1CIYA

Insecticidal toxin: structure and channel formation
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
577
structure length
577
Chain Sequence
YTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPSTIYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYIA(A)
publication title Bacillus thuringiensis CryIA(a) insecticidal toxin: crystal structure and channel formation.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Toxin
total genus 182
structure length 577
sequence length 577
ec nomenclature
pdb deposition date 1995-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00555 Endotoxin_M delta endotoxin
A PF03944 Endotoxin_C delta endotoxin
A PF03945 Endotoxin_N delta endotoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.190.10 Mainly Alpha Up-down Bundle Delta-Endotoxin; domain 1 Pesticidal crystal protein, N-terminal domain 1ciyA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1ciyA03
2.100.10.10 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Pesticidal crystal protein, central domain 1ciyA02
2W94A 2ORXA 1KGYA 1W9WA 5DPNA 3SEEA 1JHJA 3HNBM 3T09A 1O8SA 2W1UA 3NQHA 4ARXA 5FUIA 1SDDB 5J1XA 2VL4A 5EJZB 4P08A 1JZ6A 4DUVA 3HJRA 5EJ1B 3LEIA 3MV11 1JYWA 5DMYA 2PQSA 3I3BA 4DUWA 1W9SA 1EUUA 3C7FA 4QX1A 3HN3A 3LPFA 3K4ZA 1ULPA 4L0PA 4GWIA 2OKXA 5LA2A 5C71A 1PX4A 3LEKA 3HEIA 3ACFA 2E32A 2VZOA 3PUIA 1T2XA 1GOFA 3I2KA 4QB1A 3P1IA 3UESA 3DECA 4QDRA 3WF2A 3LE0A 2VMCA 3I2FA 3WF4A 2ZEZA 3OGRA 4LQRA 4P02B 4ZXEA 4CU7A 5G05L 1K12A 2E26A 5HXMA 2Y6GA 3I3DA 1L7RA 3OEAA 3WF0A 1ULOA 3HNYM 2VQTA 4ET7A 3C7OA 4BK4A 2Y6LA 1W8OA 3I2HA 2WO1A 2YG0A 4W8JA 3C7EA 5JR2A 4GZ9A 3OG2A 2VJXA 4XUNA 5C70A 3WQBA 4BXSV 1P8JA 4A42A 3I2GA 5IJRA 1SHWB 1HN1A 2W5FA 2LS6A 4DXTA 1OH4A 1OF3A 2VOTA 2VZTA 2XOMA 5DQ0A 1DYOA 2DCJA 2HLEA 3WNMA 1NX9A 4QX3A 3WF1A 3CMGA 3MUZ1 3T0BA 4QPWA 1JI6A 2L9LA 2J1SA 2Y64A 1J83A 1K3IA 3LQCA 4ZY9A 3P6BA 2YC4A 4D8MA 1UZ0A 2EIEA 3A22A 1UMIA 5JXJA 3A21A 3T2PA 2VZPA 1R64A 1UXZA 2XHNA 1XPWA 4JX0A 4QDQA 3J7HA 3C8XA 3OEBA 3I2IA 2QBXA 1RYYA 3C7HA 2YC2A 1GU3A 3A23A 1O59A 2JE8A 1K42A 5JXGA 1W0NA 2W46A 4P5YA 4PT6A 4CUCA 1US3A 2BGPA 3PUHA 3SKJE 3FN9A 2W95A 3K4DA 2QQKA 2JKXA 2J1UA 2WAAA 4XUOA 3SKVA 5JXHA 4MO3M 3K4AA 4A6OA 2C9KA 3F2ZA 2VMDA 2J1TA 4OMCA 2VCCA 2YFZA 3T08A 2RJ2A 2WUHA 2Y6KA 3WNLA 3T2OA 2ORZA 1CZSA 4A44A 4XUQA 3U37A 3T0DA 3K77A 1CIYA 4AAXA 5CZKA 1GOGA 2J1EA 4QDSA 3DYMA 3VD5A 3D3AA 2Y6JA 4LHSA 1EUTA 2VMFA 3I97A 3WNPA 3VD3A 3BN6A 1JZ7A 1OT5A 3T2QA 3NNGA 2XONA 2VTFA 3CQOA 2EIDA 2J1AA 3C7GA 5A1AA 4ARYA 1SG3A 3FL7A 2E31A 4XURA 3THDA 1UY4A 3VDAA 3OGVA 3ACIA 3LPGA 5JUVA 4CUAA 3WSOA 3OB8A 3DYPA 4OUEA 2W91A 4PQQA 3FHAA 2VCAA 4CU6A 4MOAA 4ZZ5A 1DLCA 1GNYA 2QQIA 2BZDA 1W9TA 2VZQA 3I2JA 4XVHA 2BGOA 3HNMA 3HPNA 1PMHX 1UYXA 2VZRA 2WYSA 2JDAA 4P00B 4RYDA 2J1VA 5B4XA 1JZ5A 2C26A 4CU8A 4DEVA 4QX0A 4OMDA 4DUXA 4DXRA 3IIIA 2WO2A 3IAQA 1UWWA 2ZEXA 5C7GA 2CDOA 2QQOA 2XQXA 3CZUA 4AG4A 3CIHA 2VCBA 4RN5A 2VZ3A 3BGAA 4A3ZA 2VZUA 2WAOA 5JMOA 1JYNA 3EB7A 2WZ8A 2VZ1A 1JYXA 2WDBA 1UX7A 5HPOA 2WBKA 4CVUA 5B4NA 1WCQA 3IB3A 4MGSA 4XUTA 5F7UA 4LKSA 1XNTA 2W1WA 3I3EA 4JKMA 1PX3A 3CDZB 2BERA 3THCA 1W99A 2VQUA 4W4ZA 2VZSA 2V72A 3K75B 4YPJA 2VO5A 2X09A 2YB7A 1GQPA 2J22A 1LNSA 1XC6A 5DN2A 3NJVA 4M4RA 3VDBA 4D0QA 2VR4A 1BHGA 1NAEA 3GDBA 3DYOA 2C4XA 1J84A 2VM9A 2RVAA 4UOJA 2EIBA 1CX1A 3X0UA 4JKKA 4DEQA 4FI9A 4JKLA 3ABZA 4MGQA 3ZM8A 1L7QA 2J1RA 4QB6A 1OF4A 3IDAA 2V5DA 1JZ3A 2WO3A 2Y8KA 4KMQA 4Z2AA 4BJ0A 1US2A 1JYVA 4UAPA 4E8DA 3HOBA 2RV9A 3LEGA 2WN2A 4KWUA 4QB2A 3W5NA 1UYYA 2KD7A 2Z4FA 1UY3A 2DDUA 1NUKA 3ECQA 2WN3A 1GOHA 5LA0A 3T0AA 3WF3A 5JXIA 1XNAA 1MPXA 3K46A 1K45A 3E1F1 1H6YA 3JXSA 4QAWA 1OD3A 1D7PM 4LPLA 4E8CA 1KEXA 2W47A 3WNKA 1UY1A 5IFPA 1DP0A 3MV01 4MADA 2ID4A 2HYXA 2X10A 2VMEA 1TG7A 2ZXQA 4UI9L 3FHQA 3GXUA 1NKGA 5IYYA 4PF1A 1F4HA 1GMMA 2V4VA 5IFTA 2E33A 2R7EB 4W50A 2WQ8A 3WNNA 4CUBA 2ZEYA 5EIYB 2B9VA 4KI5M 1TVGA 2VC9A 1IQDC 1UMHA 1UYZA 4BDVB 1PMJX 2QQMA 2CDPA 1I5PA 3MO4A 3EYPA 4OYUA 1GUIA 1UY2A 3MUY1 5I0DA 5LCWL 3IAPA 4IUGA 4JHZA 1JZ8A 4XUPA 4DXSA 2WZEA 3WEZA 4OZOA 2EICA 2QQLA 2LW8A 4M4PA 4A41A 4QX2A 4A45A 3ACHA 1JU4A 3VD7A 3UNPA 3AC0A 3WNOA 5LA1A 2BBAA 3W5MA 2Y6HA 1CZVA 1YQ2A 3NJXA 2VZVA 3GGLA 2DCKA 2W87A 1H6XA 1JU3A 3SEPA 3ACGA 3A7QA 4TXWA 1UY0A 4HG6B 2YFUA 5CYYA 2WABA 2J7MA 1O8PA 2W9XA 2X05A 3VDCA 3CZJA 5IHRA 4TTGA 3OGSA 1W8NA 2B4KA 2W1SA 4CU9A 3VD4A 2W1QA 4ZZ8A 3ETPA 1UXXX 1CZTA 1F4AA 4XZUG 2JD9A 1JZ2A 4BK5A 1JZ4A 4GWJA 5G04L 4A4AA 2W92A 3MBWA 3CKHA 3VD9A 2QQJA 1WKYA 3NRUA 2ZEWA 2W3JA 2QQNA 3UETA 3OBAA 3GM8A
chains in the Genus database with same CATH superfamily
2W94A 4XFGA 2ORXA 2RJLA 5F2WA 1W9WA 4X6QB 3ZSMA 4TLFA 1ZZBA 2DVDA 3Q8EA 4EN8B 1FMD3 3VV1A 5BNPC 5LWBA 1HB1A 5EJZB 3V56A 4DUVA 2R043 2VXRA 3LEIA 1S0CA 4FO9A 5LVZA 2XWJB 3MV11 1PO11 5F32A 5EWSA 5FXZA 3UGGA 4IHLA 5ACA1 2XJSA 1JYWA 3VZMA 3C7FA 1ENQA 4K1ZA 4ONUA 3WLUA 2ZZQA 4L0PA 3CLPA 4MHUA 2GNDA 4GWIA 3THPA 3WOGA 4DY5A 3GHNA 2R16A 2DU1A 2QFEA 2NYYA 3M2MA 3VL8A 2PHFA 1MEC1 4XF3A 3LLZA 1OUXA 4JQTA 3SCFA 1R083 2XXZA 3WOCA 1XBFA 5KHIA 5LX2A 1RUH3 2OYZA 2PMWB 2UU8A 5HXVA 5FV3A 4CXXA 2C5DA 2FZ1A 4NROA 1VBA2 3IQVA 3HR9A 4COYA 4HOOA 1RUG1 3WF2A 3GALA 2ZGLA 3LE0A 3POFA 5DUXA 4EROA 3RZZA 4CDXA 2YV8A 2ZGMA 2PXJA 4LKEA 4LQRA 1NLQA 4ZXEA 2Q8EA 5HV4A 2PLV1 1GP4A 1K12A 1O5UA 2E26A 4FT8A 5F3CA 4NIHA 4AQSA 3ZMNA 5ABJA 4IV1C 4IXLA 2X5IA 1MQTB 1UU4A 3OGGA 4OHWA 2HYKA 3I3DA 1IHMA 1RJ7A 2QDNA 3VZKA 4CCDA 1N1VA 3WF0A 5LBBA 1ULOA 2ZGSA 2RG4A 1GZCA 1C3HA 3QACA 4CDUB 5A7SA 5J4XA 4J6GA 2VBBA 2WKKA 3VBHA 4NR1A 3C7OA 4E2GA 1RUI3 4CEWB 4IE6A 1MS3A 4DX0A 5GZDA 3DF0A 1WD3A 4YVSC 5A3UA 3VDDA 1LB2A 1UYPA 3VGIA 2WQZC 5GKAC 5FUNA 1BCXA 5FZ6A 5I0UA 4DHRA 4CRQA 5CKNA 4FP3A 4K7JA 1Q56A 1VBD2 2MNGA 2D44A 5DAWA 1DZTA 1NOVA 2XVLA 3NAPB 2JDKA 1QQP3 4N9HA 1YIFA 4NMIA 5KXBA 5ANNA 