW0 A;  1UO9 A;  2XJT A;  1H4H A;  2ZEY A;  3B01 A;  3VN4 A;  2YU2 A;  3H1M A;  1SFP A;  3A0N A;  4GJY A;  3H8U A;  5BUV A;  1SPP A;  5IVB A;  4Z07 A;  3O14 A;  1KDM A;  5EWZ A;  5GZG A;  1Z7S 3;  5LRR A;  1W8F A;  4MUV A;  3ZFE A;  5JOW A;  4Q29 A;  1XU1 A;  3LEG A;  1XYO A;  2FDH A;  1CX4 A;  4FFG A;  3C2U A;  2ZGN A;  1BK0 A;  1NZC A;  1Q43 A;  4K40 A;  5LEJ A;  4P9W A;  4V1P A;  4PT6 A;  1RVF 1;  1MQT C;  3B5L B;  1QJU 1;  1ND2 C;  2ZX3 A;  1BCX A;  1TVG A;  2GU9 A;  4TXW A;  2ZHM A;  2WZR 3;  5GLT A;  1AL2 2;  3QH7 A;  2WO2 A;  3T4V A;  3I2D A;  2IVI B;  2NM1 A;  3JQX A;  1ULD A;  2K0G A;  1UMH A;  3C7G A;  2ZGQ A;  4QX7 A;  3IAP A;  4ZON A;  2JB4 A;  5IVJ A;  4NHM A;  5DG1 A;  4XFG A;  3ZYP A;  4BU2 A;  1NLQ A;  2BNN A;  1TQ5 A;  1MQT A;  1UY1 A;  5K0U A;  2VOV A;  3M1H A;  2JDH A;  1VBB 2;  1Z7S 2;  3POB A;  3OD4 A;  4M01 A;  4J1X A;  3POS A;  4XJA A;  5GM0 A;  4E9K A;  1Z7S 1;  1DCS A;  2V72 A;  5EPA A;  5FQ0 B;  5FYV A;  5FP7 A;  5IVY A;  3UES A;  1IPS A;  5J48 A;  3B7M A;  1KUJ A;  3LA2 A;  1UZV A;  4C90 A;  2JG9 B;  3PMS A;  1K45 A;  5BNN B;  1DHK B;  4AI9 A;  4CP0 A;  3ZPY A;  3SMO A;  4BQ3 A;  3JZV A;  1JYW A;  5GLZ A;  3VKM A;  1C8M 3;  4A3X A;  4ITC A;  2TEP A;  5CA6 A;  3U0Z A;  3HQU A;  2VUL A;  4CPB D;  1ZRD A;  4WM7 B;  3ZKY A;  1J84 A;  3VHN A;  3WNO A;  2W39 A;  3CMG A;  4A4A A;  2BNM A;  3D8C A;  5JPM B;  1ALY A;  3RSJ A;  2XJP A;  3LDK A;  4YGB A;  4CP2 A;  1W0O A;  4DUV A;  3Q8C A;  1YQ5 A;  1RUC 1;  1S2K A;  4DDN A;  3CQG A;  2PXJ A;  1OSG A;  2OPK A;  1UY3 A;  1C5H A;  3NV4 A;  3O0V A;  4WM7 C;  2JWP A;  2R06 3;  4XW3 A;  4YZ1 A;  4W6W A;  3VHR A;  2J1S A;  2OW4 A;  1C3K A;  3C7H A;  4Q4V 2;  4IW3 A;  2YG0 A;  4AXO A;  1VLN A;  2JIG A;  3LSD A;  5C3P A;  1AR7 1;  1AXZ A;  1PM4 A;  1RIT A;  5BNN C;  5JCT A;  1RMU 1;  1ZBE 3;  3H42 B;  4N9I A;  4FOQ A;  3I49 A;  4AQT A;  4UBG A;  3I7D A;  2WNV C;  5GLU A;  2VTF A;  3O0X A;  5A3W A;  3MHZ A;  5FO9 B;  4LBQ A;  2P5B A;  1JOT A;  2RS5 1;  5H9S A;  5LVZ A;  5FZF A;  5F5Q A;  1PGS A;  1VR3 A;  4AKC A;  4YW5 A;  1QJX 1;  1TMF 1;  1YQ6 A;  1O3R A;  4RGA A;  1S2E A;  2OX0 A;  2YHJ A;  2IVJ A;  1DZQ A;  2GUC A;  4V2W A;  4NIA A;  4BME A;  2YC4 A;  5DAB A;  2FHR A;  2ZHN A;  4K9S A;  1XPW A;  2R7E B;  5EJ1 B;  1UOJ A;  1IKQ A;  2DU1 A;  1C57 A;  5FZG A;  5F2S A;  1ZM1 A;  3ZXK A;  4AQ6 A;  1LEM A;  4NOT A;  4XUO A;  3KZ4 C;  3OEB A;  3M3I A;  4Y5Z 0;  1LOF C;  5I0D A;  1X8E A;  5AVP A;  4G3Y C;  1BEV 3;  2UWC A;  1ZNP A;  4MX3 A;  3AKT A;  5LY1 A;  4QQO A;  4IET A;  2HWE 1;  2JJ6 A;  4P5H A;  4E2G A;  3GBF A;  2WAB A;  3GHM A;  2QDR A;  3VZG A;  1O7F A;  1RVF 3;  4NPM A;  3SMH A;  2AEY A;  1US3 A;  1Y9G A;  1ZRR A;  2Q1Z B;  3QOP A;  4O9G A;  1L3J A;  1UPS A;  4K7J A;  4XXP A;  2FBE A;  2C24 A;  2LRO A;  4HKW A;  2V73 A;  3MFA A;  4UYB A;  3ENR A;  4C8D A;  2VUC A;  5CFC A;  3R51 A;  2LW8 A;  4FO9 A;  5C8C C;  4IV3 C;  3AMH A;  3DKQ A;  3RZZ A;  4Q4X 2;  1V70 A;  1RHI 1;  4BG6 A;  4NAM A;  3CF6 E;  3VBU A;  2JD9 A;  3K3N A;  1LEC A;  1QDC A;  1A8D A;  2HEW F;  5FY0 A;  5F74 A;  1HQL A;  1CJP A;  2EAK A;  4N43 C;  1O4T A;  3FLP A;  2BWC A;  2QUO A;  1PMI A;  2CNA A;  3KV9 A;  3N4M A;  2VC9 A;  2JDP A;  3OY8 A;  5FZC A;  5J31 A;  1EY2 A;  4KWK A;  4AHY A;  1NLS A;  1REF A;  3K4A A;  1I3H A;  2PTM A;  1GR3 A;  2Q1M A;  1RC6 A;  2WS9 2;  5A3P A;  3DKW A;  1T6G C;  4FXG B;  4GIQ A;  2RDN A;  5C9A C;  2GTY A;  1HIX A;  4LO7 A;  2WT1 A;  5E89 A;  2VM9 A;  3DPR C;  5FP9 A;  3LOB A;  1AZD A;  2WNU C;  3KQR A;  2XOM A;  3MFC A;  2WN3 A;  4FCA A;  1OUW A;  5I8S A;  2H6B A;  1EAH 2;  4JTN A;  3N9P A;  5ANQ A;  2ERF A;  4RYD A;  1PMJ X;  4R9C A;  3GGL A;  1W0N A;  3BCW A;  4BIO A;  5AFE A;  5HI0 A;  1C3N A;  4S2G A;  3O1R A;  4RL7 A;  2A6W A;  4FPG A;  1O3T A;  4XFH A;  5JVV A;  5KXE A;  4RN5 A;  4N9H A;  1GOF A;  1AYN 2;  5DUU A;  3DYO A;  4QPG C;  4BDV B;  1UOF A;  1TME 3;  3T2Q A;  4LHS A;  4XF9 A;  4JDN A;  4XBN A;  1DQ6 A;  1W6O B;  3LKJ A;  4AEM A;  1BJQ A;  3INA A;  2DCZ A;  2WNO A;  3KGZ A;  2W0X A;  5F9T A;  3R52 A;  1N3P A;  4AF9 A;  4QPG A;  1U12 A;  4PLN A;  3PIJ A;  3BTZ A;  1DZR A;  3LB9 A;  4XEZ A;  1W9S A;  1RMU 2;  2CDP A;  1BBT 2;  1K5M B;  3GF6 A;  1RUG 1;  1BKZ A;  2LM3 A;  3AKQ A;  3N7M A;  4SLI A;  1AR8 3;  4HET A;  1RUD 2;  4YRD A;  3OUI A;  1H9P A;  2H0V A;  1XQN A;  2C5D A;  2PQS A;  4HXC A;  4CDQ B;  2B9U A;  5DAQ A;  1GU3 A;  3FJS A;  1C5I A;  4L99 A;  1GZW A;  2B5H A;  2C9K A;  4LKD A;  2DFB A;  2RS1 2;  2R04 2;  5LX2 A;  2BER A;  4YGD A;  5FAX A;  1KGY A;  3VD9 A;  5IK7 A;  4DX0 A;  1HB4 A;  4DEQ A;  3I8T A;  1UZ0 A;  4NHK A;  1W2A X;  5LAS A;  2BU9 A;  2WFP A;  2Q8O A;  1DQ4 A;  3OCP A;  5JUV A;  