1AR71 2VJXA 5D21A 4UWDA 1RMU1 5L7OB 3VZFA 5IVBA 3M70A 5FZ7A 3UV9A 4E2EA 1HJFA 2E7QA 3ZFGC 1GQGA 1HKDA 1SHWB 1HN1A 2W5FA 4KBZA 3TEXA 2DVBA 3GYDA 4XFCA 3VB9A 4AF9A 2Q8DA 1TQ5A 3WW3A 4CDWB 4DXTA 4FVVA 4RS5B 2VOTA 4O46A 2XOMA 3P3NA 3ZYGA 3WNMA 1IG0A 1TME3 2XBO1 3MUZ1 5A7OA 4FPGA 5KHGA 3J9SA 3ZVXA 4MLOA 1W6OA 1NA1C 2HWD1 4XYXA 4FCAA 4YW4A 4DPNA 4NHMA 5FZLA 2GC0A 4YVWA 4EN7B 4W6YA 1AYM2 3J4UH 4YW5A 1S2KA 4NRQA 2C0ZA 5GJ6A 4MGYE 4AKCA 1J58A 1W9FA 4G9SB 3ZMOA 2R32A 4YZ5A 1T6GC 2J1SA 1J83A 1RVF1 1AJKA 2AACA 5FP4A 5A70A 1O3RA 4MGTA 4Z07A 4BQ2A 1QJAA 1W6NB 4D6SA 4PIKA 1TOQA 1CPMA 1UMZA 3SCHA 1DGLA 4KGQA 1DZRA 4WM7A 3EQEA 1WW7A 4IV3A 4EJRA 4GH4B 3L2YA 4JHTA 1DDLA 1UXZA 1AYN3 2A3WA 2RDNA 2JICA 2RS52 1NCQB 3E6BA 1QH7A 5J37A 4TLGA 5J7MA 2GUXA 1YWKA 5D8AB 1ZBE2 1GU3A 2BGCA 3N35A 5JI9A 1WMEA 4PBOA 1LHWA 5F3GA 1K42A 5C3QA 5HCBA 4Z1VA 1HX6A 1AXKA 2Y26A 3Q8BA 2GUEA 3N9QA 4K8RB 4RHV1 1AL22 1GZWB 2W95A 2YU1A 4X6RB 1GNZA 5JIUA 1IPKA 2GDFA 1H8VA 4EQVA 5T54A 3UJOA 4BA6A 2QP2A 4QGLA 4OQ9A 4A6OA 5J48A 1LULA 4J25A 5J09A 2VCCA 2C1NA 1X33A 2YFZA 1LODA 1O4TA 1PK6B 2NLRA 4HPKA 4RFT0 5EHDA 5EPAA 3U78A 2NU5A 2RJ2A 1SLIA 2BWAA 4J1WA 5BXXA 3URFA 3ZYFA 1OKQA 2DCYA 1CZSA 4COVA 3U37A 4GMP3 3A4UA 2WWUA 4N9IA 3K77A 2RR13 4XJ8A 1CIYA 4AAXA 1WA4A 2V7DA 3AFKA 4E27A 5A3PA 5FP9A 2RDRA 4JV4A 2R071 4JGZB 2J1EA 4QDSA 1BK0A 5JZGA 4U2AA 3H50A 3S5QA 5FPLA 5AFEA 2YYOA 3WNPA 5LA9A 5IVJA 4FTEA 4NPMA 2C24A 4H14A 4PF5A 4QX5A 2EXHA 3GCXA 5JR7B 2BTPA 1OPOA 5A6YA 1POV0 3SCGA 3VD3A 3MEPA 2P2KA 1MR5A 3T0LA 3NNGA 4CTEA 3POSA 4QQPA 3JZVA 4AHYA 3IDCB 2RE9A 3DL3A 3CEWA 3MLLA 3PIGA 4LHNA 3USUA 4CSWA 2A5ZA 2Y6FA 1IS4A 1QEXA 5CFCB 4NHYA 3UK9A 4AQ6A 4DDNA 3AMHA 3OYWA 4XAAA 4XACA 1ZZCA 2WT2A 1S55A 5DAXA 1UY4A 5EP9A 3H3UA 3RI9A 2FDJA 2D5HA 2Z69A 3N7LA 2UY8A 3OGVA 4LOTA 3VY7A 2D6PA 3LPGA 4OULA 1VBOA 1UPSA 1VBA3 1NCRA 3WCRA 5BPXA 2QE3A 1W2AX 3IPVB 1QMJA 2YZ4A 4NIGA 2DBNA 3FHAA 4MGKE 2WLPA 2ATFA 2BP6A 2XUEA 2FMYA 1PO22 4E4DX 4ZZ5A 3S30A 2UWCA 1GNYA 2ET1A 1J4UA 1ND3C 2NPMA 4LE4A 2O8OA 4XCAA 1SQ4A 4AVAA 1B35A 3M3EA 2EXIA 4XVHA 1UYXA 1OFNA 5CFDB 4HVQA 2C74A 1S0IA 2J1VA 2BFUL 1YEWA 3VY6A 2RS32 2VNVA 1ENSA 5LK7B 1W6PB 3ZXDA 2VGDA 5C8WA 1AR91 4DHMA 1CESA 4NPLA 3DKQA 4DEVA 1O4ZA 4XBNA 5GLUA 1C3KA 3GCWA 3LF7A 2B05A 1W6MA 4Y22A 5CKQA 3ORJA 3BB6A 2NQYA 3OF1A 1AL0G 2CGNA 1OOPB 4UFKA 4AHWA 1Y9GA 5C7GA 2HWF1 4IW3A 2WWJA 1HB3A 1G9FA 4MHRA 2PFWA 5F3IA 5FJKA 3FUQA 4XCBA 4YZ1A 2BFUS 3W21A 1AXZA 1UU5A 2VUCA 2JDNA 4DHOA 3KVAA 1PZ7A 3AKTA 4AG4A 2B9UA 2W08A 3VHOA 4RN5A 3ROUA 1WCUA 1ONAA 2VZ3A 3VHPA 3SPRA 2WAOA 2MEV1 4NN0A 5FMOS 4BQ4A 4AFBA 5JMOA 2A6WA 1RUOA 5KHJA 4O9EA 5DXDA 3EB7A 1KFUL 1OA2A 4XTMA 1RUD1 3VL9A 1JYXA 2WDBA 3OBZA 1K5MC 1LOAA 5K9YA 1ST8A 1S0EA 5IW0A 1COV1 2PHRA 1DBNA 3RVHA 3CQGA 2FQPA 3IB3A 4MGSA 4NHXA 1LCLA 1SDWA 1CAXB 1Q8SA 2P34A 2VVDA 2RDSA 4OZXA 1AYM3 4D6QA 1UX6A 2IFWA 2TNFA 1SZBA 5C9AC 1PX3A 1BEV3 5DG2A 3TN93 3THCA 3I3MA 5J51A 2CAUA 2BVBA 1UZZA 1BMV2 3LIGA 1NT0A 4P14A 4B1MA 1POQA 3TBDA 5LEKA 3M3IA 4W4ZA 5FKBA 1QHDA 2JG8A 5IK8A 3LD8A 2H6CA 1H4GA 1R1A2 3WUDA 1BVVA 1L7LA 2OVUA 3AX4A 5FZOB 4X8PA 2X09A 1RUG2 3MPBA 2ZOEB 1BBT3 1GQPA 2J22A 3O0XA 3OPZA 3WQ0A 4DO0A 1PGL2 5JOXA 1JOJA 1ZBE3 3T1LA 1UIJA 3LFMA 4HKLA 1LJ7A 1G8WA 2F6BA 1LOEA 2FBEA 2VW2A 4LULA 3B9CA 3EXUA 1N3QA 1A6CA 2WSVA 4IGQA 2CWMA 4OHVA 2GALA 1VMFA 3TOJA 1J3PA 1J3QA 2RVAA 1AL23 2JG9C 2ARXA 1KD7A 3WOBA 1AZDA 2RS13 3KCCA 4JKKA 1GSLA 1SEFA 1O7FA 2Z5WA 4FI9A 4GD4A 2W39A 3H1MA 5FZKA 1O3SA 3ZXEA 4RGAA 4UBGA 4ZKTB 2J1RA 5CIRA 5JDBA 4IEAA 1JZ3A 1ASJ1 4URTA 4XEZA 5IVEA 4IV1B 2BU9A 4Q2FA 3I4IA 3RSJA 1HRV3 3IQUA 4MH0E 1JYVA 3MITA 1XXRA 3MFAA 4LITA 2WN2A 4BG6A 2E7AA 1G86A 4JDDA 5IT6A 1V6OA 1S0JA 1NQJA 2E7TA 5EQUA 4YVSB 3M8LA 2F4LA 3ECQA 1BK1A 4RR3C 5I93A 5LA0A 1LTEA 2BJSA 4LOSA 3BIWE 4I3PA 5E16A 1QOTA 1SBEA 3T0AA 3WF3A 4ORFA 5HCAA 1XNAA 4Y20B 4BH9A 4C0BA 3POYA 1MPXA 5DAQA 3K46A 1K45A 1EYBA 3JXSA 4BE3A 4QAWA 3LOBA 3AKPA 4IL7A 3NO8A 5FYMA 1CAVB 1CAUB 1V6NA 3WW1A 2JIGA 4BU2A 3FLRA 2A6VA 3Q8AA 3L9JT 2WQ4A 3ZFGB 3MV01 4JGYA 4F3JA 4DHTA 3M7AA 4N43A 1PM4A 3FBYA 3KHBA 4JRLA 4AW7A 4Q5OA 3ALQA 2HYQA 2ZXQA 1T6BX 4N90A 3FHQA 2FDKA 1NKGA 1PVXA 3HVDA 1MS1A 1SLAA 5FY8A 2DFBA 2YPDA 4Y5TA 2I07B 1AR81 4CPBD 5A32A 5EXGA 2WZR1 4W50A 1NA1B 4HXCA 4KG0A 5F5AA 2Q8OA 3RWNA 4IE5A 1AR61 3ZDSA 3P1QA 4DATA 2JEMA 2DU0A 5IVFA 2ZEYA 2BVVA 2HH9A 4XXPA 3VZJA 1PGSA 1XSRA 4KI5M 1VRH1 4LTAA 3UGHA 1EY2A 3DV8A 3H9AA 4UXAA 1ZYBA 1RTVA 5F37A 3GZEA 4BDVB 1U5ZA 2QQMA 1B09A 2CDPA 2XH6A 5JI7A 2UWAA 3UBWA 2BV4A 1X50A 3EYPA 4NE9A 4OYUA 1KJRA 5C8CC 5CG8A 5CISA 1MQTC 1GQHA 2RM22 2RS33 1EAH3 1H2KA 3JBG1 4Y32A 4CDXB 2HWC3 4N7IA 3POJA 4JHZA 1FPN2 4R9AA 5JPMB 3PVBB 1I1EA 1VBC1 4EWDA 3BODA 5I8YA 2GSYA 1NLSA 2WZEA 1R091 5DDJ3 5EYXA 3LEMA 4DHUA 2P3KA 2VNGA 2P3YA 5D3FA 3OY8A 4OZOA 4B4QA 4CEWC 5ABJB 5FYSA 2X5IB 1ZZ8A 2ZPXA 5I0RA 3AXDA 3SQOA 5EJ3A 1ZGSA 1C8NA 5FXVA 2LW8A 2B45X 2KM2A 4QU2A 1UOFA 4LMFA 2OZJA 3ZYIB 3AZYA 3O1MA 4AK3A 1G6NA 3VBHB 3MPPG 5IAXA 1ZM1A 4MGIE 2BBAA 1CJDA 4K9SA 4YG3A 3NAPC 4FBFA 3O1TA 4B3NA 1YQ2A 1CAWA 2VZVA 4RFRB 2DCKA 4B4RA 1LGNA 3VDDB 2CU5A 2W87A 2PAMA 4QWNA 3VKFC 4AEDC 1ZZ9A 3ZYHA 1JU3A 2A73B 1W0PA 3MLKA 5F39A 2YGLA 1DGWA 4BPZA 4LJHA 2P37A 4L2NA 3DKWA 4FPHA 3U4XA 3BOPA 3AZZA 1XYOA 3VBUA 1PO13 2D6MA 3POWA 5FZHA 2EF6A 1R1ZA 2X05A 1W2OA 1E5RA 2PELA 4K1YA 3OBTA 1WBFA 4YRDA 1OKOA 2R49A 4R6PA 4Y33A 2B4KA 2XGXA 2YGMA 4JTOA 3WP5A 3KHCA 1OHFA 5FYHA 5I0SA 1CZTA 4UT5A 2D3PA 2JECA 5FREA 1JZ2A 3RZJA 3RS6A 4FAHA 4GWJA 4A4AA 5F9TA 1D2SA 2FDHA 4MXVA 4LO4B 1MZ6A 4ZS2A 3MBWA 3OCPA 1IZ3A 3WDWA 3VD9A 2QQJA 4LORA 3NRUA 4FPJA 2XJQA 5J50A 2XJPA 4Q4Y1 3DCQA 1DG6A 3N9MA 1QXJA 3B69A 1C28A 1QJY2 1R1A3 4BOWA 4I30A 2D3RA 4CP9A 5F5IA 1RUG3 1QGLA 5T5PA 3ZHEB 2WS91 5DPNA 1WGPA 1JHJA 3HNBM 5A7NA 3MLJA 5FYUA 3T09A 4CXYA 3VBRA 2W1UA 2VU9A 5FUIA 2JDMA 4BXFA 5JOWA 4K20A 1RUJ2 