4Q26 A;  3VY7 A;  5F39 A;  1GOH A;  3E97 A;  3EJK A;  1LNS A;  1QH6 A;  2WC2 A;  4HG6 B;  1KFU L;  4F7Z A;  4YAR A;  5HV4 A;  4KG8 A;  1W8U A;  2WO1 A;  4FPH A;  2DVB A;  3TEW A;  1WA6 X;  1YZ5 A;  3ST7 A;  2QZ3 A;  4KWJ A;  2HWF 3;  1F4A A;  1ND2 A;  3AYA A;  2WZE A;  3WNM A;  4DNY A;  1C3H A;  3H8R A;  2F17 A;  2OII A;  4L11 A;  3POF A;  5FRE A;  5FUN A;  1SDD B;  4N53 C;  4YVW A;  5IFP A;  2OT7 A;  3WNP A;  1GP6 A;  4QQP A;  1ZBA 1;  2ZGL A;  4NHL A;  1A4O A;  4D7Y A;  1MR5 A;  5KHI A;  4DEV A;  4XFI A;  3RZJ A;  5C9A A;  1J3R A;  3CJX A;  2RS1 1;  3ZM8 A;  4J6G A;  4C1X A;  1S0B A;  2GMP A;  1O8P A;  1K3I A;  2VD7 A;  2HWF 1;  5FYZ A;  4EN8 B;  1CZV A;  2ADD A;  2D3S A;  3QCW A;  4CEY B;  3I3B A;  5GZE A;  4XIO A;  1OXC A;  3KD4 A;  2GC1 A;  2XJV A;  3SIT A;  1FXZ A;  3WT3 A;  1NX9 A;  4PQQ A;  1LGN A;  2QQU A;  4XIL A;  2D40 A;  2QQW A;  4NAO A;  3POI A;  4QX5 A;  3RZH A;  1JOJ A;  3ILR A;  3J9S A;  1PK6 A;  4AKB A;  3JXS A;  3VB9 A;  2IUW A;  4CUC A;  5A6Z A;  1FNZ A;  4NIG A;  1EV1 1;  5FY5 A;  2WWU A;  5IJR A;  3MDP A;  4CCK A;  2EXI A;  5LWB A;  2K9Z A;  3KHC A;  3VHP A;  3GZT B;  3MBW A;  4QQL A;  1QOO A;  3P8S A;  4IE0 A;  4R9A A;  4HKC A;  5JZG A;  4GX7 A;  4O7X A;  5H9P A;  4F7R A;  3VZE A;  1BBT 3;  3C3V A;  2QQK A;  3AXE A;  1TMF 2;  3U37 A;  3WNN A;  3N35 A;  2E9Q A;  2JB8 A;  1U5Z A;  2IXK A;  1YXW A;  1TME 1;  1AYN 3;  3WZ1 A;  4EN9 B;  1NOV A;  1VB2 A;  4IHL A;  1JN2 P;  3EFZ A;  3A21 A;  5DXD A;  4EWA A;  3ZYJ B;  5T50 A;  4R6O A;  5FRA A;  1DGR N;  3IAQ A;  4GNT A;  2ZS6 B;  1URX A;  5K4L A;  4B7E A;  3I59 B;  5FZI A;  5FMO L;  1MS0 A;  4WVM A;  3GCW A;  4DUX A;  4R6P A;  2FMD A;  4HZF A;  4XET A;  3SKJ E;  4A7K A;  3S57 A;  2JEM A;  1S0J A;  2QJV A;  5KR7 A;  4FTS A;  5ACA 1;  4X6Q B;  1SFY A;  1IZ3 A;  2X53 S;  2FDI A;  5FYB A;  4HSL A;  3WP4 A;  5FY7 A;  2GMM A;  1AVB A;  4GJZ A;  4R8H A;  3JUU A;  3VZJ A;  1GV9 A;  3BN6 A;  5FY4 A;  2FMY A;  5IK5 A;  2XHN A;  4Y1Z A;  1JYC A;  1XND A;  4FPE A;  4XFA A;  5J51 A;  3POE A;  1RIN A;  4K6B A;  5FBZ A;  1KJL A;  3U75 A;  5B2G B;  2QQN A;  4ORF A;  1XE8 A;  4AL9 A;  1OQ1 A;  3A4U A;  2J42 A;  4XIK A;  2JG9 A;  4DHM A;  3M4F A;  1CIY A;  4P02 B;  1NA1 B;  4XF4 A;  2DBN A;  4HVQ A;  1JAC A;  3VLB B;  5D3F A;  5BNP C;  2BFU L;  3AP4 A;  5A6X A;  1ZZ8 A;  3ACF A;  5JOZ A;  2H6C A;  5F3G A;  1NCR A;  2YMZ A;  3PDQ A;  3UGG A;  3DF0 A;  5FV3 A;  5JIA A;  3ATG A;  4XQD A;  2ZCW A;  1YFU A;  3VKN A;  4EN0 A;  5EJZ B;  4CCD A;  3TB0 A;  2UUR A;  2WA3 A;  3O12 A;  2YV8 A;  3OD0 A;  3POG A;  4BOW A;  2XGX A;  5ACA 2;  3LD8 A;  4RR3 A;  1LHV A;  1MZ6 A;  1IG3 A;  4FQ4 A;  4P08 A;  4E4S A;  4UFJ A;  4DHT A;  1B35 A;  1NT0 A;  2ZJC A;  4YWA A;  3UV9 A;  3AQG A;  1AYN 1;  5LEK A;  4XF3 A;  5F3I A;  1J4T A;  2ZX0 A;  2R49 A;  3E5U A;  3B3Q E;  1QIQ A;  4CCM A;  1B35 C;  3RWN A;  4LTA A;  3WG3 A;  2C1N A;  1JUH A;  3WSO A;  2VNR A;  4DMI A;  4XHB A;  1XXQ A;  1ZYB A;  1G86 A;  4M3C F;  3SHR A;  1OLM A;  5D1I A;  2YPJ A;  1JH5 A;  4LO4 B;  3H8O A;  4TLG A;  4MGT A;  1Y43 B;  1W6Q A;  1UGY C;  3URF A;  3T08 A;  4MGZ E;  2K46 A;  1G6N A;  3IDB B;  2VNV A;  2HYR A;  4DHN A;  3DYP A;  4P14 A;  4Y5S A;  3PU8 A;  2VQT A;  5IVV A;  1UX7 A;  2ZMK A;  3B93 A;  5FWJ A;  1LOG A;  4WOG A;  3HNB M;  2DVA A;  4XQW A;  3MLJ A;  2VZR A;  5A7W B;  2FCV A;  1B35 B;  1GZC A;  1QY4 A;  1CVN A;  1O4Z A;  1XYN A;  1TMF 3;  1GMM A;  3MID A;  3NV2 A;  4E4Z A;  1G9D A;  1RUC 2;  3ZYI B;  4CDX B;  3CQO A;  1OQD A;  2EAA A;  4QB6 A;  4PLO A;  2WWS A;  5IWF A;  4BXS V;  5A32 A;  3CHX A;  1X7N A;  2XVK A;  2VBB A;  4Q0V A;  4Y4Y A;  2D98 A;  3K4D A;  3UT0 A;  2Y6J A;  1J59 A;  3Q8A A;  2JG8 C;  5C3O A;  4TWT A;  3CU8 A;  1IPJ A;  4JRL A;  2VQ0 A;  5JMC A;  1W04 A;  2MPF A;  4JGZ C;  4KMQ A;  1QNW A;  3X0U A;  2O8Q A;  3VGI A;  1UZZ A;  2CU5 A;  2C63 A;  2QQJ A;  2RS5 2;  3BOW A;  3IDA A;  4QPI B;  3LDB A;  1OF4 A;  4Y33 A;  3W21 A;  4CP1 A;  5C8C A;  2E33 A;  3M3Q A;  4BB3 A;  1RUC 3;  3VD3 A;  1ZZ6 A;  4OHW A;  3WW3 A;  3NL1 A;  1ENR A;  2Y6L A;  4NO4 A;  5LHO A;  5KXC A;  2W1U A;  4BQ2 A;  4MET A;  5HV0 A;  3CEW A;  4UFM A;  2GAL A;  2XHK A;  1NUK A;  2PMW B;  4LNV A;  5C9A B;  1TEI A;  3VHO A;  3ZXA C;  2D5H A;  3I3Q A;  2EXJ A;  5A70 A;  2XL7 A;  2A3W A;  1TME 2;  3K51 A;  1GLH A;  2PAM A;  3PL0 A;  5CAZ A;  2ORZ A;  5IT6 A;  3ZVX A;  3TWI A;  2DUQ A;  5BN6 E;  1LUL A;  4Q4X 1;  4U36 A;  1WD3 A;  1VBB 3;  3ACI A;  3W59 A;  1JZ7 A;  1YCI A;  3OEA A;  2J22 A;  2W9X A;  1FV3 A;  1ZGR A;  1ZA4 A;  1D2Q A;  1SMV A;  2JDA A;  3R05 A;  1UGW C;  1UQX A;  3V65 A;  4COV A;  2RS5 3;  2UYB A;  5FYC A;  1KFX L;  1QOT A;  1W6N B;  3GZA A;  3N9O A;  5BY5 A;  4I0W B;  1AXY A;  5HPO A;  5FOJ B;  4FXK B;  5C70 A;  5L9V A;  2BMY A;  4Z8B A;  3NRU A;  5A3T A;  5E1R A;  5F32 A;  1NCQ B;  3OGG A;  4AI8 A;  2GN7 A;  5FXW A;  1O6U A;  1MS9 A;  3C8X A;  2XH6 A;  3SKV A;  4QHB A;  2JE7 A;  1VBE 1;  5DUV A;  3LFM A;  3SH5 A;  3MLL A;  1LOA A;  1OT5 A;  2VUD A;  5LY2 A;  4YFZ A;  2VZO A;  4AFM A;  4LUL A;  4B7K A;  1CAU A;  2WZ8 A;  3KT1 A;  4GMP 0;  4AVT A;  2QP2 A;  1UX6 A;  1S0I A;  2DVD A;  2JKB A;  2VU9 A;  1N1T A;  3KVA A;  1SEF A;  2VG9 A;  4QPY A;  2YGM A;  3PTY A;  1XRU A;  3VUO A;  3K75 B;  1V6K A;  5EYY A;  5FZ3 A;  1WLT A;  4ES8 A;  2W5F A;  3WIN E;  1UZY A;  1O3S A;  1Q8Q A;  1S55 A;  4WM8 B;  3PUA A;  3B69 A;  2BBV A;  3ACL A;  1SBD A;  1HB1 A;  3T0M A;  1XOY A;  1OFS A;  2DVF A;  2OA2 A;  2WLP A;  3VDD B;  3HT2 A;  1ND2 B;  5FZ4 A;  1UXX X;  1LCL A;  2VL4 A;  4LBN A;  2VR4 A;  4CDX C;  1FOD 2;  1MS3 A;  2Z79 A;  2XUM A;  4OHV A;  5A33 A;  4OQ8 A;  1RVF 2;  3OUJ A;  1WCS A;  2HWE 3;  1VMJ A;  3O7O A;  3ZXG A;  4M3C B;  5A3L A;  2VPV A;  1LHW A;  4XZU G;  1C8M 1;  5CIR A;  2VZ3 A;  1RGS A;  4EZ4 A;  4BWO A;  3D82 A;  4EWE A;  5DAW A;  4YG0 A;  5FYS A;  3BI3 A;  1DLC A;  3JD7 3;  1TZO A;  1GBG A;  1H8T B;  1D4M 1;  3O1V A;  4IEW A;  3AP7 A;  4GWI A;  4Q0Q A;  1PO2 1;  2XDV A;  4M4R A;  2PHD A;  3ZXD A;  2J1A A;  1OF3 A;  4BQX A;  4ET7 A;  2QDN A;  5C3S A;  3AX4 A;  2PQQ A;  4GQ7 A;  3B94 A;  5CG9 A;  1BEV 1;  2VOT A;  2TBV A;  4D69 A;  4WVV A;  1CAU B;  1RUG 2;  1DYO A;  4FPL A;  5FZM A;  1VMH A;  5HBA A;  5FXZ A;  1J83 A;  4FAH A;  2HWC 3;  2JE8 A;  2XQR A;  1YI7 A;  3DUI A;  5LRS A;  1YQ2 A;  4XJW A;  3FN9 A;  2HWE 2;  1VB4 A;  2QQO A;  1GIC A;  5FPX A;  4BIS A;  5AC9 3;  3TEZ A;  2OQ7 A;  5T55 A;  3VBU B;  2A71 A;  3ON7 A;  4R9B A;  3SXW A;  1F2N A;  1PO2 3;  1Z78 A;  3EYP A;  4GH4 C;  2XPJ A;  4DRV A;  1XNB A;  2OXB A;  3IM0 A;  2WFF 1;  4Q4V 3;  5F8P A;  2B8M A;  4ISR A;  4AFD A;  1WCD J;  2FCT A;  3IWZ A;  2HJI A;  2RVA A;  2E32 A;  1H1I A;  3UKT A;  2WIN B;  3NAP A;  1OHF A;  1QKQ A;  1PMH X;  4JTO A;  3SH3 A;  4D6Q A;  2XG3 A;  4N7I A;  1KU8 A;  4AEK A;  2PHU A;  4KWL A;  3UET A;  3D4K A;  4LBO A;  5HF3 A;  2WDB A;  2WLQ A;  5A3M A;  4B1M A;  3MIG A;  2D6M A;  1TNR A;  3LA7 A;  3RJR A;  4DXT A;  2KA3 A;  1E5I A;  3BYW A;  1BXH A;  1W2O A;  3GNE A;  4QXH A;  1ASJ 3;  4S2D A;  2V09 A;  1KIT A;  2VCM A;  4GKY A;  1QQP 3;  3WP6 A;  5LW9 A;  2ATF A;  3VBS C;  1UMZ A;  3OTF A;  1APN A;  1BK1 A;  1GFF 2;  4Q4Y 3;  4RS5 A;  3VBU C;  2JIJ A;  1UOG A;  2ETE A;  3APB A;  3JB8 A;  2RR1 3;  3MI8 A;  1CES A;  3NNF A;  4JDO A;  2BVB A;  2VZ1 A;  4MLO A;  4Q4V 1;  5CFD B;  1NCQ A;  4IE4 A;  3WW4 A;  3P1R A;  4IGO A;  2HWF 2;  4ASL A;  3AZX A;  5FPU A;  3K46 A;  5DUX A;  4LOR A;  2PHF A;  3FLT A;  4YZ5 A;  2AEN A;  1W6N A;  4JQR A;  3RMY A;  4N43 B;  4QKD A;  3I3M A;  2VGD A;  3UYJ A;  2C26 A;  1OOP C;  2R30 A;  4CCJ A;  2VZV A;  4XC9 A;  1WS4 C;  2NZ9 A;  4FL5 A;  3BIW E;  3M70 A;  1A38 A;  1YQC A;  2BTV C;  3VL8 A;  4XTM A;  1JOB A;  1HRV 3;  4PI0 A;  1KS4 A;  4Y4R A;  2R0F A;  3O1T A;  3LWC A;  1KS5 A;  3IBM A;  4JHZ A;  5FKB A;  2TNF A;  4KG0 A;  4XPV A;  4EQV A;  2BUK A;  3AM2 A;  4YM0 A;  1QU0 A;  3AKR A;  3J8F 1;  3IDC B;  2JEC A;  2BP6 A;  2VVE A;  5A32 B;  3BTA A;  3M3C A;  3WF1 A;  4YZ2 A;  1AR8 2;  1UMI A;  4D7S A;  1NY7 1;  3TEX A;  1VBB 1;  4WBB A;  2IXI A;  1VE0 A;  1OLR A;  1W8N A;  4IEP A;  4DUW A;  2RDS A;  2X05 A;  1XE0 A;  5LA1 A;  1VBO A;  3UGF A;  4JGZ A;  1MS5 A;  4PLM A;  3W20 A;  2R1B A;  3RI8 A;  2UWB A;  1POV 3;  3FX3 A;  1ACC A;  3R6S A;  3WG4 A;  4E8D A;  1OOP B;  3VBO A;  3OF1 A;  2F4L A;  4QLI A;  2Y38 A;  3W5N A;  4Q4Y 2;  2UY8 A;  2X10 A;  3WP5 A;  2HWD 1;  5DZG A;  3D0S A;  4JV4 A;  3LW1 A;  5A7O A;  5IW0 A;  3U78 A;  1ULO A;  1W28 A;  2PYT A;  2P3J A;  4XYX A;  5FYI A;  5F6L B;  2RHP A;  1W03 A;  4IEY A;  1V6O A;  1WLD A;  4LLF A;  5GKA C;  2E7A A;  4BH9 A;  5HCA A;  4PF1 A;  5K0U B;  5EIY B;  2R32 A;  1US2 A;  1RUE 1;  1LOB A;  3ZIW A;  2WNV B;  3KF3 A;  5JPN B;  3CU7 A;  1VBE 3;  4JX0 A;  3HNY M;  5CB7 A;  1ODM A;  1YYN A;  2TUN A;  4M0N A;  1F8V A;  2ZGO A;  1AR7 2;  4MGY E;  3G6J B;  2HLE A;  4HN1 A;  4HSJ A;  4LBL A;  4IE7 A;  4LOS A;  4AED A;  1H30 A;  2AZ5 A;  3H0O A;  4J6S A;  1IS3 A;  1X9P A;  4LE4 A;  1UYZ A;  2DBI A;  4UBH A;  5KC5 A;  2CL2 A;  2XQX A;  2XUE A;  4XTP A;  4UF0 B;  1VAL A;  3IDE A;  3ZSE A;  1S0D A;  4DQA A;  2UYA A;  3MV0 1;  4GWJ A;  4MZU A;  3EQE A;  4OI1 A;  4D94 A;  5J36 A;  3KGL A;  4DIQ A;  4R6Q A;  1XE7 A;  3OPZ A;  3GDB A;  4P5Y A;  5A3N A;  1VRB A;  4HKO A;  5FCC A;  3P3N A;  4B4R A;  1HQW A;  3IPV A;  1GYK A;  2DYC A;  2VUA A;  4WVW A;  5JXI A;  3O1O A;  4PIT A;  3MPP G;  2RS3 3;  