4Q1PA 1D0GA 2WWSA 3FWEA 1H2LA 3HJRA 3TYJA 5J96B 5JOYA 3AQGA 4FOQA 3SNMA 5I91A 3I3BA 2XG3A 1W9SA 1W90A 3KV4A 3QH6A 4P5HA 4MGZE 2ZGRA 3RG0A 1KRIA 3K4ZA 4GB32 1LU1A 3PURA 3FZ3A 1XXNA 4H2AA 2O98A 4Y1VA 3UYJA 2VD7A 4CEYA 3MICA 4FXKB 3AP4A 5LA2A 5J36A 1AUYA 1XE7A 2AEYA 1YJLA 5C71A 1XEZA 2RMU2 5BUVA 3LEKA 1PK6C 3HEIA 4XPVA 3O0VA 2VZOA 3PUIA 4YNIA 5FZ1A 4XQWA 2HWF2 5A3OA 4XQ4A 4LO7A 2GC3A 3I2KA 5T3NA 3ZLIA 3FLPA 2JENA 4ASLA 3NVCA 2QKDA 2YMZA 1GP6A 3UESA 2JE9A 2WNVA 1AR73 4U36A 4INDA 4CCOA 1RMU3 2WO7A 3CBNA 3IWZA 3NL1A 2CGPA 2VMCA 2V5YA 5IWFA 4LK7A 1YIPA 3ZKUA 4HPKB 1H30A 2SBAA 2BOJA 1NQDA 4PJYA 1TMF1 2ZEZA 4JGZC 4G3YC 4NIAA 3T30A 4D3WA 1HQNA 4O9GA 4EV0A 1N1SA 4Y1XA 4HSLA 1LOFA 4MVTA 5A1FA 3ZX7A 4AEJA 2RJKA 3OEAA 1G7YA 4KBBA 1COV2 4LBQB 4MUVA 4ISRA 1QQP2 5E1RA 4BM8A 2IVIB 1CGPA 2HWD3 3WP4A 1X8MA 1HRI1 3S7IA 4BK4A 1WS5C 3GBGA 3NNFA 4Y1YA 5AVPA 1W8TA 2HWB1 3WDVA 3FUOA 4EN0A 1WS4A 1H9PA 5FPXA 3P8SA 3EO6A 4IEVA 5LY2A 1N3PA 3D4KA 3RYPA 5D2DA 1TME2 3ACLA 1F2NA 5DZFA 2ZGKA 3JU9A 3PUAA 3WQ1A 4GZ9A 3ETQA 2B42B 4P9JA 1HXS2 4XUNA 4QKBA 3G6JB 4XBQA 5C9AB 3USUB 5GLWA 3U75A 3RMYA 4OI2A 4P9YA 4A42A 2Z42A 1A78A 1OLMA 1W8HA 3I2GA 3WG2A 4FFIA 3GF6A 1I6XA 3OYWB 1UGWA 4YYOA 4AWDA 1AX1A 1DGWX 2WA3A 2LS6A 3A0NA 3ZSEA 1WZXA 1GWMA 2VY0A 4NOTA 2BMYA 1OH4A 1OF3A 2CSGA 2VZTA 5DQ0A 1DYOA 4ZQ0A 1RGSA 2DCJA 3E5XA 1POV3 4N53A 4QX3A 1QDOA 4BZ4A 3FBMA 2ZMNA 2C1JA 4QKFA 4F8AA 1EP0A 3VN4A 5CFDC 5FP3A 2FCVA 1YXWA 1KUJA 1U5IA 2OUHA 3CQCA 2CV6A 1J59A 3ZIWA 4FFHA 5LBCA 1MZ5A 4ATFA 1VBB2 3M1HA 2R6QA 2VXJA 5FWEA 3N4MA 3O1VA 2FDGA 1K3IA 3LQCA 1D4VB 1B35B 4HN0A 3WDTA 4Q4V1 4WRQA 2YC4A 4OHYA 1UZ0A 3A22A 1V6JA 1PVC2 5ANQA 4ES9A 1UMIA 3R4DB 3RWKX 3A21A 3VBOA 4YGDA 2AH2A 1GZ9A 4LBLA 1HV1A 2BDRA 3OEBA 3I2IA 4IGOA 4XFFA 1V9U1 4FOVA 1G9BA 2QBXA 3HMYA 2PN5A 5SV5A 1FI2A 2EVXA 2JE8A 5JXGA 5H9RA 2G4IA 4CUCA 1US3A 1ZRRA 3L2HA 3KQRA 1FOD1 4NRPA 3SKJE 3FN9A 4XTPA 1EPWA 2RR12 3K4DA 4BQ3A 2QQKA 4XUOA 1QJZA 3V0BA 2P4EA 5KHKA 5FY7A 1CPNA 4RR3B 5FJHA 5EYYA 3U11A 4XW3A 2FDIA 3CU7A 3F2ZA 2VMDA 1FATA 2J1TA 3EBRA 3LFIA 3NV2A 1RUE2 5FAXA 3WDXA 3SH5A 2FZ2A 3H8XA 1ZBA1 3VKNA 4LXLA 3PL0A 5FO7B 4I09A 4QXCA 2XHKA 1KFXL 5AC91 4Q0UA 1DHKB 3HT1A 3T2OA 2Q1MA 2VG9A 3OUJA 3CO2A 1ENXA 1PNGA 1Z7S1 1CQ9A 2F4PA 2MHFA 1QJY3 4KWKA 4UFHA 1DGRN 4YM1A 3JB4C 1HW5A 1WD4A 2PHLA 4AHXA 3CJIC 3W59A 3DYMA 4R6OA 1OA3A 2Y0OA 4DHQA 3D3AA 1LU2A 2Y6JA 1S2EA 1EUTA 2AR6A 2HKXA 3LGRA 3POEA 4PBPA 5LB6A 4A3XA 3BIEA 1RUJ3 1VMOA 1NLRA 4KH9A 4BMBA 1E5IA 3NNJA 2JG8B 2GP3A 4UF0A 1EV11 2DFCA 3KF3A 3W58A 4CUGA 3FHIB 1DF0A 2JXAA 4IESA 3O12A 2ARBA 1X7NA 1YZ5A 1C8M2 4A6SA 1JZ7A 1X1VA 3MHRA 2NMNA 4WVVA 3JD72 2ZGOA 4M0NA 4GB33 4TWTA 1PXDA 1V6KA 1AR93 1JOBA 2VTFA 3UJQA 1VBC2 3ZPYA 3O14A 4I0WB 2J1AA 4PIXA 4Q29A 1NG0A 3ZXKA 5A1AA 4ARYA 2WNUC 3M3OA 1PHMA 1SG3A 2RMU3 2ZMLA 4GULA 4OLLA 4XURA 5C8CB 3THDA 1H4HA 2HWF3 1TNRA 3KQ4B 2DV9A 4Y4YA 3AP9A 2ZHMA 5FZEA 5JUVA 2FCTA 3ON7A 4YWAA 4CUAA 3EMRA 3Q8FA 4XBLA 4WM8C 2W91A 2JB4A 2W52A 1M06G 2R061 4NIIA 4MX3A 1BQPA 1RUC1 4V1PA 2XL7A 1GR3A 3CNAA 4QPIA 1URJA 2MEV3 1DLCA 1SFYA 2P3JA 4FOYA 3THTA 2BZDA 3I2OA 1W9TA 2ES3A 4H7LA 5FLJA 4IEZA 4QXHA 2JX9A 1LRHA 2SLIA 2XJVA 2QZ3A 1COV3 1Q8QA 1PMHX 3HNMA 5EV7A 2WYSA 4AL9A 2JDAA 3LB9A 2C9AA 3N7MA 4M3CE 4CCJA 4ZDRA 1JOPA 4PDWA 4BWOA 4XHXA 1WLDA 5J31A 2C26A 4AEDB 4FJ3A 3ILNA 2NPIA 1JZ5A 1LHOA 4GKYA 5D1IA 3HBKA 4AFMA 3IDBB 4QX0A 4OMDA 4Q4W1 4DXRA 4XJUA 3MIGA 2OQ7A 1KU8A 4UFLA 1D4M1 1LENA 1Y3TA 3IAQA 4F7ZA 1EPZA 1WW6A 1UZWA 4KNCA 1BJQA 1OFSA 1IKQA 2CDOA 4IQPA 5EXOA 4BQWA 2ENRA 2QQOA 4CA9A 3S57A 1G9CA 3KVBA 2GTYA 1MVQA 4BIOA 1W03A 1UQXA 3D0JA 1QJU1 3WT3A 1OVPA 1F5JA 1HXS3 4JGYB 2TBVA 5FZDA 3RI8A 4D7SA 3TEZA 1W8ZA 2ZKNA 4DHPA 3CIHA 4L92A 3E6YA 2GP5A 2VCBA 3V0AA 4BQ5A 1BEV2 2MPFA 3M51A 4IERA 3TN92 1JBCA 5A32B 4YG0A 2XWBB 1UX7A 3J7NA 4CPBA 4E9KA 1OBNA 3ZFFA 1LAJA 4CVUA 5B4NA 3ZFEA 2VULA 1U0AA 3ILFA 3WUCA 3ITQA 4RL7A 3SC7X 1BBT2 2F17A 2BOIA 2JJ6A 2W1WA 2WINB 2ZGPA 1VBB3 2A1XA 3MW3A 1M26A 3SMOA 4CDXC 5GZCA 5CVRA 1V00A 2BERA 2YDEA 4JZRA 3TRSB 1QWRA 1W99A 5KWRA 2VQUA 5ABJC 5HCHA 2V73A 5A7PA 2X5IC 2IWGB 5CG9A 1PVC3 1LECA 3P1NA 2VZSA 2XLFA 3D8CA 1PMIA 1PZ8A 1LOGA 3N7JA 5H9SA 4URAA 2RS12 5A1LA 1XJAA 3K75B 2JDYA 1MS0A 4WZFA 4YPJA 2GMEA 5CAZA 5CNAA 5GLZA 3FLTA 3VBHC 2DUOA 1LNSA 2VUJA 5DN2A 3AL6A 5FY5A 3OY8B 2HEWF 1C1LA 4WV8A 5FYZA 2IXLA 3P1RA 1RHI1 3VDDC 2Y33A 3WD5A 3VDBA 2Y38A 4UW6A 2X29A 3GDBA 2WFF1 5LU1A 4IGPA 1AX2A 1HRV2 2ZX1A 2P17A 4ZU5A 4UOJA 2P6HA 4RGGA 1UAIA 1NZIA 4OI4A 3ZR6A 4ASMB 2IZWA 4CCLA 4R9DA 5BNQA 1CAWB 4Q4X1 4MGQA 5J4TA 4OI1A 1WA6X 2D98A 3UKVA 2QQUA 2NZ9A 1RUE3 5JVVA 4QB6A 2V5DA 5C5UA 3U1XA 4XDQA 1QJX1 4W6WA 1YI9A 2EAAA 1HQWA 4SLIA 3VBUB 3GZUC 5KXDA 1AR83 1US2A 3JCIA 5FP7A 5C3RA 4Q27A 4E8DA 1DQ1A 2D6OX 3AKSA 4KU7A 1GV9A 3VZGA 2Z2SB 3NKGA 4QPGA 2DYCA 1ALYA 1IPJA 1APNA 1DLLA 2UWBA 4NHLA 4WVMA 4AI0A 2W2IA 1YC61 2BNOA 1D2QA 2DDUA 4YVWC 4XZPA 1CWPA 1QOOA 2WN3A 1GOHA 4RQPA 4UW3A 4YW6A 5JXIA 1OD5A 2DVGA 5APAA 1X36A 2PAEA 2WNOA 1UPIA 1QNWA 3MIBA 2O14A 2ZX4A 1OD3A 1D7PM 3LDRA 4LPLA 4WM7C 3MYXA 1C8M3 1BXHA 4XC9A 4E8CA 5BNNA 1V6LA 4IV3C 5D2AA 1QJBA 2IXJA 3JD73 4YM0A 3VBSA 2IXCA 3JBG3 3IBMA 2IXIA 4IETA 1DQ0A 5JSOA 1DP0A 2HWE2 1NE6A 2GU9A 1VBC3 2WIIB 3KS7A 5FZCA 2VMEA 4CDQA 4PITA 4C90A 2P3IA 2R1BA 5HBAA 2GC1A 5F2SA 1XXQA 1ND2A 2KR2A 3ZXJA 3GXUA 4NWWA 3NJZA 4PF1A 3N7KA 4NWVA 3I59A 4HK8A 4QQHA 4H7MA 3RZHA 2R041 2E33A 2R7EB 2E6VA 1BZWA 1UH1A 5HI0A 2QNKA 1EAH2 1A34A 2UY9A 2WQ8A 3FC0A 1W04A 4CEYB 1F35A 2HWC2 4DAUA 1DQ5A 5FYBA 3MGUA 5E8AA 3R52A 2XR4A 5H9PA 5DDJ2 1VE0A 1KQRA 4J1XA 2D43A 2WYFA 3NKXA 1S0BA 3LL0A 4Y5Z0 1CJPA 3RZGA 3AFGA 2O8PA 4Y3BA 1BVP1 1QJFA 4QQ2A 5DUWA 1H8TA 1UY2A 2VH9A 3SMMA 2ZAAA 1JS9A 1G9DA 1YI7A 2JE7A 4LBKA 3MDPA 3ZYPA 4AI2A 5LZ6A 4IUGA 2C23A 1JZ8A 1W6QB 5JZGC 2YUEA 3T4VA 3NV3A 1OC1A 1O9CA 2IVJA 3FMGA 3LAGA 4CE8A 4AOCA 1C3NA 