5J37 A;  2HWC 1;  4HPK A;  1Y7B A;  3E1F 1;  5LA9 A;  3M3E A;  3RZK A;  1GKB A;  1X1V A;  4M0H A;  1RYY A;  1HRV 2;  3K2O A;  3HPN A;  3M2M A;  1ENS A;  2JXA A;  4LKF A;  2H0B A;  3ROU A;  3MIC A;  5DAP A;  4CCN A;  1MZ5 A;  2D3R A;  4BIF A;  1ZGS A;  1LKN A;  4NII A;  3I2K A;  4IV3 B;  1VBC 2;  1K12 A;  2R6Q A;  3TEY A;  4L92 A;  3IZO A;  5HCB A;  5FPV A;  1Q8P A;  3IIA A;  4HKL A;  3RDH A;  3S5Q A;  5FZ7 A;  5C3R A;  4RGK A;  4ZZ8 A;  1RUI 2;  3WD5 A;  3FMG A;  1E5H A;  1JW6 A;  1UGW A;  4IEO A;  4RR3 C;  2E63 A;  1QHD A;  5I0S A;  2J1U A;  4GA9 A;  5JR2 A;  1IG0 A;  1UYX A;  4GMP 1;  4S2F A;  1RUH 1;  1ULC A;  1S0E A;  2XR4 A;  3ILN A;  4XDO A;  4AI2 A;  4URA A;  4YGC A;  1L7L A;  3VBO C;  3B9C A;  3OGJ A;  1FAT A;  1O9F A;  1PIV 3;  2YBS A;  1H2L A;  3M51 A;  2C0Z A;  3ZMN A;  1VBC 3;  4FTB A;  5KBF A;  4Q4W 2;  2EVX A;  5FZ8 A;  1SLA A;  5FDB A;  4CU9 A;  2W92 A;  3OGR A;  1QOS A;  2XWB B;  3R50 A;  1JOP A;  1A37 A;  1PNF A;  1XBF A;  2GNB A;  2Y26 A;  3AJY A;  3IN9 A;  2WO7 A;  3M3O A;  4PIY A;  4OUS A;  1R64 A;  4UT5 A;  5T54 A;  1LAJ A;  4RSU A;  3FUQ A;  3JCI A;  3T2T A;  1PGW 2;  3MIH A;  5K9Y A;  1I5Z A;  4JDD A;  2B4K A;  4QDS A;  1QJY 1;  1ZVF A;  2G9F A;  1OUS A;  4FFH A;  4JGY C;  4X8N A;  1U5Y A;  1OD5 A;  5E6H A;  5FWE A;  4CVU A;  4NID A;  4XFC A;  1R1A 2;  2OKX A;  2A6Y A;  3HEI A;  2A3X A;  4XHX A;  3BOD A;  2Y60 A;  3ZSK A;  4AI3 A;  1LHO A;  1R1Z A;  1TE1 B;  4N8M A;  1MEC 3;  4BQW A;  1LR5 A;  1SLL A;  1OFN A;  1SFN A;  5FP4 A;  4ATF A;  3NKT A;  3U9X A;  4IUG A;  3WR0 A;  4C91 A;  2I2S A;  5C8C B;  1ZRF A;  1Y4W A;  1EV1 2;  2RMU 2;  3JU9 A;  3Q8E A;  4RHV 3;  4TYS A;  4FVV A;  4AFA A;  1ZRE A;  2O1Q A;  1XXR A;  2JDU A;  2Y6F A;  3AMN A;  1DQ5 A;  1OI6 A;  1QWR A;  4HOO A;  4WV8 A;  3O1P A;  2BBA A;  4Q1R A;  4RS5 B;  4Y26 A;  1ZZB A;  2XBO 2;  1SHW B;  3ACG A;  3VBS A;  1WBF A;  2EIG A;  4PI2 A;  4JQT A;  4ATE A;  3EHK A;  5LZ6 A;  1EUU A;  5CKM A;  5J09 A;  2J1T A;  3OBT A;  3ZXE A;  4Z2W A;  3H8X A;  2JIC A;  2RDR A;  1Q3E A;  1W8H A;  4H3W A;  3OG2 A;  4WZF A;  1D4V B;  3MLK A;  1R09 2;  4IND A;  4MXV A;  4XCA A;  4Y20 B;  3GAL A;  5FY8 A;  1NA1 C;  4ES9 A;  2L9L A;  3USU B;  3WHT A;  4ERO A;  1V9U 2;  1QJE A;  1RUJ 3;  5G05 L;  5A6Q A;  1PZ9 A;  1XSQ A;  1SBE A;  3ABZ A;  1OVP A;  1W05 A;  3NAP B;  2VNO A;  3SEE A;  4CTE A;  1BHG A;  3ALQ A;  5CKN A;  3CBN A;  3J8F 2;  4XJ9 A;  1UNB A;  3CLP A;  4HPK B;  4NIH A;  4QMA A;  2WS9 1;  3P1N A;  5L7O C;  1OA2 A;  2WYF A;  5CEH A;  2J1E A;  3FBM A;  2VZT A;  3VZL A;  3WG2 A;  3OPT A;  4COW A;  3LOI A;  4QKN A;  4WRQ A;  1AL2 1;  1K5M A;  5EXG A;  2PN5 A;  4OCT A;  4XOG A;  4EN6 B;  2ADE A;  3MPB A;  3OBR A;  3AXD A;  3HQR A;  3FLR A;  2CYF A;  3ZYR A;  2WKK A;  2WN2 A;  5LBF A;  3UBW A;  3VBR A;  5BNP B;  1HB3 A;  1OLM E;  3D6E A;  3PUS A;  4NHY A;  4AGV A;  3LQC A;  4Y20 A;  5J7M A;  4QDQ A;  4FPY A;  5JSP A;  3WNK A;  4B8E A;  2HYK A;  1S2X A;  4LKS A;  3AKS A;  1RUH 3;  5HCF A;  1SLI A;  3Q8F A;  3O1M A;  3HIF A;  1AF9 A;  1W2T A;  1XNK A;  5FZL A;  1LES A;  3LF7 A;  1FX5 A;  2IXH A;  4B1L A;  1DGW A;  3BKZ A;  3KCX A;  2RV9 A;  3Q8B A;  4LKE A;  1BBT 1;  3RPQ A;  1LJ7 A;  2A6V A;  3ZR6 A;  5FYT A;  3WVJ A;  4PIZ A;  1O5U A;  2JG9 C;  5JOY A;  1U0A A;  2LUW A;  3OJB A;  3ZFE C;  5I8T A;  3PJY A;  3I54 A;  1HXS 1;  2QQI A;  3AP9 A;  3WDU A;  3IB3 A;  1DLL A;  2ILM A;  3LSE A;  1FMD 1;  1H2K A;  4H7M A;  1RB8 G;  1ZX5 A;  2LRP A;  3HT1 A;  4MXW B;  2OS2 A;  2BV4 A;  2GC3 A;  3CJI C;  4O9E A;  1MS8 A;  5BPX A;  1NA1 A;  2J7M A;  5FYH A;  4ZU5 A;  4Z2A A;  4Q27 A;  2E7Q A;  3WV6 A;  5F3E A;  1OLQ A;  1OKO A;  1WME A;  3NO8 A;  2PFW A;  3MF9 A;  1M06 G;  3RGB A;  4BQ5 A;  3H7J A;  3O1U A;  1OA4 A;  5D8A B;  1DGR A;  2SLI A;  2YXS A;  4BXF A;  5C71 A;  1ULF A;  1CD3 G;  3CQC A;  1D0H A;  1HW5 A;  4FPO B;  1LHU A;  2QE3 A;  1SG3 A;  1OMI A;  2VXR A;  5K0U C;  3NWK A;  4CUB A;  3HN1 A;  4HVO A;  4TZD A;  3WCS A;  4YNI A;  2ZGP A;  2CWM A;  4K3U A;  5JXH A;  1POV 0;  2IZW A;  1LOD A;  1QJX 3;  2RJK A;  5CFC C;  2YU1 A;  3EMR A;  2ZAA A;  1EAH 3;  1FAY A;  2VNG A;  3H3L A;  5FZO B;  4G4F A;  2XLA A;  4FR3 A;  2VMD A;  4XZP A;  5T3N A;  3NJX A;  1MEC 1;  1UU6 A;  5C4W A;  4CEW B;  1JOD A;  4ZKT B;  1L7Q A;  3KB5 A;  3CJI B;  5HCH A;  5AV7 A;  3S0M A;  4XAC A;  3MGU A;  2D6O X;  3T0A A;  2V4A A;  4YZ4 A;  2JX9 A;  2RS1 3;  2CV6 A;  4NWW A;  1QXJ A;  4MV2 A;  5ERL A;  1PNG A;  1J58 A;  4L8Q A;  3RVH A;  1IB1 A;  2O8O A;  2Y64 A;  3NNJ A;  4LBK A;  2A5Z A;  2ZEX A;  4DHO A;  3JB4 C;  4NRP A;  1PK6 C;  2O14 A;  2CHH A;  5FZK A;  3WUC A;  5JAX A;  1GP5 A;  4KGQ A;  4OI2 A;  3LEM A;  5FO8 B;  4P9L A;  3TN9 1;  4XJU A;  