2ZACA 3MFCA 3NNLA 1NZCA 3I49A 3AZXA 3WCSA 4FOWA 4GWNA 1Q8OA 3O8IA 5CU1A 2GUCA 5ACA2 1UW8A 1PO12 3FFQA 1YLLA 2QUOA 3RRDA 3VD7A 3KV5A 4BLJA 4AQTA 1E5HA 4XDOA 5CKMA 3WNOA 2Q1FA 5FPZA 2Y6HA 1VMHA 1VBE1 3NJXA 2WS93 3GGLA 4P9XA 4OUSA 2ADEA 1AF9A 1RUI1 2EA7A 4QHZA 4I0AA 5BV6A 2BQ0A 1UIKA 1DQ4A 2JDHA 1ULEA 1H2MA 1MEC2 3O1OA 5LRSA 5CYYA 1YNAA 5FQ0B 5A3TA 2Q30A 3N36A 4O7XA 4BCUA 2B5HA 1JACA 2OQ6A 2J7MA 1O8PA 2W9XA 4DIQA 3CJIB 1RUF1 2ZGNA 5JOZA 4OI0A 1NCRC 5FBZA 2Y60A 1G9AA 4CP2A 3WNXA 4AEMA 2VVFA 3OGSA 3AZWA 3SH3A 3H3ZA 3DPRA 5F1RA 4Y4RA 3ETPA 4A2UA 2PLV2 2JD9A 2VMGA 2ZTNA 3QLQA 1ZRDA 3BTXA 5G04L 1KITA 2EALA 1ULGA 2WT1A 3ZXGA 4D6RA 4QHBA 3T3YA 2BUKA 1B35C 3HT2A 4RSUA 1F5FA 2ZEWA 1YFUA 3AJZA 1W28A 1RXGA 2VTXA 3NMBA 4YM2A 2W3JA 4UW5A 1IS6A 3KT7A 2JD4A 4MXWA 2Z79A 3GM8A 2A71A 4ATEA 1S1AA 4JVAA 4AVBA 4F83A 2WNUB 1A8DA 1ZRIA 2R062 3BTZA 4ZPIA 1MZFA 4Y1UA 3SEEA 1RUC2 1IPSA 1O8SA 3ES1A 2CWSA 3LCPA 2OT7A 5FZAA 3TWIA 3E6CC 1JYTA 1LESA 1Z78A 2IXKA 4CP1A 5J1XA 3AXYC 3BI3A 2VL4A 1CONA 3O44A 4P08A 2O8QA 3WW4A 2VBPA 1I5ZA 4WBBA 5I8TA 5IVCA 2HYRA 2ARCA 4WM8B 4BISA 1XNCA 3VBOB 2PQSA 1H1AA 2ZJCA 4DUWA 5HV0A 2XB6C 5EXAA 1EUUA 5J3UA 4QX1A 1AR72 2GMMA 1RMU2 3UKNA 1AYN1 2WJSA 2YBKA 1AHSA 1W2UA 1KDKA 4KG8A 4M0HA 2OKXA 1HJGA 2CGOA 3B94A 3DN7A 4LUMA 4YGBA 4CDUA 3VLBB 5KXEA 1GWKA 5GZGA 2HWB3 1C5HA 4LKDA 4AAPA 1JUHA 4AGVA 1C1FA 1OQDA 2VE1A 4GWMA 1UOBA 4NHKA 1VAVA 5FFOC 5GZFA 5EWZA 2IFRA 1NXMA 5A6XA 4NIDA 4FR3A 3K48A 4QHOA 4JAAA 5K7PA 3FE5A 1S2XA 1GOFA 1FV2A 2XBO2 1Q8VA 1XNKA 3P1IA 4ZONA 1CD3G 1NY71 1HB2A 1W39A 4J6SA 1O5LA 2HWD2 3DECA 3ELNA 3HN1A 4HKCA 4EZ4A 3P1OA 3TNQA 1N1TA 2DTYA 5L7OA 3PMSA 1RVF2 1LOBA 5A7WA 5T50A 3MF6A 5FPUA 3ZN6A 1MS9A 4DNKA 2Y6GA 4CDWA 2JG8C 4O65A 1UKGA 4RS5A 4LK6A 1ZNPA 3AZVA 1GFF2 3APBA 1OURA 2P6CA 4SBVA 2VQTA 1FV3A 2HWE3 5IK4A 3AL5A 4QPYA 1MS8A 5FZMA 4DQAA 5KR7A 3RPQA 4LBOA 4HN1A 1RC6A 1J1TA 5BYNA 3I2HA 5FYVA 2XVKA 4Q4V3 4UF0B 4R8HA 3WDYA 4XDPA 4RHV2 2WO1A 1F8VA 2A3XA 3SMHA 1HLCA 1SLBA 1W6NA 3E5UA 5FY1A 3I3QA 4D94A 2XJTA 1FYUA 2D3SA 1RL3A 2YG0A 3C7EA 3GJBA 3IT8A 2HEVF 2GZWA 3N9PA 3X29B 4BHPA 5C70A 3SXWA 1AXYA 3AM2A 4W65A 1P8JA 4GH4A 4BQ1A 5FWJA 1OVSA 1V9U3 2B39A 1NCQA 5CB7A 3OD4A 4DS0A 2ZMKA 3LOIA 2XPJA 3PJYA 5GLVA 5FY4A 3PU8A 5D8AA 2P1BA 1E57A 4HETA 3USSA 2ET7A 4HLTA 4DB5A 1LR5A 5DUUA 2NUOA 2HLEA 1J1LA 1CR7A 4XFBA 2D97A 1ULFA 5BNOA 1YO8A 3CMGA 1J3RA 5B2GB 5KC6A 4LNVA 1OQEA 3WP6A 3LW1A 3T0BA 1LHNA 4Q4X2 1JH5A 2R072 4XXAA 1JI6A 4QQOA 4QD2A 4QPIB 3ASIA 1V6MA 3TEYA 3SH4A 2WLQA 3KSCA 1F31A 4M01A 1QJX2 5FRAA 4ZY9A 3VBFA 4UBHA 3P6BA 5AC93 3AMMA 3W20A 5FTTC 1PM7A 2EIEA 5ACA3 1ACCA 5IK5A 1VMJA 4LIVA 5GALA 2WR9A 1Z7S3 5JXJA 3T2PA 5LW9A 1UOJA 1R64A 4Q0VA 1IQAA 2XHNA 5LBEA 2D6KA 1XPWA 4JX0A 4WZCA 3ZSKA 2ZGUA 4I0BA 2K0GA 4JGYC 4N43C 1Y4WA 1S0DA 5C4WA 3J8F1 2WRAA 3RGBA 1RYYA 4A7YA 1DQ6A 3C7HA 1RXFA 2YC2A 1SFPA 1MEC3 1KS5A 2DUQA 1OA4A 1W0NA 2VPVA 2UYBA 2W46A 4GAZA 4LBNA 2TEPA 4P5YA 4PT6A 3TNPB 5C3SA 3ME2A 1EV13 1VBD1 4FL5A 1W6OB 3P5BA 5JXHA 1HIXA 3LA7A 4YVWB 3SKVA 4MO3M 3PTRB 4P9WA 4QX7A 4S2HA 1F9KA 3K4AA 4YGEA 5FYIA 2Q8CA 3B00A 4AKDA 1O9EA 2YXSA 4FFGA 1JYCA 2C9KA 1QNYA 3V0AB 5DZGA 4GALA 3OTFA 4OMCA 3WG4A 2PLV3 1XOYA 4AZZA 4MG2A 3T08A 2WUHA 5CFCA 2Y6KA 3WNLA 3BTAA 3GBWA 4WM7B 4EN9B 4IV3B 4LA3A 5DAVA 3ZFEB 4AHZA 4I2OA 4XUQA 4D7YA 2XL9A 5FKCA 4FPCA 5IAVA 3T0DA 3WV6A 2OW4A 4QMAA 4IEWA 5CZKA 4K40A 3J7LA 4MV2A 2BNNA 5FIXA 4A7KA 1AR92 1GYKA 1Z0HA 2R063 4AI8A 3PUSA 1N3OA 2XLGA 1RUC3 3C3VA 1MACA 3BUCA 3IPVA 3SISA 1OMIA 1U5YA 4XFHA 2VMFA 2DBIA 3VZOA 3AMQA 1W8FA 3WP3A 5A33A 3RZMA 1WMFA 3H8OA 5FZGA 1H2NA 2HJIA 2UURA 1MVEA 3D6EA 1TP8A 1H1MA 3AVSA 2OX0A 1OT5A 4R9BA 4X8NA 2B8MA 2RS51 1JOTA 4S2GA 4IEUA 3AYEA 1X82A 3CQOA 1W6PA 3C7GA 1CIWA 3MIEA 5KHHA 3ZIXA 1VALA 1ZBE1 2LRPA 2MEV2 5FOBB 1D4M3 5FMDA 1WCDJ 2ARAA 4AFDA 1RUD2 3GZAA 4XABA 4E2SA 1YRZA 2XBO3 1AL21 1OOPA 3ACIA 3VBUC 5JLVA 4V2VA 3AP5A 2OPWA 3WSOA 4XJZA 4PLMA 1JMUB 2QQVA 3OB8A 4FPKA 5K0UA 3WR0A 3PMEA 4OUEA 4PQQA 5JZGB 4IEXA 4XIKA 1WLWA 1VBE2 2VCAA 3M3QA 5T5OA 4MOAA 4B7KA 4N7YA 1RVF3 2GN7A 2VECA 1IKPA 3E5QA 2R30A 2QQIA 3BOWA 3B01A 5JMCA 1TNFA 1V0AA 3AXEA 3WW2A 2VZQA 4COWA 4KL1A 3WDUA 4XMAA 2HBTA 3UX0A 3PNAA 4P00B 2VZRA 2AEZA 1NE4A 1OI6A 1ZA7A 5I0TA 3IMNA 1ZZ7A 2XLAA 4AQ2A 1UGYA 1VLNA 3EHKA 2HEYF 1UU6A 4L11A 4RQPB 1DZQA 2O0OA 4HSJA 4C1XA 1CAXA 3B7MA 4ZHNA 2JZ4A 4DHNA 3KF5A 5BNPA 3VBRC 4DUXA 3IIIA 5FBJA 4NRMA 2WO2A 3AYCA 2ZEXA 5K8SA 1ZX5A 2A70A 2ZX2A 3C2UA 4QKDA 4TYSA 4RHV3 1Y7BA 5BNNB 2BWCA 1O3TA 2BTVC 1NCRB 2D6NA 2VNRA 3MW4A 3AMNA 5LU2A 1QXPA 2W68A 2FCUA 2LTNA 1HV0A 3WG1A 2K46A 1SLCA 2GNBA 3CZUA 4PIZA 4CDQB 2VCMA 3U0ZA 4Y1ZA 4BB3A 4CEYC 1ND2B 1SFNA 1U12A 4QGMA 5FDBA 3H42B 1ASJ2 1RIRA 3BGAA 5FLIA 2E51A 5A80A 4A3ZA 1RHI3 3IMMA 5FUPA 4XJWA 4D7TA 4LIUA 4PQ9A 2WFF3 1GBGA 2WZ8A 4XFIA 2VZ1A 3HD8B 1BKZA 3ZO0B 4XOGA 5HPOA 2D40A 4Q1RA 4Z82A 4FQZA 4HMZA 2DUPA 4JDNA 4MYEA 5FK7A 4XIOA 1VB4A 3VHRA 5A3NA 5CA6A 1WCQA 2AC1A 2N7GA 4Q4X3 4XUTA 2WNVC 2R073 3KGZA 2GN3A 3SHRA 4KQ7A 5F7UA 2BNMA 3SMKA 1W6MB 4Y22B 1C57A 1ULCA 3FX3A 5FO9B 4NAMA 1GLHA 2GAUA 1KXGA 1PO21 1QJX3 3CDZB 4XE9A 5JIAA 4CCCA 1UO9A 1Q3EA 3WY6A 4K3UA 2HBUA 1IG3A 1JUIA 1LOFC 1UD1A 1H8TB 4IV1A 1XE8A 3ZN5A 3KZ4C 1A37A 4LO6B 4Z2WA 5LASA 5A3MA 3UGFA 3S5AA 2RS31 2VO5A 2GNTA 1XYNA 4CCEA 5LEJA 3BYWA 2YB7A 3NJYA 2QQPA 2JDZA 2KA3A 5ERLA 1YFWA 3IZOA 4YVSA 4GQ7A 3LSDA 3OBRA 1ULDA 2PHXA 4OCTA 2R0FA 3D82A 1WS4C 2VR4A 4EYUA 1NAEA 1C4RA 4EWEA 1SLLA 3DYOA 1AR82 4FXGB 2JB8A 1J84A 2VM9A 3SLIA 5C5TA 4N7GA 1RJ8A 2WZR2 5IVYA 2EIBA 2XQRA 2XKPA 4GA9A 4XJ9A 1AR62 1CX1A 3X0UA 3JB8A 5FZBA 4DEQA 3WQ7A 3HQRA 3ABZA 3IIAA 1LHVA 1N1YA 2B46X 2WSUA 3O1UA 1CAUA 1CAVA 1XNDA 1L7QA 1AX0A 1VRH2 4QU1A 4DOUA 3ZFGA 4UFJA 2OA2A 1UGWC 4HKOA 1BLZA 1WLTA 2Y8KA 3NW4A 5FO8B 3OGJA 3S7EA 4KMQA 4QM8A 5FZ0A 4BJ0A 4Z2AA 5LHOA 2X53S 4JCKA 2RV9A 4JDOA 4PIUA 4N53C 4KWUA 1OQ1A 5AVAA 5FZ8A 5T5JA 4YLZA 2RHPA 1QF3A 3RDHA 1NA1A 1XSQA 1JTZX 1UYYA 3JBG2 4META 1W2NA 3DPRB 4M3CA 3T1MA 1UY3A 4BIFA 1NUKA 3QH7A 3OPTA 1OSGA 3I54A 1R092 1ZVFA 4IEPA 4AXOA 4IDZA 2ZGQA 5E6HA 4YZ2A 3PVEA 1DYPA 1BMV1 1SCRA 4YW2A 3E1F1 2PYTA 4N8MA 1J4SA 1F15A 4MXWB 3ZOIA 1ENRA 1KEXA 2W47A 3BVCA 3WNKA 2YU2A 3VBOC 1R1A1 1UY1A 3UKTA 5IFPA 4Q0SA 1LGBA 1NXD1 2ID4A 1J4TA 2HYXA 1PGL1 2X10A 4RGKA 3U9XA 5SV8A 1RB8G 5L9RA 4PIFA 2CY6A 4NPRA 3SITA 3P3PA 4KWJA 4UI9L 4COZA 3PDQA 4XJAA 1RUD3 1F4HA 5JWPA 1ZZ6A 1K5JA 3OUIA 3MIHA 3R05A 2WH0A 2ZGTA 5IFTA 3OPWA 5LRRA 3CU8A 4QGNA 3TAYA 1MZEA 2OUJA 4GJYA 2RDQA 3WNNA 4AGRA 5EIYB 1VBE3 2I2SA 3TOWA 5FMCA 5T55A 2LROA 3OJBA 2FHRA 3J8F2 1DIWA 3ZPOA 1UL9A 1YQ6A 2VC9A 2TUNA 2C1FA 1UMHA 2CHHA 1UYZA 5JSPA 5L73A 2JIJA 3AVRA 1W8UA 3LA3A 2FMDA 3EJKA 1UCXA 3MO4A 1CVNA 4Q4Y2 5AV7A 5JM1A 4CP0A 4YSFA 1RUF3 4PIYA 5I0DA 4G4FA 4N43B 1YCIA 4LE3A 3GZTB 1DU3D 1S0FA 4FTBA 3IAPA 2G19A 2CAVA 2E9QA 3GNEA 3ZXFA 2ZKLA 4JTNA 2WS92 1LHUA 4GXLA 4XUPA 2QCSB 5DAPA 2K9ZA 4DXSA 5A7WB 1WBLA 4ZU4A 3BTYA 1VIWB 3ES4A 1REFA 2NM1A 1SPPA 2EICA 2QQLA 3IKWA 2WA4A 1FX5A 2ERFA 3MIFA 5LY1A 4BLIA 1UOGA 4M4PA 3PJQA 4AFCA 4CCNA 2D5FA 3RMXA 5A6ZA 2C63A 2A3YA 3IM0A 1XYPA 3AC0A 4QKNA 3SMNA 3K3OA 3UALA 2I74A 3VKMA 1CZVA 3O1PA 1IB1A 5FPBA 3PUQA 1JXNA 2ADDA 2ETEA 1ASJ3 2FD8A 2IC1A 5FYYA 3O7OA 4ZZ8A 2VMHA 3A7QA 1PIV1 3AKRA 4S2DA 4ES8A 3RYKA 3RZKA 1ZRFA 1UZVA 2YFUA 3DUIA 3U10A 4QT6A 2WABA 3W9AA 4HVOA 3AP7A 2ZX3A 4XFAA 1DYKA 1ZA4A 3OSDA 3B9IA 3I7DA 5IHRA 4HONA 2XDVA 4C91A 2B7YA 3HWJA 2KXLA 2XKOA 1VBPA 2W1SA 3ZXLA 4I3GA 5C33A 4RD7A 1TMF2 4FPFA 1WUVA 2DF7A 4XZUG 4QPIC 4AKBA 3NV4A 1VAKA 1LEMA 4HBNA 1ND3A 4QM9A 2W92A 5BNOB 3CKHA 4HZFA 1V70A 1WKYA 2VBDA 3DXTA 5DUVA 5M0TA 3KMHA 5F74A 5FYTA 1POV1 3UETA 3VHNA 2RM21 4PDWC 1UZYA 1REDA 1HRI2 1O4YA 2YPJA 1KGYA 1FPN1 3I2DA 5KXCA 4YFZA 1XRUA 2PTMA 3AK0A 2HWB2 1W3XA 3VBFB 4E4SA 1DCSA 2BYVE 2ZBJA 3NQHA 4ARXA 4E4ZA 3HAGA 1SDDB 5FYCA 1V6IA 1DGRA 3RJ2X 1JZ6A 1IOAA 2WZR3 3G7DA 5EJ1B 1YWTA 1O3QA 1WCSA 4LLOA 1AR63 1VJ2A 5DMYA 3NSTA 1LKNA 1IS5A 2JDUA 2IUWA 2G9FA 2DURA 3HN3A 3LPFA 4LBQA 3M50A 5C4WB 1Y43B 1UGXA 1ULPA 5IVVA 1OXCA 1VRH3 3HQUA 1JHNA 2XUMA 3T4HB 2EIGA 1KDMA 3AB0A 3AP6A 3EFZA 4YFWA 2DCTA 4XETA 1PX4A 4YW3A 3R4UA 4HVRA 2E32A 1REEA 3ACFA 1D0HA 3D5OA 1T2XA 2GH8A 5TSWA 1K5MA 4I02A 3U14A 1WMDA 3B93A 2VOKA 1M4WA 3QD6A 4CP9B 3ZFFC 3ZFEC 1W8WA 1YFXA 2OXBA 3B3QE 4QB1A 1ZGRA 4Q8KA 5FP8A 2BEOA 2VQ0A 4QDRA 1I3HA 3I2FA 3VBRB 3WF4A 4DY3A 4XF9A 1R093 4YW1A 3PIJA 1X9TA 3OGRA 5C9AA 4P02B 3ENRA 4CU7A 5G05L 1FMD1 1BYHA 1FXZA 4Q4V2 5I8SA 3WXPA 2GNMA 1LEDA 3LIHA 3VKOA 1I9RA 2XJUA 3SP5A 4LEJA 5HXMA 4PCRA 4FPEA 1STMA 3MIUA 1L7RA 1X9PA 2VUDA 4IE7A 4B7EA 1O91A 2VW0A 4WVWA 4B29A 2ZAHA 3HNYM 3Q9OA 1QJY1 2X8KA 4LBJA 1KS4A 4ET7A 4UW4A 1V9U2 2Y6LA 4F7RA 1XE0A 2VW1A 1W8OA 2A6ZA 4GKXA 3R51A 5A33B 4B1LA 2Q5TA 1RUJ1 4R4XA 3LM1A 1O9DA 3O0WA 1R081 5DABA 1A3KA 1FOD2 1GZTA 2JG9A 2WNVB 4OQ8A 2A6YA 1RUH1 3PVNA 4XF0A 3R50A 4W8JA 5JR2A 3OG2A 2NMOA 3U4SA 4E4HA 3K3NA 4DRRA 3WQBA 3BPSA 1AVBA 4GB31 2V09A 1Y9MA 2WL1A 3LDBA 4BXSV 1IGOA 3K51A 3J8F3 3KWVA 3LZZA 3NV1A 4OFGA 3ZKYA 1ZBA2 5IJRA 2VNOA 1IS3A 5FMOL 1ZRCA 3NKTA 2BW8A 3AYDA 4EZHA 1ODMA 2J42A 2PAKA 4WVZA 2RMU1 5AC92 4OVEA 5F6KA 4Q4Y3 1VBD3 4R9CA 5F5QA 4Y5SA 5K0UB 1NX9A 1Z7S2 3H7YA 3WF1A 4D69A 2PA7A 4OUMA 3ZSLA 3MI8A 4QPGC 1GNHA 2CTVA 1YJKA 4QPWA 2L9LA 3DGTA 4P9GA 4RR3A 4DRVA 4RQPC 2ZS6B 2Y64A 5BY5A 3N9LA 5L36A 4LA2A 4L8QA 2AREA 4D8MA 3S0MA 2AZ5A 3ZSJA 1EV12 2Y0IA 5IUQA 2D93A 3S6PA 3H1WA 3ZR5A 2YBPA 4AVSA 5BNNC 1O9FA 1WW5A 4FPYA 4JDMA 4WOGA 3P1SA 3POIA 1PGW1 4DFSA 2VZPA 1QQP1 3KV9A 3CF6E 5FY9A 5FZFA 3ST7A 3VBSC 4L97A 1YHFA 3O1SA 4QDQA 2BBVA 3I4RA 2A75A 3J7HA 3LSEA 3C8XA 4Q8LA 4AVTA 3BPZA 2A6XA 5BNPB 2VVEA 4CDQC 1UKRA 1QJEA 5BY9A 3A23A 4DXZA 1C3MA 3VKLA 1ND2C 1E5SA 1QH6A 1O59A 3KT4A 4H55A 1QU0A 2QVSB 4RA0A 4V2WA 4YGCA 3WX5A 3E6DA 4N53B 1WMXA 2D6LX 3MF9A 2XJRA 1SBFA 2BGPA 5EZWA 4JRAA 3PUHA 2YC0A 4JC1A 1TME1 3ZN4A 1WW4A 2ILMA 5FOJB 4Y24A 1L3JA 2J1UA 2JKXA 2WAAA 3H1YA 4IE0A 1RITA 2IXHA 3POBA 2RS53 1HXS1 3BALA 2CL2A 4JQRA 5KC5A 4OHXA 1TMF3 4AVVA 5A6QA 4N7UA 4R6NA 3JUUA 5L19A 4IEYA 3E97A 2DWRA 1RUNA 4N84A 2G9ZA 2JWPA 5FLHA 2H6BA 2YY1A 4K6BA 2XVGA 5L9BA 2ORZA 3KT1A 3KGLA 4A44A 2ZABA 4EWAA 1H8TC 5C8CA 3H3LA 3RFRA 1MQTA 2NP0A 4YZ3A 5K4LA 1WLCA 1H9WA 2PHWA 1HRI3 4TSVA 3HQXA 4AEKA 1SBDA 4UFMA 4BMEA 1GOGA 2ZHLA 5H9QA 1PNFA 4TZDA 5T5LA 3J7MA 2R0HA 1VBB1 3VD5A 1UN1A 4XAEA 3R0RA 2BRTA 4LHSA 4Q4W2 1JODA 2DTWA 3MW2A 4OHZA 5DG1A 3ZDVA 4CEWA 1D4M2 2GC2A 3I97A 3PU3A 4R4ZA 1UH0A 1W2TA 4NVPA 2BQPA 2EXKA 2VMIA 2ZZJA 3O5SA 3V0BB 4XHBA 1RINA 1PVC1 3BN6A 3RQ0A 3KD4A 1Q5OA 1QJU2 3T2QA 1URXA 2XONA 5JSRA 2LUWA 3B5LB 3NAPA 4AI3A 2E53A 1YYNA 1U5XA 2BPA2 4AEDA 2EAKA 2EIDA 3CL1A 5F8PA 3O1RA 4B4PA 3CJXA 4NO4A 3ZYBA 3TB0A 3H7JA 3ATGA 2OPKA 5FPVA 3FL7A 2E31A 3LKYA 4GJZA 3VDAA 4AI9A 2ZCWA 3QBQA 2ZHNA 3N9NA 3NNMA 4GMP1 3LL1A 3BKZA 2RR11 2I45A 3DYPA 2PHDA 1FT9A 4ZXKA 3KCXA 4CCMA 1DQ2A 3HBZA 4CU6A 5FZIA 1GICA 3DPRC 1W06A 1RUE1 3JQWA 4P9LA 3UZDA 5EFUA 1PIV2 4H3WA 1CX4A 3A0KA 4O61A 1FNZA 3ZN6B 1H1IA 3KB5A 2QTWB 4M3CF 3V64A 5FY0A 5A3LA 3I2JA 2G9GA 3H0OA 5LATA 4ASKA 1ZREA 2BGOA 3HPNA 4Q26A 4RYDA 5B4XA 4COUA 4EE2A 2VOVA 4AGGA 2H0BA 4M3CB 1W9YA 2AUYA 4GX7A 1OPMA 3R6SA 1YUDA 5FCCA 3K2OA 4CU8A 5FXWA 1TEIA 1NYWA 1XNBA 1YFYA 1PO23 3OD0A 1RHI2 1PZ9A 4LBMA 4ZU7A 1QXRA 5AFBA 3V65A 1UWWA 3MHZA 2WFF2 5C3OA 1S2BA 3AJYA 1FOD3 1A8MA 3CHXA 3LKJA 4Z92B 4GMP0 3TEWA 5GM0A 1JN2P 5J98B 2XQXA 2WT0A 1C8M1 1GZWA 2A7AA 1VBA1 4Q0QA 4HL0A 3JD71 1WCKA 3AKQA 1HN0A 3GBFA 1Q43A 4LLFA 5FZ3A 3BU7A 4CDUC 3P1PA 1ZBA3 1UNBA 2VZUA 5JAXA 2ZX0A 3UT0A 4KGGA 1OLQA 1JYNA 5FPAA 1PK6A 2QDRA 1MS5A 2EXJA 4IEOA 4QX8A 4LHKA 1YQCA 4FTSA 4NJ4A 4PDWB 2WBKA 4XF1A 4ITCA 2VAUA 2VOXA 4NUBA 5F6LB 4KU8A 4YZ4A 4LBQD 4LKSA 1SCSA 1OH3A 1W3VA 5IATA 3IQJA 4C0HA 1XNTA 