1FOD 1;  1UU4 A;  4QB1 A;  2ET1 A;  4A6O A;  5A7N A;  1RHI 3;  1I1E A;  3CJI A;  2VTX A;  4IEV A;  3RI9 A;  3TRS B;  1D2S A;  4Q8K A;  5J4X A;  4COZ A;  5F7U A;  5C6C A;  1AJK A;  2QKD A;  3TYJ A;  2YB7 A;  3LEI A;  3WQ0 A;  2QZ2 A;  3BVC A;  5KHK A;  1CAX B;  4IV3 A;  4F3J A;  4CDU C;  4IV1 B;  4R6N A;  2HH9 A;  4OFG A;  4BMB A;  2OVU A;  1XB9 A;  4GWM A;  1QGL A;  2JD4 A;  1GUI A;  5EJ3 A;  5C3Q A;  3LL1 A;  3ZLI A;  4GD4 A;  4W6Y A;  1O91 A;  5LA0 A;  3BUC A;  5FK8 A;  3VBH C;  1Y9Q A;  1UPI A;  2PHX A;  1Q5O A;  2ZX1 A;  1COV 1;  5DN2 A;  3SQO A;  3MIB A;  3ZFF B;  4P9I A;  3D0J A;  5L36 A;  1WLW A;  3AVS A;  5IHR A;  4UW3 A;  1UU5 A;  3IPV B;  4M3C E;  5I0T A;  4L97 A;  1QJX 2;  3E6Y A;  4QWN A;  2MEV 2;  3HJR A;  3E5X A;  4LUM A;  4RD7 A;  5APA A;  4OI0 A;  4LIU A;  3DV8 A;  4FPF A;  4Z92 B;  1UXZ A;  1WS5 A;  4CSW A;  3U1X A;  3WP3 A;  1DFQ A;  1AR6 2;  2P3Y A;  5IVC A;  5L19 A;  4LR4 A;  4P9Y A;  4XFB A;  2KR2 A;  3NNL A;  5FPL A;  3JD7 1;  4QGN A;  1I9R A;  2Q4S A;  3DPR B;  1WMX A;  4X8P A;  2YPD A;  5LCW L;  1UN1 A;  5J96 B;  2WT0 A;  1R08 2;  1AR6 3;  1U5I A;  3J4U H;  3ZN6 B;  5I93 A;  5DDJ 2;  3VZK A;  3AP5 A;  3W5M A;  5J3U A;  4IDZ A;  1NKG A;  2NP0 A;  1IQA A;  4ZU4 A;  2A1X A;  4AVA A;  2VW1 A;  4XUN A;  3GBG A;  4HK8 A;  1NXM A;  1V6M A;  4CXW A;  1JYI A;  3KHB A;  4Q1P A;  2W1S A;  5FLJ A;  1BMV 1;  3ELN A;  4XFF A;  2A6X A;  2G19 A;  2WAA A;  1PM7 A;  1JHJ A;  1YWK A;  1CON A;  3WDY A;  3V64 A;  1F4H A;  2VJX A;  3F2Z A;  5CU1 A;  3ZFG C;  1QDO A;  3KSC A;  5BTV A;  1NCR B;  1UYP A;  1EPZ A;  4BCU A;  5A33 B;  5F1R A;  3T0D A;  4GH4 B;  2ZA9 A;  3MUZ 1;  4ZS2 A;  1QJB A;  5T5J A;  2BZD A;  2KM2 A;  1PO1 1;  5JOX A;  4OVE A;  2XJR A;  3T2P A;  1DG6 A;  4QGL A;  1HKD A;  3LEK A;  2Y6H A;  1MZF A;  1H8V A;  1VBA 3;  3LPG A;  4MHU A;  3ZFF A;  1J1L A;  4FQZ A;  4AG4 A;  1MS1 A;  4Y3O A;  1OC1 A;  3LCP A;  2GP3 A;  1DZT A;  3DEC A;  3RYK A;  2E7T A;  1ODN A;  3ORJ A;  2OUJ A;  5G04 L;  2CGP A;  1I6X A;  3A7Q A;  5E16 A;  3QD6 A;  3EB7 A;  2VME A;  3LIG A;  4TN7 A;  5IK4 A;  1VBP A;  3FZ3 A;  2NMO A;  1NG0 A;  5E88 A;  4K20 A;  2V7D A;  1LED A;  2DUP A;  2W95 A;  4TSV A;  3VBS B;  3AJZ A;  2P4E A;  3J8F 3;  1NCR C;  4JAA A;  3TAY A;  4CDW A;  1XYP A;  2DFC A;  2WSU A;  4HLT A;  2ZAH A;  1SAC A;  1UW8 A;  2R04 3;  3GCX A;  3C7E A;  5FZH A;  2RE9 A;  5CG8 A;  3ZYF A;  4DPN A;  1JYT A;  1QNY A;  3PUI A;  4AVB A;  5D2A A;  1X9T A;  3H1W A;  4QU1 A;  2E6V A;  3NST A;  3KM5 A;  2BDR A;  4DO0 A;  4B29 A;  1M4W A;  3I2O A;  2Q30 A;  3RS6 A;  3PVO A;  1V00 A;  3THP A;  1DQ0 A;  3RMX A;  5LU1 A;  4LE3 A;  5KXB A;  1YRZ A;  3VBF C;  2C1J A;  5F6K A;  3T2O A;  1VJ2 A;  4DZG A;  2XJU A;  4QD2 A;  5FYU A;  3ZYB A;  1YO8 A;  4AAP A;  2BN0 A;  5EZW A;  3VKO A;  1GZ9 A;  5FY1 A;  4CEW A;  5C4W B;  1C4R A;  5FLH A;  1G8W A;  1OD3 A;  2BR9 A;  4MAD A;  4A6S A;  3GBW A;  1ULP A;  1DYK A;  4LBM A;  5IK8 A;  3GZU C;  1UL9 A;  2VBD A;  1OH4 A;  2GSY A;  4GAL A;  2ZML A;  3TOJ A;  4Q0U A;  5J1X A;  1NYW A;  1NE6 A;  2K2S A;  5BYN A;  4R4X A;  2RJ2 A;  2VVF A;  3VDC A;  4I0A A;  4LBQ D;  3H9A A;  5D8A A;  4GKX A;  4MGS A;  1H6Y A;  2D6N A;  3KV4 A;  4QPI A;  5CAD A;  2NMN A;  4U2A A;  2VOW A;  1GP4 A;  3OGS A;  1WCU A;  1VRH 2;  1OPO A;  3OUH A;  2Z5W A;  4MO3 M;  5L9R A;  2QNK A;  2BMZ A;  4DAU A;  5FZ6 A;  4HL0 A;  1QJZ A;  4NRQ A;  1RUJ 2;  1Q8V A;  5FJK A;  4CDW B;  5LB6 A;  4RHV 2;  4GUL A;  2BOJ A;  3SCF A;  1KEX A;  1RUD 3;  1UCX A;  3I2J A;  4JKM A;  5FYY A;  3H3Z A;  1PIV 2;  3HN3 A;  3MW4 A;  4OYU A;  4UF0 A;  4QX1 A;  2QVS B;  4CDX A;  1AR9 1;  2W1W A;  1A34 A;  1NAE A;  1JYV A;  1KD7 A;  1CWP A;  1N3O A;  3Q9O A;  1GWK A;  5J50 A;  3E6D A;  5F5C A;  2NPI A;  1JU3 A;  1H8T A;  3ZN4 A;  4AR2 A;  5JIU A;  3K4Z A;  1WW6 A;  2Q8D A;  1RUN A;  1W8Z A;  1YFW A;  2WR9 A;  3DXU A;  4ASM B;  4ZU7 A;  3LAG A;  4DHP A;  1LEN A;  2R07 3;  2Y34 A;  3W58 A;  1JI6 A;  4AEJ A;  2YYO A;  1QQP 2;  2WSV A;  3N7K A;  3MIE A;  1KRI A;  1CPM A;  5FOB B;  4XDQ A;  5SV5 A;  4Q4X 3;  2W08 A;  1N47 A;  3S30 A;  1QJU 3;  2ZX4 A;  4D6R A;  3PLQ A;  3VL9 A;  1MEC 2;  5F5I A;  4YW2 A;  4Q4W 3;  4QDR A;  4WM7 A;  5LK7 B;  4XBQ A;  5IVE A;  2YC0 A;  3BB6 A;  5JR7 B;  1JZ3 A;  1QMJ A;  1PZ7 A;  5FUI A;  3A23 A;  1OH3 A;  3RZG A;  1DBN A;  1HRI 2;  4RFT 0;  3AC0 A;  3USU A;  2R06 2;  1AYM 3;  3ZFG B;  4KWU A;  4MG2 A;  3EO6 A;  1ZA7 A;  5FQ0 A;  4YZ3 A;  1GZW B;  2RR1 2;  1GNH A;  4XBL A;  5C5U A;  4DS0 A;  5AC9 2;  1WWY A;  4K1Z A;  5I0U A;  2VZS A;  3DPR A;  1SLT A;  1VBA 1;  3GHN A;  2W1Q A;  4YM3 A;  2J1R A;  3IKW A;  1PVC 1;  3X29 B;  1JMU B;  1GNZ A;  1VBD 1;  4XAA A;  4Y5T A;  4LOT A;  1YIF A;  5JMO A;  