1YQ5A 3R4SA 4AI1A 3I3EA 4JKMA 1WWYA 4JGZA 5L7OC 1VRBA 3KM5A 2JDPA 2W0XA 1DFQA 4MZUA 1OUWA 1N47A 1JYIA 3LDKA 4CDWC 2VTXJ 3WG3A 4PI0A 4RS5C 2WC2A 2CNAA 2DVFA 3ZYRA 2WNEA 1XU2A 1TE1B 2V72A 2K2SA 3SMLA 1MS4A 1VB2A 1S0GA 4Y26A 1XC6A 3INAA 1OUSA 1WS5A 4LR4A 3MZHA 1SPPB 1O6UA 2AYHA 4QXBA 5D3EA 3NJVA 4M4RA 1FMD2 3GHMA 3M4FA 4R52A 4CZSA 4D0QA 2BN0A 3LL2A 1XB9A 1BHGA 1HB4A 1XQNA 3ZFFB 3RNSA 1VPHA 4DMIA 5CBLA 2C4XA 2QZ2A 2R042 1Q8PA 2CYFA 4I01A 4MQ0A 3OOXA 3Q8CA 2DCZA 5LK5A 1C5IA 3B02A 3PHMA 4Z8BA 4JKLA 4IE4A 4LUKA 3ZM8A 2PHTA 4QLIA 5BN6E 5GLTA 1AYM1 3F95A 4GH4C 4UFIA 1AJOA 4Q0PA 4C1WA 1OF4A 3IDAA 1NCQC 4GIQA 1VAMA 1BEV1 3GJAA 3I8TA 3KV6A 4L9BA 4MSVA 3TN91 2WO3A 2QQWA 5D8AC 4BYYA 1R082 4UAPA 3HOBA 3LWCA 3LEGA 3APAA 5BNOC 1QY4A 3RDIA 1RUH2 4QB2A 5JPNB 4HT1T 2ZA9A 1QDCA 4QXKA 1LGCA 5CFDA 3W5NA 5BTVA 2V4AA 3POGA 3KLSA 5GZEA 2KD7A 2Z4FA 3UL2A 2BMZA 2E63A 1SMVA 1BBT1 2OZ6A 4EN6B 2FDFA 2JKBA 4K21A 4FAGA 5L9VA 4FP2A 1HQLA 3HIFA 4Q4W3 1ND3B 4B8EA 3PLQA 4LT5A 4HK9A 1FNYA 3VBFC 3N3HA 1HDKA 3FJSA 3AYAA 4FQ4A 1H6YA 5KBFA 3NWKA 4XQDA 2VQAA 3AMPA 4PLNA 1QJU3 2RS11 1H0BA 4CCKA 4BQXA 3DEMA 2LM3A 4AR2A 5HF3A 5ISLA 5C3PA 4MADA 1CN1A 3N9OA 1RUI2 5C4WC 4LKFA 1TG7A 5FMBA 4R6QA 1W6QA 5FXXA 3IN9A 3MIVA 4NAOA 4PHZA 4ISQA 1XU1A 3DXUA 4YARA 2GUDA 3BCWA 3QCWA 2VUAA 4IEQA 5IYYA 2G1MA 1GMMA 2V4VA 2YBSA 4W6XA 4KWLA 1HRV1 3FFZA 4QPGB 2OS2A 2VOWA 3U07A 4WVMB 3RJRA 2H0VA 5A7QA 1RUF2 4M00A 3IDEA 4DINB 1PGW2 3J26N 3H8RA 3T2TA 4CUBA 1GANA 5FR3A 4FSJA 2B9VA 1X8EA 5IQPA 1GKBA 5FZ9A 5F5CA 4Y3OA 3D0SA 1TVGA 1PIV3 2O1QA 1IQDC 1K5MB 1PMJX 1Y9QA 4FPLA 2YROA 1W05A 4QQLA 3WZ1A 1I5PA 5CFCC 2YHJA 2UYAA 4BQYA 3H8UA 1GUIA 3VBSB 4E2QA 5FQ0A 4DHSA 3MUY1 5E88A 2Y34A 4FPOB 5A3WA 1W0OA 5LCWL 1A4OA 3WINE 3LA2A 3CJIA 2ZHKA 3ZYJB 1QOSA 4CXWA 3JQXA 1GP5A 1TZOA 5FZOA 3RZLA 4LHLA 3WEZA 5JCTA 3I59B 1KJLA 2AENA 4AK4A 2QJVA 3ILRA 2Q0AA 4UYBA 5HCFA 4YW7A 1GWLA 1VP6A 4L99A 4YG6A 2WFPA 5T52A 4A41A 4AVCA 2R1DA 4QX2A 2GMPA 4A45A 3ACHA 1JU4A 5E89A 2RM23 3KCYA 3OUHA 4YM3A 4HFSA 2PHUA 3UNPA 5LA1A 3T0MA 1OLRA 2DVAA 1AYN2 5DZEA 4AYUA 3W5MA 5CEHA 3PVOA 1FPN3 4DZGA 3M3CA 2HWE1 3QOPA 4C8DA 4PLOA 3VZLA 3LLYA 2C6SA 2Q1ZB 2D7FA 1H6XA 1SLTA 2WNUA 4JC3A 3SEPA 3ACGA 1JW6A 4TXWA 2NN8A 2BR9A 4XILA 1UY0A 4HG6B 3VZNA 4GNTA 4XMIA 1FAYA 4HANA 4AE2A 2JG9B 4A7ZA 4CYDA 2AGSA 3WVJA 2LALA 2XMLA 4FFFA 1OOPC 5C6CA 4LO8A 2GH2A 2Q4SA 3VDCA 3CZJA 3MIDA 4PI2A 1NY72 4DNYA 1EAH1 5K0UC 1OLME 4TN7A 4WM8A 4TTGA 3BU0A 4P9IA 1VR3A 1S4CA 1ODNA 4K8FA 2HWC1 5CADA 1W8NA 3PTYA 3WHUA 4Y5IA 2P5BA 3VUOA 4CU9A 5IK7A 1QKQA 3VD4A 2W1QA 5FK8A 1UXXX 5F3EA 1QIQA 5FZ4A 1SACA 4XF4A 4LO5B 1A38A 1F4AA 1LOCA 5DDJ1 3WHTA 4BK5A 1JZ4A 4ZS3A 5LBFA 2OIIA 2WZPP 4S2FA 4Y20A 4R6RA 4AFAA 2PQQA 1YQ8A 3VZEA 2QQNA 3OBAA 2O02A 1UF2C 4HKWA 3ZXAC 3RYRA 1UGYC
chains in the Genus database with same CATH topology
2W94A 2ORXA 1KGYA 1W9WA 5DPNA 3SEEA 1JHJA 3HNBM 3T09A 1O8SA 2W1UA 3NQHA 4ARXA 5FUIA 1SDDB 5J1XA 2VL4A 5EJZB 4P08A 1JZ6A 4DUVA 3HJRA 5EJ1B 3LEIA 3MV11 1JYWA 5DMYA 2PQSA 3I3BA 4DUWA 1W9SA 1EUUA 3C7FA 4QX1A 3HN3A 3LPFA 3K4ZA 1ULPA 4L0PA 4GWIA 2OKXA 5LA2A 5C71A 1PX4A 3LEKA 3HEIA 3ACFA 2E32A 2VZOA 3PUIA 1T2XA 1GOFA 3I2KA 4QB1A 3P1IA 3UESA 3DECA 4QDRA 3WF2A 3LE0A 2VMCA 3I2FA 3WF4A 2ZEZA 3OGRA 4LQRA 4P02B 4ZXEA 4CU7A 5G05L 1K12A 2E26A 5HXMA 2Y6GA 3I3DA 1L7RA 3OEAA 3WF0A 1ULOA 3HNYM 2VQTA 4ET7A 3C7OA 4BK4A 2Y6LA 1W8OA 3I2HA 2WO1A 2YG0A 4W8JA 3C7EA 5JR2A 4GZ9A 3OG2A 2VJXA 4XUNA 5C70A 3WQBA 4BXSV 1P8JA 4A42A 3I2GA 5IJRA 1SHWB 1HN1A 2W5FA 2LS6A 4DXTA 1OH4A 1OF3A 2VOTA 2VZTA 2XOMA 5DQ0A 1DYOA 2DCJA 2HLEA 3WNMA 1NX9A 4QX3A 3WF1A 3CMGA 3MUZ1 3T0BA 4QPWA 1JI6A 2L9LA 2J1SA 2Y64A 1J83A 1K3IA 3LQCA 4ZY9A 3P6BA 2YC4A 4D8MA 1UZ0A 2EIEA 3A22A 1UMIA 5JXJA 3A21A 3T2PA 2VZPA 1R64A 1UXZA 2XHNA 1XPWA 4JX0A 4QDQA 3J7HA 3C8XA 3OEBA 3I2IA 2QBXA 1RYYA 3C7HA 2YC2A 1GU3A 3A23A 1O59A 2JE8A 1K42A 5JXGA 1W0NA 2W46A 4P5YA 4PT6A 4CUCA 1US3A 2BGPA 3PUHA 3SKJE 3FN9A 2W95A 3K4DA 2QQKA 2JKXA 2J1UA 2WAAA 4XUOA 3SKVA 5JXHA 4MO3M 3K4AA 4A6OA 2C9KA 3F2ZA 2VMDA 2J1TA 4OMCA 2VCCA 2YFZA 3T08A 2RJ2A 2WUHA 2Y6KA 3WNLA 3T2OA 2ORZA 1CZSA 4A44A 4XUQA 3U37A 3T0DA 3K77A 1CIYA 4AAXA 5CZKA 1GOGA 2J1EA 4QDSA 3DYMA 3VD5A 3D3AA 2Y6JA 4LHSA 1EUTA 2VMFA 3I97A 3WNPA 3VD3A 3BN6A 1JZ7A 1OT5A 3T2QA 3NNGA 2XONA 2VTFA 3CQOA 2EIDA 2J1AA 3C7GA 5A1AA 4ARYA 1SG3A 3FL7A 2E31A 4XURA 3THDA 1UY4A 3VDAA 3OGVA 3ACIA 3LPGA 5JUVA 4CUAA 3WSOA 3OB8A 3DYPA 4OUEA 2W91A 4PQQA 3FHAA 2VCAA 4CU6A 4MOAA 4ZZ5A 1DLCA 1GNYA 2QQIA 2BZDA 1W9TA 2VZQA 3I2JA 4XVHA 2BGOA 3HNMA 3HPNA 1PMHX 1UYXA 2VZRA 2WYSA 2JDAA 4P00B 4RYDA 2J1VA 5B4XA 1JZ5A 2C26A 4CU8A 4DEVA 4QX0A 4OMDA 4DUXA 4DXRA 3IIIA 2WO2A 3IAQA 1UWWA 2ZEXA 5C7GA 2CDOA 2QQOA 2XQXA 3CZUA 4AG4A 3CIHA 2VCBA 4RN5A 2VZ3A 3BGAA 4A3ZA 2VZUA 2WAOA 5JMOA 1JYNA 3EB7A 2WZ8A 2VZ1A 1JYXA 2WDBA 1UX7A 5HPOA 2WBKA 4CVUA 5B4NA 1WCQA 3IB3A 4MGSA 4XUTA 5F7UA 4LKSA 1XNTA 2W1WA 3I3EA 4JKMA 1PX3A 3CDZB 2BERA 3THCA 1W99A 2VQUA 4W4ZA 2VZSA 2V72A 3K75B 4YPJA 2VO5A 2X09A 2YB7A 1GQPA 2J22A 1LNSA 1XC6A 5DN2A 3NJVA 4M4RA 3VDBA 4D0QA 2VR4A 1BHGA 1NAEA 3GDBA 3DYOA 2C4XA 1J84A 2VM9A 2RVAA 4UOJA 2EIBA 1CX1A 3X0UA 4JKKA 4DEQA 4FI9A 4JKLA 3ABZA 4MGQA 3ZM8A 1L7QA 2J1RA 4QB6A 1OF4A 3IDAA 2V5DA 1JZ3A 2WO3A 2Y8KA 4KMQA 4Z2AA 4BJ0A 1US2A 1JYVA 4UAPA 4E8DA 3HOBA 2RV9A 3LEGA 2WN2A 4KWUA 4QB2A 3W5NA 1UYYA 2KD7A 2Z4FA 1UY3A 2DDUA 1NUKA 3ECQA 2WN3A 1GOHA 5LA0A 3T0AA 3WF3A 5JXIA 1XNAA 1MPXA 3K46A 1K45A 3E1F1 1H6YA 3JXSA 4QAWA 1OD3A 1D7PM 4LPLA 4E8CA 1KEXA 2W47A 3WNKA 1UY1A 5IFPA 1DP0A 3MV01 4MADA 2ID4A 2HYXA 2X10A 2VMEA 1TG7A 2ZXQA 4UI9L 3FHQA 3GXUA 1NKGA 5IYYA 4PF1A 1F4HA 1GMMA 2V4VA 5IFTA 2E33A 2R7EB 4W50A 2WQ8A 3WNNA 4CUBA 2ZEYA 5EIYB 2B9VA 4KI5M 1TVGA 2VC9A 1IQDC 1UMHA 1UYZA 4BDVB 1PMJX 2QQMA 2CDPA 1I5PA 3MO4A 3EYPA 4OYUA 1GUIA 1UY2A 3MUY1 5I0DA 5LCWL 3IAPA 4IUGA 4JHZA 1JZ8A 4XUPA 4DXSA 2WZEA 3WEZA 4OZOA 2EICA 2QQLA 2LW8A 4M4PA 4A41A 4QX2A 4A45A 3ACHA 1JU4A 3VD7A 3UNPA 3AC0A 3WNOA 5LA1A 2BBAA 3W5MA 2Y6HA 1CZVA 1YQ2A 3NJXA 2VZVA 3GGLA 2DCKA 2W87A 1H6XA 1JU3A 3SEPA 3ACGA 3A7QA 4TXWA 1UY0A 4HG6B 2YFUA 5CYYA 2WABA 2J7MA 1O8PA 2W9XA 2X05A 3VDCA 3CZJA 5IHRA 4TTGA 3OGSA 1W8NA 2B4KA 2W1SA 4CU9A 3VD4A 2W1QA 4ZZ8A 3ETPA 1UXXX 1CZTA 1F4AA 4XZUG 2JD9A 1JZ2A 4BK5A 1JZ4A 4GWJA 5G04L 4A4AA 2W92A 3MBWA 3CKHA 3VD9A 2QQJA 1WKYA 3NRUA 2ZEWA 2W3JA 2QQNA 3UETA 3OBAA 3GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W94 A;  2ORX A;  1KGY A;  1W9W A;  5DPN A;  3SEE A;  1JHJ A;  3HNB M;  3T09 A;  1O8S A;  2W1U A;  3NQH A;  4ARX A;  5FUI A;  1SDD B;  5J1X A;  2VL4 A;  5EJZ B;  4P08 A;  1JZ6 A;  4DUV A;  3HJR A;  5EJ1 B;  3LEI A;  3MV1 1;  1JYW A;  5DMY A;  2PQS A;  3I3B A;  4DUW A;  1W9S A;  1EUU A;  3C7F A;  4QX1 A;  3HN3 A;  3LPF A;  3K4Z A;  1ULP A;  4L0P A;  4GWI A;  2OKX A;  5LA2 A;  5C71 A;  1PX4 A;  3LEK A;  3HEI A;  3ACF A;  2E32 A;  2VZO A;  3PUI A;  1T2X A;  1GOF A;  3I2K A;  4QB1 A;  3P1I A;  3UES A;  3DEC A;  4QDR A;  3WF2 A;  3LE0 A;  2VMC A;  3I2F A;  3WF4 A;  2ZEZ A;  3OGR A;  4LQR A;  4P02 B;  4ZXE A;  4CU7 A;  5G05 L;  1K12 A;  2E26 A;  5HXM A;  2Y6G A;  3I3D A;  1L7R A;  3OEA A;  3WF0 A;  1ULO A;  3HNY M;  2VQT A;  4ET7 A;  3C7O A;  4BK4 A;  2Y6L A;  1W8O A;  3I2H A;  2WO1 A;  2YG0 A;  4W8J A;  3C7E A;  5JR2 A;  4GZ9 A;  3OG2 A;  2VJX A;  4XUN A;  5C70 A;  3WQB A;  4BXS V;  1P8J A;  4A42 A;  3I2G A;  5IJR A;  1SHW B;  1HN1 A;  2W5F A;  2LS6 A;  4DXT A;  1OH4 A;  1OF3 A;  2VOT A;  2VZT A;  2XOM A;  5DQ0 A;  1DYO A;  2DCJ A;  2HLE A;  3WNM A;  1NX9 A;  4QX3 A;  3WF1 A;  3CMG A;  3MUZ 1;  3T0B A;  4QPW A;  1JI6 A;  2L9L A;  2J1S A;  2Y64 A;  1J83 A;  1K3I A;  3LQC A;  4ZY9 A;  3P6B A;  2YC4 A;  4D8M A;  1UZ0 A;  2EIE A;  3A22 A;  1UMI A;  5JXJ A;  3A21 A;  3T2P A;  2VZP A;  1R64 A;  1UXZ A;  2XHN A;  1XPW A;  4JX0 A;  4QDQ A;  3J7H A;  3C8X A;  3OEB A;  3I2I A;  2QBX A;  1RYY A;  3C7H A;  2YC2 A;  1GU3 A;  3A23 A;  1O59 A;  2JE8 A;  1K42 A;  5JXG A;  1W0N A;  2W46 A;  4P5Y A;  4PT6 A;  4CUC A;  1US3 A;  2BGP A;  3PUH A;  3SKJ E;  3FN9 A;  2W95 A;  3K4D A;  2QQK A;  2JKX A;  2J1U A;  2WAA A;  4XUO A;  3SKV A;  5JXH A;  4MO3 M;  3K4A A;  4A6O A;  2C9K A;  3F2Z A;  2VMD A;  2J1T A;  4OMC A;  2VCC A;  2YFZ A;  3T08 A;  2RJ2 A;  2WUH A;  2Y6K A;  3WNL A;  3T2O A;  2ORZ A;  1CZS A;  4A44 A;  4XUQ A;  3U37 A;  3T0D A;  3K77 A;  1CIY A;  4AAX A;  5CZK A;  1GOG A;  2J1E A;  4QDS A;  3DYM A;  3VD5 A;  3D3A A;  2Y6J A;  4LHS A;  1EUT A;  2VMF A;  3I97 A;  3WNP A;  3VD3 A;  3BN6 A;  1JZ7 A;  1OT5 A;  3T2Q A;  3NNG A;  2XON A;  2VTF A;  3CQO A;  2EID A;  2J1A A;  3C7G A;  5A1A A;  4ARY A;  1SG3 A;  3FL7 A;  2E31 A;  4XUR A;  3THD A;  1UY4 A;  3VDA A;  3OGV A;  3ACI A;  3LPG A;  5JUV A;  4CUA A;  3WSO A;  3OB8 A;  3DYP A;  4OUE A;  2W91 A;  4PQQ A;  3FHA A;  2VCA A;  4CU6 A;  4MOA A;  4ZZ5 A;  1DLC A;  1GNY A;  2QQI A;  2BZD A;  1W9T A;  2VZQ A;  3I2J A;  4XVH A;  2BGO A;  3HNM A;  3HPN A;  1PMH X;  1UYX A;  2VZR A;  2WYS A;  2JDA A;  4P00 B;  4RYD A;  2J1V A;  5B4X A;  1JZ5 A;  2C26 A;  4CU8 A;  4DEV A;  4QX0 A;  4OMD A;  4DUX A;  4DXR A;  3III A;  2WO2 A;  3IAQ A;  1UWW A;  2ZEX A;  5C7G A;  2CDO A;  2QQO A;  2XQX A;  3CZU A;  4AG4 A;  3CIH A;  2VCB A;  4RN5 A;  2VZ3 A;  3BGA A;  4A3Z A;  2VZU A;  2WAO A;  5JMO A;  1JYN A;  3EB7 A;  2WZ8 A;  2VZ1 A;  1JYX A;  2WDB A;  1UX7 A;  5HPO A;  2WBK A;  4CVU A;  5B4N A;  1WCQ A;  3IB3 A;  4MGS A;  4XUT A;  5F7U A;  4LKS A;  1XNT A;  2W1W A;  3I3E A;  4JKM A;  1PX3 A;  3CDZ B;  2BER A;  3THC A;  1W99 A;  2VQU A;  4W4Z A;  2VZS A;  2V72 A;  3K75 B;  4YPJ A;  2VO5 A;  2X09 A;  2YB7 A;  1GQP A;  2J22 A;  1LNS A;  1XC6 A;  5DN2 A;  3NJV A;  4M4R A;  3VDB A;  4D0Q A;  2VR4 A;  1BHG A;  1NAE A;  3GDB A;  3DYO A;  2C4X A;  1J84 A;  2VM9 A;  2RVA A;  4UOJ A;  2EIB A;  1CX1 A;  3X0U A;  4JKK A;  4DEQ A;  4FI9 A;  4JKL A;  3ABZ A;  4MGQ A;  3ZM8 A;  1L7Q A;  2J1R A;  4QB6 A;  1OF4 A;  3IDA A;  2V5D A;  1JZ3 A;  2WO3 A;  2Y8K A;  4KMQ A;  4Z2A A;  4BJ0 A;  1US2 A;  1JYV A;  4UAP A;  4E8D A;  3HOB A;  2RV9 A;  3LEG A;  2WN2 A;  4KWU A;  4QB2 A;  3W5N A;  1UYY A;  2KD7 A;  2Z4F A;  1UY3 A;  2DDU A;  1NUK A;  3ECQ A;  2WN3 A;  1GOH A;  5LA0 A;  3T0A A;  3WF3 A;  5JXI A;  1XNA A;  1MPX A;  3K46 A;  1K45 A;  3E1F 1;  1H6Y A;  3JXS A;  4QAW A;  1OD3 A;  1D7P M;  4LPL A;  4E8C A;  1KEX A;  2W47 A;  3WNK A;  1UY1 A;  5IFP A;  1DP0 A;  3MV0 1;  4MAD A;  2ID4 A;  2HYX A;  2X10 A;  2VME A;  1TG7 A;  2ZXQ A;  4UI9 L;  3FHQ A;  3GXU A;  1NKG A;  5IYY A;  4PF1 A;  1F4H A;  1GMM A;  2V4V A;  5IFT A;  2E33 A;  2R7E B;  4W50 A;  2WQ8 A;  3WNN A;  4CUB A;  2ZEY A;  5EIY B;  2B9V A;  4KI5 M;  1TVG A;  2VC9 A;  1IQD C;  1UMH A;  1UYZ A;  4BDV B;  1PMJ X;  2QQM A;  2CDP A;  1I5P A;  3MO4 A;  3EYP A;  4OYU A;  1GUI A;  1UY2 A;  3MUY 1;  5I0D A;  5LCW L;  3IAP A;  4IUG A;  4JHZ A;  1JZ8 A;  4XUP A;  4DXS A;  2WZE A;  3WEZ A;  4OZO A;  2EIC A;  2QQL A;  2LW8 A;  4M4P A;  4A41 A;  4QX2 A;  4A45 A;  3ACH A;  1JU4 A;  3VD7 A;  3UNP A;  3AC0 A;  3WNO A;  5LA1 A;  2BBA A;  3W5M A;  2Y6H A;  1CZV A;  1YQ2 A;  3NJX A;  2VZV A;  3GGL A;  2DCK A;  2W87 A;  1H6X A;  1JU3 A;  3SEP A;  3ACG A;  3A7Q A;  4TXW A;  1UY0 A;  4HG6 B;  2YFU A;  5CYY A;  2WAB A;  2J7M A;  1O8P A;  2W9X A;  2X05 A;  3VDC A;  3CZJ A;  5IHR A;  4TTG A;  3OGS A;  1W8N A;  2B4K A;  2W1S A;  4CU9 A;  3VD4 A;  2W1Q A;  4ZZ8 A;  3ETP A;  1UXX X;  1CZT A;  1F4A A;  4XZU G;  2JD9 A;  1JZ2 A;  4BK5 A;  1JZ4 A;  4GWJ A;  5G04 L;  4A4A A;  2W92 A;  3MBW A;  3CKH A;  3VD9 A;  2QQJ A;  1WKY A;  3NRU A;  2ZEW A;  2W3J A;  2QQN A;  3UET A;  3OBA A;  3GM8 A; 
#chains in the Genus database with same CATH topology