4CCE A;  4QHZ A;  2WFF 2;  3PVN A;  4I0B A;  4MH0 E;  4N7Y A;  2YGL A;  3BU0 A;  4LBJ A;  1UH0 A;  2NUO A;  4IER A;  4QXB A;  4XXA A;  2DV9 A;  3H50 A;  2QBX A;  5LBB A;  4CXX A;  3JBG 2;  3U11 A;  5A7Q A;  5C8W A;  2NYY A;  2DVG A;  1ENQ A;  1C3M A;  1W06 A;  3OGV A;  2OZ6 A;  1N1S A;  1ZBA 2;  4QU2 A;  4MYE A;  2GN3 A;  2RS3 2;  3ZR5 A;  4JHT A;  2B05 A;  4AWD A;  5LU2 A;  3I2G A;  2VUJ A;  1K42 A;  1YUD A;  3EBR A;  3OSD A;  4LA2 A;  5KXD A;  3WOB A;  1GZT A;  2B39 A;  5FZ0 A;  3ZMO A;  2C6S A;  2D43 A;  3AFK A;  4Y1X A;  2JEN A;  2EXH A;  2Q0A A;  1KJR A;  2QQV A;  3A22 A;  3HNM A;  1PGL 1;  4N84 A;  4LMF A;  3NNM A;  1XEZ A;  2W68 A;  5A6Y A;  4SBV A;  5B4X A;  5DDJ 1;  2VZP A;  3GZE A;  1WUV A;  2CWS A;  1GQH A;  2DDU A;  2P3K A;  4CYD A;  1R08 1;  4N90 A;  4Y22 B;  4A44 A;  2R04 1;  4AVV A;  2Z2S B;  2ARB A;  3E5Q A;  4PIF A;  4R52 A;  3P1S A;  2GC2 A;  2RJL A;  3I2I A;  4BLJ A;  3AP6 A;  4ZDR A;  1OKQ A;  2ZGT A;  3VDA A;  2D6L X;  3MIF A;  3SPR A;  1MS4 A;  1YQ8 A;  4N43 A;  5JSR A;  2HBT A;  2RS3 1;  4XQ4 A;  3U07 A;  1HJG A;  1OQE A;  1GWL A;  1YI9 A;  2NU5 A;  2NLR A;  4LK7 A;  3WW2 A;  5FP8 A;  5A1L A;  1FMD 3;  3OOX A;  4BA6 A;  2EIE A;  4QQH A;  3MIU A;  2D7F A;  2WZR 2;  4L9B A;  2YY1 A;  2VOK A;  1IKP A;  4XVH A;  1COV 2;  3NJV A;  3TN9 3;  3ZX7 A;  4KH9 A;  2DUO A;  1IPK A;  4EZH A;  5DMY A;  2BPA 2;  1O3Q A;  4Q0P A;  3ZSL A;  2AEZ A;  4Z82 A;  1UGX A;  1VBD 2;  1WA4 A;  3BAL A;  1PO1 3;  2FDK A;  3OYW A;  3P1P A;  3POJ A;  4EE2 A;  1FPN 2;  3OPW A;  3ZFG A;  3T3Y A;  4JGY B;  3VD4 A;  2IWG B;  4Y22 A;  5DAX A;  2BNO A;  4I02 A;  1EUT A;  3FE5 A;  3VKL A;  3ZXL A;  2Y6G A;  2JG8 A;  4IL7 A;  2P1B A;  2VH9 A;  2VEC A;  2HEV F;  3ACH A;  2Z69 A;  4QXK A;  1EAH 1;  4WM8 C;  3VBR B;  4H14 A;  1FPN 3;  4CCC A;  2R0H A;  5BXX A;  1DGW X;  4M3C A;  1XNA A;  4KL1 A;  1URJ A;  1R09 3;  1D7P M;  4MXW A;  4OZX A;  1C28 A;  2FDJ A;  4Y1V A;  3APA A;  2DWR A;  3IMN A;  4I01 A;  4IEQ A;  4QT6 A;  2PLV 3;  3S7I A;  4LQR A;  4YG3 A;  3AYE A;  4AVC A;  1UZW A;  1QJY 2;  1VPH A;  2EA7 A;  2ZEZ A;  1CAV A;  3I97 A;  5FJH A;  1J1T A;  4I3P A;  1DIW A;  1W9W A;  4AVS A;  2UY9 A;  2BYV E;  3GJB A;  3WX5 A;  5JXG A;  2DCK A;  3DYM A;  4NPR A;  4YVS B;  1RIR A;  4CPB A;  2AUY A;  3WQ7 A;  3MIV A;  2C74 A;  5H9R A;  1JZ6 A;  4A45 A;  4AI1 A;  2VCC A;  3QBQ A;  1NQJ A;  4RR3 B;  4YM2 A;  1T2X A;  3I4I A;  1MPX A;  1SQ4 A;  1V9U 1;  1JTZ X;  1NLR A;  4HAN A;  2FD8 A;  1BYH A;  3AMM A;  4FSJ A;  2I07 B;  2R07 1;  4DHS A;  1UKR A;  3PVB B;  4XJZ A;  4AZZ A;  2B45 X;  3RZL A;  3AXY C;  1IS5 A;  1G9C A;  4NRO A;  4S2H A;  1WCQ A;  3B00 A;  3J7L A;  2CSG A;  3N7L A;  3OBZ A;  4CZS A;  5HXV A;  4NWV A;  4DXR A;  2Y0I A;  3HOB A;  5DG2 A;  4FI9 A;  5GAL A;  3ZDS A;  4AAX A;  4D3W A;  5I91 A;  1HRI 3;  3FFZ A;  1FYU A;  1RED A;  2ZMN A;  3C7F A;  4LO6 B;  4W8J A;  2G1M A;  4OUM A;  1F9K A;  4N7G A;  3UKV A;  4BQ4 A;  2AGS A;  3NKG A;  5FBJ A;  1CR7 A;  2W91 A;  3O1S A;  4O46 A;  3WNL A;  3ZFE B;  4BYY A;  1W8W A;  1HXS 2;  2DCY A;  2PAK A;  1W99 A;  4D0Q A;  1FOD 3;  1ULE A;  3I3D A;  1WS5 C;  5EYX A;  2XJS A;  1YIP A;  1H8T C;  2A70 A;  2DUR A;  1H6X A;  5LBC A;  2CY6 A;  4ARX A;  2RR1 1;  4AE2 A;  1JYN A;  3I59 A;  2XB6 C;  4ZY9 A;  3S6P A;  3HBK A;  1OUR A;  2WJS A;  1A78 A;  2P6H A;  4CEW C;  4NMI A;  5FZB A;  1OBN A;  2GUD A;  2XLG A;  3KCC A;  1HN0 A;  5A7P A;  3PTR B;  2MHF A;  4LPL A;  4N53 A;  3VBF B;  2EAL A;  2G9Z A;  4LIV A;  2D6K A;  3DN7 A;  3NJZ A;  5DAV A;  1DGL A;  1SLC A;  2OUH A;  3P6B A;  3PUQ A;  4FBF A;  1CZT A;  3OB8 A;  4JKK A;  4KBB A;  4QM8 A;  1O8S A;  4JCK A;  5JZG B;  3HQX A;  5EQU A;  3III A;  5GLV A;  3AZV A;  1BLZ A;  1NQD A;  2ES3 A;  4N53 B;  2PHW A;  4NN0 A;  4ZHN A;  1MAC A;  2EXK A;  1F35 A;  5D8A C;  3V56 A;  2DTW A;  4ZS3 A;  1A3K A;  4QX2 A;  1B09 A;  2EID A;  2NN8 A;  3ITQ A;  4IQP A;  3WLU A;  3E6B A;  4CEY A;  4K1Y A;  3BPS A;  3NJY A;  4ZXK A;  3USS A;  3LL2 A;  2VTX J;  5EHD A;  3UK9 A;  4KU8 A;  2ET7 A;  5F3C A;  3RG0 A;  1AR9 2;  1DP0 A;  2BJS A;  1XNT A;  4XAE A;  4AGG A;  4IXL A;  2GNM A;  3T0L A;  2R16 A;  2GUX A;  1G9A A;  3UGH A;  2JKX A;  4RHV 1;  1SCR A;  2PHT A;  3BGA A;  2HWB 1;  2OPW A;  1GAN A;  1YC6 1;  3N36 A;  3PNA A;  2VO5 A;  1IS6 A;  1JUI A;  4PBO A;  1SCS A;  4LO5 B;  1MVE A;  5A80 A;  1TG7 A;  2FDG A;  1WMD A;  1G7Y A;  2ZTN A;  1G9F A;  4X6R B;  2VE1 A;  3ZXJ A;  1AX0 A;  4AQS A;  2ZAC A;  3AL5 A;  1S0C A;  1HRV 1;  1JBC A;  4UFI A;  4E4H A;  1VMF A;  1JZ4 A;  1UGY A;  4OMD A;  2Q5T A;  1V6N A;  3AYC A;  3ECQ A;  4AHZ A;  1ZRI A;  2CTV A;  3M50 A;  1RUF 3;  3SML A;  3VY6 A;  2WH0 A;  3HR9 A;  4FPJ A;  3T4H B;  3W9A A;  1QJY 3;  1VBD 3;  4IE6 A;  4MSV A;  1ZZ7 A;  2QQL A;  5TSW A;  4PIU A;  4QXC A;  3H7Y A;  1K5M C;  2HEY F;  2CGN A;  2GP5 A;  4LBQ B;  3SMM A;  4PQ9 A;  1PXD A;  4DRR A;  4QGM A;  3ME2 A;  4Q5O A;  2QFE A;  1YNA A;  3VBF A;  3ZYG A;  5ISL A;  4AHX A;  3P1I A;  1OA3 A;  4P9G A;  2GND A;  4LHK A;  3SMK A;  5DZF A;  3NAP C;  5JDB A;  1WBL A;  4LJH A;  1ST8 A;  4PDW C;  1HV0 A;  1BZW A;  4YGE A;  1RUE 3;  1VIW B;  4BE3 A;  2XVL A;  3VBH B;  1RJ7 A;  1POV 1;  1WW5 A;  4LHL A;  5FKC A;  1W9F A;  3N9Q A;  4Q4W 1;  1H9W A;  2Y0O A;  1Y3T A;  4D6S A;  4E2Q A;  1JZ8 A;  1HV1 A;  5CZK A;  1V6L A;  1FMD 2;  5ABJ A;  2AAC A;  1IGO A;  1YLL A;  2IXL A;  2ZGR A;  3PIG A;  4QPG B;  5ANN A;  2QCS B;  3KF5 A;  4QQ2 A;  3VDB A;  1M26 A;  4UW5 A;  1AR6 1;  4W6X A;  3UJQ A;  2V5D A;  2V5Y A;  1VAM A;  2XKO A;  4W50 A;  2MEV 1;  5A3U A;  2UWA A;  2FDF A;  2HWD 2;  4FPC A;  5ABJ C;  3R4D B;  2DTY A;  3AMQ A;  2C4X A;  3ILF A;  2X8K A;  3T0B A;  3LGR A;  3OYW B;  4ZZ5 A;  3V0A A;  3BTX A;  4AFC A;  1UY0 A;  2VMC A;  4KI5 M;  4GH4 A;  3S5A A;  1GOG A;  4Y3B A;  2HKX A;  1S4C A;  4D8M A;  1AR9 3;  1H4G A;  2RM2 1;  2ZOE B;  5L73 A;  4DFS A;  3MF6 A;  1ND3 A;  2ZEW A;  1YWT A;  1LU2 A;  2IFW A;  2JE9 A;  4WVM B;  1WW4 A;  4Y1U A;  4E8C A;  1IOA A;  1UD1 A;  2VVD A;  3N9N A;  2I74 A;  1COV 3;  4UOJ A;  1REE A;  2PLV 1;  3K3O A;  4BJ0 A;  1G9B A;  1H0B A;  4JKL A;  4IGQ A;  3NQH A;  1PZ8 A;  3VZO A;  2VW2 A;  5JI9 A;  5GLW A;  3ZOI A;  2X29 A;  4UAP A;  4YYO A;  4C0B A;  2YDE A;  1KDK A;  4FP3 A;  4ASK A;  4YVS A;  3KT7 A;  4XJ8 A;  4P9X A;  2VMG A;  4NPL A;  1ZBA 3;  2VXJ A;  1VAV A;  1UIJ A;  4CCL A;  1O4Y A;  5GJ6 A;  1OVS A;  5C33 A;  3O8I A;  2BWA A;  3JBG 3;  3WNX A;  4QPI C;  1AYM 2;  4PF5 A;  5EV7 A;  3T1M A;  1RMU 3;  1ZBE 1;  3WY6 A;  1D4M 2;  1ULG A;  3KVB A;  5CFC B;  5I0R A;  2BFU S;  3JBG 1;  4CXY A;  4QHO A;  1PIV 1;  3FHI B;  4XDP A;  1HLC A;  1QJA A;  3ZHE B;  2KXL A;  4EV0 A;  1TNF A;  1ASJ 1;  1VMO A;  5K7P A;  2JDN A;  1F5J A;  3AMP A;  2F4P A;  2WFF 3;  4Q0S A;  3HWJ A;  1AX2 A;  3M8L A;  4JZR A;  5I8Y A;  4A7Z A;  2XVG A;  1E57 A;  2JDZ A;  3UNP A;  1W90 A;  1HQN A;  1BVV A;  1ZZC A;  2ZPX A;  3O0W A;  4H55 A;  3H1Y A;  4J25 A;  4QB2 A;  2BW8 A;  2DF7 A;  3VZN A;  1C8N A;  1UYY A;  3U4X A;  3K77 A;  5FR3 A;  1N1Y A;  5FMO S;  4CUA A;  4E2E A;  2PA7 A;  2GUE A;  3ZYH A;  1GQG A;  1JYX A;  2O98 A;  1L7R A;  4AQ2 A;  2GC0 A;  1CIW A;  1J3P A;  2NPM A;  1NCQ C;  2A73 B;  2IC1 A;  4JRA A;  4CU7 A;  3BOP A;  1H1M A;  1EPW A;  1FI2 A;  3CZJ A;  3VZF A;  4FFI A;  2RG4 A;  4CDQ C;  2GNT A;  4EYU A;  4PIK A;  4YW7 A;  1FV2 A;  4A41 A;  3DEM A;  2WNE A;  2WWJ A;  4TLF A;  2C9A A;  1AJO A;  5LA2 A;  5FFO C;  5H9Q A;  2PHL A;  1TP8 A;  4FJ3 A;  3B02 A;  4OI4 A;  1JS9 A;  5BNQ A;  4CUG A;  5FPZ A;  3I4R A;  2P6C A;  4LUK A;  5A7W A;  5BNO B;  1LGC A;  5FXV A;  3VZM A;  5FZA A;  3AL6 A;  3K48 A;  4RQP A;  4YM1 A;  2R07 2;  2MEV 3;  1W2U A;  4UFL A;  2A75 A;  3BPZ A;  5CKQ A;  5JXJ A;  2KD7 A;  2XLF A;  4QKF A;  4A42 A;  1CAW A;  3AZZ A;  1O9E A;  1JU4 A;  2YFZ A;  2XML A;  5FZO A;  5C7G A;  1KXG A;  4IE5 A;  2D97 A;  3FC0 A;  5EXA A;  4AHW A;  3NVC A;  4BZ4 A;  3T1L A;  4Q8L A;  4M00 A;  5IAT A;  1RXF A;  1RHI 2;  2GH8 A;  2WII B;  3V0A B;  4O65 A;  1DF0 A;  4OUL A;  1YHF A;  2B7Y A;  1VRH 3;  3LDR A;  3ZKU A;  3TNQ A;  4CE8 A;  1U5X A;  2YUE A;  2YBP A;  3SC7 X;  3SIS A;  3LZZ A;  3TOW A;  2NQY A;  2D3P A;  1CX1 A;  4Y32 A;  2VBP A;  4AW7 A;  4RFR B;  3AFG A;  5T52 A;  4DHU A;  4Y5I A;  4QAW A;  3U10 A;  5JM1 A;  5DQ0 A;  4CEY C;  2D44 A;  1HB2 A;  3GM8 A;  3KCY A;  5KHH A;  3KT4 A;  3SNM A;  3IQV A;  1NE4 A;  1WLC A;  3A0K A;  4N7U A;  4F83 A;  2RM2 2;  5C5T A;  5AC9 1;  1PHM A;  3AB0 A;  5GZF A;  3LM1 A;  4H7L A;  3V0B A;  3WF3 A;  4CDQ A;  1KQR A;  3THT A;  4K8F A;  3AVR A;  2JDK A;  1QF3 A;  3IQJ A;  4LIT A;  3LL0 A;  4I3G A;  2ARE A;  1S0G A;  4MHR A;  2HWB 3;  4BK5 A;  4PCR A;  5IFT A;  3UL2 A;  3LIH A;  4GB3 2;  2WNU B;  1QXR A;  1Q8S A;  4AED C;  5T5L A;  2LS6 A;  4D7T A;  5IVF A;  5D3E A;  2LTN A;  4PIX A;  5FPA A;  1XNC A;  2GME A;  4WM8 A;  3OY8 B;  1O9D A;  3DL3 A; 
#chains in the Genus database with same CATH homology
 3LPF A;  4XUQ A;  3WF1 A;  1UMI A;  2WAB A;  4DXS A;  1W8N A;  1UY4 A;  4DUW A;  4MOA A;  2X05 A;  5LA1 A;  2WO3 A;  1US3 A;  3CKH A;  2Z4F A;  4QDR A;  4UI9 L;  1JZ3 A;  4E8D A;  5FUI A;  3J7H A;  2ZXQ A;  3A23 A;  3W5N A;  2X10 A;  3AC0 A;  2LW8 A;  3T09 A;  4KWU A;  1ULO A;  3MV1 1;  2JD9 A;  4PF1 A;  5EIY B;  2VZS A;  1US2 A;  2W1Q A;  2J1R A;  2VC9 A;  2W47 A;  4JX0 A;  3HNY M;  3K4A A;  5JMO A;  1PX4 A;  1IQD C;  2HLE A;  2W94 A;  4OZO A;  2VM9 A;  2QBX A;  1W8O A;  1UYZ A;  2W3J A;  2XOM A;  2XQX A;  2WN3 A;  3OGV A;  3GXU A;  4RYD A;  4XUT A;  1PMJ X;  3I3E A;  3GGL A;  1W0N A;  2CDO A;  3MV0 1;  3PUH A;  4GWJ A;  3I2G A;  1HN1 A;  4RN5 A;  1K42 A;  1GOF A;  3GDB A;  3DYO A;  4P5Y A;  4BDV B;  3T2Q A;  4YPJ A;  4LHS A;  5JXI A;  3HNM A;  3A22 A;  2VMF A;  3E1F 1;  1O59 A;  3MO4 A;  1RYY A;  2J1V A;  3LE0 A;  5B4X A;  3HPN A;  3VD5 A;  2VZP A;  2DDU A;  4A44 A;  1W9S A;  2CDP A;  3I2K A;  1K12 A;  3I2I A;  3VDA A;  2WBK A;  2PQS A;  5HXM A;  1GU3 A;  4ZZ8 A;  3I2H A;  2C9K A;  2BER A;  3VD9 A;  1KGY A;  2J1U A;  5JR2 A;  3C7O A;  1UYX A;  2EIE A;  4DEQ A;  1UZ0 A;  4XVH A;  3NJV A;  4ZXE A;  5JUV A;  3OBA A;  3CZU A;  3ETP A;  1GOH A;  5DMY A;  1LNS A;  4HG6 B;  2WO1 A;  4GZ9 A;  4CU9 A;  2W92 A;  3OGR A;  3NNG A;  3CIH A;  1F4A A;  3WNM A;  2WZE A;  3VD4 A;  1R64 A;  1SDD B;  1EUT A;  4TTG A;  5IFP A;  2Y6G A;  4A3Z A;  3WNP A;  3ACH A;  2B4K A;  4DEV A;  4QDS A;  2XON A;  3ZM8 A;  4CVU A;  1XNA A;  3CDZ B;  3D3A A;  1D7P M;  1O8P A;  1K3I A;  3HEI A;  2OKX A;  1CZV A;  3I3B A;  2QQM A;  4LQR A;  3SEP A;  5CYY A;  2ZEZ A;  1NX9 A;  4PQQ A;  3I97 A;  4IUG A;  1I5P A;  1W9W A;  3FL7 A;  5JXG A;  2DCK A;  3DYM A;  3JXS A;  4CUC A;  5IJR A;  1JZ6 A;  4A45 A;  1W9T A;  2VCC A;  2VCB A;  3MBW A;  1T2X A;  2WUH A;  2BBA A;  1MPX A;  2W46 A;  1SHW B;  3ACG A;  1EUU A;  2QQK A;  3THC A;  3U37 A;  2J1T A;  3WNN A;  4P00 B;  2E26 A;  3OG2 A;  1WCQ A;  1XC6 A;  2L9L A;  3A21 A;  5G05 L;  4DXR A;  3HOB A;  2VZQ A;  3IAQ A;  4FI9 A;  4AAX A;  3ABZ A;  2X09 A;  3SEE A;  3C7F A;  4W8J A;  1BHG A;  4DUX A;  3WQB A;  3SKJ E;  2W91 A;  2J1E A;  2VZT A;  3WNL A;  1GQP A;  1W99 A;  4D0Q A;  5B4N A;  3I3D A;  3BN6 A;  1H6X A;  2XHN A;  2WN2 A;  4ARX A;  4OMC A;  3WEZ A;  1JYN A;  2ID4 A;  2QQN A;  4QX3 A;  4ZY9 A;  2ORX A;  3LQC A;  4QDQ A;  2BGO A;  4QX0 A;  3WNK A;  1CIY A;  3I2F A;  4LKS A;  4P02 B;  4LPL A;  3ACF A;  1UY2 A;  4XUR A;  3P6B A;  2RV9 A;  5DPN A;  1UWW A;  1CZT A;  3WF0 A;  4CU6 A;  3OB8 A;  4JKK A;  5EJZ B;  1O8S A;  2VCA A;  3III A;  2QQI A;  3IB3 A;  4ARY A;  4P08 A;  4QX2 A;  2EID A;  2J7M A;  4Z2A A;  3THD A;  3MUY 1;  5C71 A;  3WSO A;  1DP0 A;  1XNT A;  2Y8K A;  2EIB A;  1SG3 A;  4CUB A;  4L0P A;  2JKX A;  5JXH A;  3BGA A;  3T08 A;  2VO5 A;  3DYP A;  1TG7 A;  2VMD A;  2VQT A;  1UX7 A;  3NJX A;  2B9V A;  3HNB M;  1JZ4 A;  2VZR A;  1L7Q A;  4OMD A;  1WKY A;  3ECQ A;  3T0A A;  2E31 A;  1CZS A;  1GMM A;  3WF4 A;  1P8J A;  3CQO A;  2Y64 A;  4QB6 A;  2QQL A;  4BXS V;  2ZEX A;  2W87 A;  3K4D A;  2Y6J A;  4QB1 A;  4A6O A;  3FHQ A;  3P1I A;  2WAO A;  2BGP A;  4KMQ A;  5F7U A;  3X0U A;  2QQJ A;  3IDA A;  2DCJ A;  3LEI A;  2YB7 A;  1OF4 A;  2VZU A;  2E33 A;  3VD3 A;  1JZ8 A;  2Y6L A;  5CZK A;  1GUI A;  2W1U A;  5IYY A;  2Y6K A;  5LA0 A;  1NUK A;  4XUP A;  5DN2 A;  3WF2 A;  3VDB A;  4QPW A;  2V5D A;  4W50 A;  5IHR A;  4CU8 A;  4M4P A;  2ORZ A;  2EIC A;  3HJR A;  2C4X A;  3T0B A;  2WQ8 A;  1UXZ A;  4ZZ5 A;  1JZ5 A;  3ACI A;  4OUE A;  1UY0 A;  2VMC A;  4KI5 M;  1JZ7 A;  3OEA A;  2J22 A;  1GOG A;  2W9X A;  4D8M A;  1GNY A;  2JDA A;  5LCW L;  2ZEW A;  1PX3 A;  2WYS A;  4E8C A;  5HPO A;  2VQU A;  4UOJ A;  5C70 A;  4BJ0 A;  3FHA A;  3NRU A;  2YFU A;  4JKL A;  3NQH A;  3W5M A;  2HYX A;  1NKG A;  4MGQ A;  4UAP A;  4XUN A;  3C8X A;  2W1S A;  3SKV A;  2WAA A;  1JHJ A;  1OT5 A;  2VZO A;  1F4H A;  1JZ2 A;  2VJX A;  3F2Z A;  2WZ8 A;  3T0D A;  3MUZ 1;  2BZD A;  2YC2 A;  3K75 B;  3T2P A;  4W4Z A;  2W5F A;  4BK4 A;  3LEK A;  2V4V A;  2Y6H A;  3LPG A;  4AG4 A;  3DEC A;  3VD7 A;  5G04 L;  5A1A A;  2ZEY A;  3A7Q A;  3EB7 A;  1UXX X;  2VL4 A;  2VME A;  2VR4 A;  3UNP A;  3LEG A;  4XZU G;  2VZ3 A;  2W95 A;  4QB2 A;  1UYY A;  3K77 A;  1DLC A;  4CUA A;  4PT6 A;  3C7E A;  1JYX A;  3PUI A;  1TVG A;  4GWI A;  4M4R A;  4TXW A;  4ET7 A;  1L7R A;  2J1A A;  1OF3 A;  4CU7 A;  2WO2 A;  3C7G A;  1UMH A;  3CZJ A;  3IAP A;  2VOT A;  1DYO A;  4A41 A;  1J83 A;  1UY1 A;  2JE8 A;  5LA2 A;  1YQ2 A;  3FN9 A;  2QQO A;  3T2O A;  2V72 A;  3EYP A;  3UES A;  1OD3 A;  4MAD A;  1ULP A;  2RVA A;  1K45 A;  2E32 A;  5JXJ A;  2KD7 A;  4A42 A;  1JYW A;  1OH4 A;  2YFZ A;  1JU4 A;  1PMH X;  5C7G A;  1J84 A;  3UET A;  5J1X A;  2WDB A;  3WNO A;  4A4A A;  3CMG A;  2RJ2 A;  4DUV A;  3VDC A;  4DXT A;  1UY3 A;  4MGS A;  1H6Y A;  1CX1 A;  2J1S A;  3C7H A;  2YG0 A;  3OGS A;  4QAW A;  2VZ1 A;  4MO3 M;  5DQ0 A;  3GM8 A;  3K46 A;  2VTF A;  1KEX A;  3I2J A;  4JKM A;  3WF3 A;  3HN3 A;  4OYU A;  4QX1 A;  2C26 A;  2VZV A;  4BK5 A;  2W1W A;  1NAE A;  1JYV A;  5IFT A;  2YC4 A;  1JU3 A;  1XPW A;  2R7E B;  2LS6 A;  5EJ1 B;  3K4Z A;  4JHZ A;  4XUO A;  3OEB A;  1JI6 A;  5I0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...