 2W94 A;  4XFG A;  2ORX A;  2RJL A;  5F2W A;  1W9W A;  4X6Q B;  3ZSM A;  4TLF A;  1ZZB A;  2DVD A;  3Q8E A;  4EN8 B;  1FMD 3;  3VV1 A;  5BNP C;  5LWB A;  1HB1 A;  5EJZ B;  3V56 A;  4DUV A;  2R04 3;  2VXR A;  3LEI A;  1S0C A;  4FO9 A;  5LVZ A;  2XWJ B;  3MV1 1;  1PO1 1;  5F32 A;  5EWS A;  5FXZ A;  3UGG A;  4IHL A;  5ACA 1;  2XJS A;  1JYW A;  3VZM A;  3C7F A;  1ENQ A;  4K1Z A;  4ONU A;  3WLU A;  2ZZQ A;  4L0P A;  3CLP A;  4MHU A;  2GND A;  4GWI A;  3THP A;  3WOG A;  4DY5 A;  3GHN A;  2R16 A;  2DU1 A;  2QFE A;  2NYY A;  3M2M A;  3VL8 A;  2PHF A;  1MEC 1;  4XF3 A;  3LLZ A;  1OUX A;  4JQT A;  3SCF A;  1R08 3;  2XXZ A;  3WOC A;  1XBF A;  5KHI A;  5LX2 A;  1RUH 3;  2OYZ A;  2PMW B;  2UU8 A;  5HXV A;  5FV3 A;  4CXX A;  2C5D A;  2FZ1 A;  4NRO A;  1VBA 2;  3IQV A;  3HR9 A;  4COY A;  4HOO A;  1RUG 1;  3WF2 A;  3GAL A;  2ZGL A;  3LE0 A;  3POF A;  5DUX A;  4ERO A;  3RZZ A;  4CDX A;  2YV8 A;  2ZGM A;  2PXJ A;  4LKE A;  4LQR A;  1NLQ A;  4ZXE A;  2Q8E A;  5HV4 A;  2PLV 1;  1GP4 A;  1K12 A;  1O5U A;  2E26 A;  4FT8 A;  5F3C A;  4NIH A;  4AQS A;  3ZMN A;  5ABJ A;  4IV1 C;  4IXL A;  2X5I A;  1MQT B;  1UU4 A;  3OGG A;  4OHW A;  2HYK A;  3I3D A;  1IHM A;  1RJ7 A;  2QDN A;  3VZK A;  4CCD A;  1N1V A;  3WF0 A;  5LBB A;  1ULO A;  2ZGS A;  2RG4 A;  1GZC A;  1C3H A;  3QAC A;  4CDU B;  5A7S A;  5J4X A;  4J6G A;  2VBB A;  2WKK A;  3VBH A;  4NR1 A;  3C7O A;  4E2G A;  1RUI 3;  4CEW B;  4IE6 A;  1MS3 A;  4DX0 A;  5GZD A;  3DF0 A;  1WD3 A;  4YVS C;  5A3U A;  3VDD A;  1LB2 A;  1UYP A;  3VGI A;  2WQZ C;  5GKA C;  5FUN A;  1BCX A;  5FZ6 A;  5I0U A;  4DHR A;  4CRQ A;  5CKN A;  4FP3 A;  4K7J A;  1Q56 A;  1VBD 2;  2MNG A;  2D44 A;  5DAW A;  1DZT A;  1NOV A;  2XVL A;  3NAP B;  2JDK A;  1QQP 3;  4N9H A;  1YIF A;  4NMI A;  5KXB A;  5ANN A;  1AR7 1;  2VJX A;  5D21 A;  4UWD A;  1RMU 1;  5L7O B;  3VZF A;  5IVB A;  3M70 A;  5FZ7 A;  3UV9 A;  4E2E A;  1HJF A;  2E7Q A;  3ZFG C;  1GQG A;  1HKD A;  1SHW B;  1HN1 A;  2W5F A;  4KBZ A;  3TEX A;  2DVB A;  3GYD A;  4XFC A;  3VB9 A;  4AF9 A;  2Q8D A;  1TQ5 A;  3WW3 A;  4CDW B;  4DXT A;  4FVV A;  4RS5 B;  2VOT A;  4O46 A;  2XOM A;  3P3N A;  3ZYG A;  3WNM A;  1IG0 A;  1TME 3;  2XBO 1;  3MUZ 1;  5A7O A;  4FPG A;  5KHG A;  3J9S A;  3ZVX A;  4MLO A;  1W6O A;  1NA1 C;  2HWD 1;  4XYX A;  4FCA A;  4YW4 A;  4DPN A;  4NHM A;  5FZL A;  2GC0 A;  4YVW A;  4EN7 B;  4W6Y A;  1AYM 2;  3J4U H;  4YW5 A;  1S2K A;  4NRQ A;  2C0Z A;  5GJ6 A;  4MGY E;  4AKC A;  1J58 A;  1W9F A;  4G9S B;  3ZMO A;  2R32 A;  4YZ5 A;  1T6G C;  2J1S A;  1J83 A;  1RVF 1;  1AJK A;  2AAC A;  5FP4 A;  5A70 A;  1O3R A;  4MGT A;  4Z07 A;  4BQ2 A;  1QJA A;  1W6N B;  4D6S A;  4PIK A;  1TOQ A;  1CPM A;  1UMZ A;  3SCH A;  1DGL A;  4KGQ A;  1DZR A;  4WM7 A;  3EQE A;  1WW7 A;  4IV3 A;  4EJR A;  4GH4 B;  3L2Y A;  4JHT A;  1DDL A;  1UXZ A;  1AYN 3;  2A3W A;  2RDN A;  2JIC A;  2RS5 2;  1NCQ B;  3E6B A;  1QH7 A;  5J37 A;  4TLG A;  5J7M A;  2GUX A;  1YWK A;  5D8A B;  1ZBE 2;  1GU3 A;  2BGC A;  3N35 A;  5JI9 A;  1WME A;  4PBO A;  1LHW A;  5F3G A;  1K42 A;  5C3Q A;  5HCB A;  4Z1V A;  1HX6 A;  1AXK A;  2Y26 A;  3Q8B A;  2GUE A;  3N9Q A;  4K8R B;  4RHV 1;  1AL2 2;  1GZW B;  2W95 A;  2YU1 A;  4X6R B;  1GNZ A;  5JIU A;  1IPK A;  2GDF A;  1H8V A;  4EQV A;  5T54 A;  3UJO A;  4BA6 A;  2QP2 A;  4QGL A;  4OQ9 A;  4A6O A;  5J48 A;  1LUL A;  4J25 A;  5J09 A;  2VCC A;  2C1N A;  1X33 A;  2YFZ A;  1LOD A;  1O4T A;  1PK6 B;  2NLR A;  4HPK A;  4RFT 0;  5EHD A;  5EPA A;  3U78 A;  2NU5 A;  2RJ2 A;  1SLI A;  2BWA A;  4J1W A;  5BXX A;  3URF A;  3ZYF A;  1OKQ A;  2DCY A;  1CZS A;  4COV A;  3U37 A;  4GMP 3;  3A4U A;  2WWU A;  4N9I A;  3K77 A;  2RR1 3;  4XJ8 A;  1CIY A;  4AAX A;  1WA4 A;  2V7D A;  3AFK A;  4E27 A;  5A3P A;  5FP9 A;  2RDR A;  4JV4 A;  2R07 1;  4JGZ B;  2J1E A;  4QDS A;  1BK0 A;  5JZG A;  4U2A A;  3H50 A;  3S5Q A;  5FPL A;  5AFE A;  2YYO A;  3WNP A;  5LA9 A;  5IVJ A;  4FTE A;  4NPM A;  2C24 A;  4H14 A;  4PF5 A;  4QX5 A;  2EXH A;  3GCX A;  5JR7 B;  2BTP A;  1OPO A;  5A6Y A;  1POV 0;  3SCG A;  3VD3 A;  3MEP A;  2P2K A;  1MR5 A;  3T0L A;  3NNG A;  4CTE A;  3POS A;  4QQP A;  3JZV A;  4AHY A;  3IDC B;  2RE9 A;  3DL3 A;  3CEW A;  3MLL A;  3PIG A;  4LHN A;  3USU A;  4CSW A;  2A5Z A;  2Y6F A;  1IS4 A;  1QEX A;  5CFC B;  4NHY A;  3UK9 A;  4AQ6 A;  4DDN A;  3AMH A;  3OYW A;  4XAA A;  4XAC A;  1ZZC A;  2WT2 A;  1S55 A;  5DAX A;  1UY4 A;  5EP9 A;  3H3U A;  3RI9 A;  2FDJ A;  2D5H A;  2Z69 A;  3N7L A;  2UY8 A;  3OGV A;  4LOT A;  3VY7 A;  2D6P A;  3LPG A;  4OUL A;  1VBO A;  1UPS A;  1VBA 3;  1NCR A;  3WCR A;  5BPX A;  2QE3 A;  1W2A X;  3IPV B;  1QMJ A;  2YZ4 A;  4NIG A;  2DBN A;  3FHA A;  4MGK E;  2WLP A;  2ATF A;  2BP6 A;  2XUE A;  2FMY A;  1PO2 2;  4E4D X;  4ZZ5 A;  3S30 A;  2UWC A;  1GNY A;  2ET1 A;  1J4U A;  1ND3 C;  2NPM A;  4LE4 A;  2O8O A;  4XCA A;  1SQ4 A;  4AVA A;  1B35 A;  3M3E A;  2EXI A;  4XVH A;  1UYX A;  1OFN A;  5CFD B;  4HVQ A;  2C74 A;  1S0I A;  2J1V A;  2BFU L;  1YEW A;  3VY6 A;  2RS3 2;  2VNV A;  1ENS A;  5LK7 B;  1W6P B;  3ZXD A;  2VGD A;  5C8W A;  1AR9 1;  4DHM A;  1CES A;  4NPL A;  3DKQ A;  4DEV A;  1O4Z A;  4XBN A;  5GLU A;  1C3K A;  3GCW A;  3LF7 A;  2B05 A;  1W6M A;  4Y22 A;  5CKQ A;  3ORJ A;  3BB6 A;  2NQY A;  3OF1 A;  1AL0 G;  2CGN A;  1OOP B;  4UFK A;  4AHW A;  1Y9G A;  5C7G A;  2HWF 1;  4IW3 A;  2WWJ A;  1HB3 A;  1G9F A;  4MHR A;  2PFW A;  5F3I A;  5FJK A;  3FUQ A;  4XCB A;  4YZ1 A;  2BFU S;  3W21 A;  1AXZ A;  1UU5 A;  2VUC A;  2JDN A;  4DHO A;  3KVA A;  1PZ7 A;  3AKT A;  4AG4 A;  2B9U A;  2W08 A;  3VHO A;  4RN5 A;  3ROU A;  1WCU A;  1ONA A;  2VZ3 A;  3VHP A;  3SPR A;  2WAO A;  2MEV 1;  4NN0 A;  5FMO S;  4BQ4 A;  4AFB A;  5JMO A;  2A6W A;  1RUO A;  5KHJ A;  4O9E A;  5DXD A;  3EB7 A;  1KFU L;  1OA2 A;  4XTM A;  1RUD 1;  3VL9 A;  1JYX A;  2WDB A;  3OBZ A;  1K5M C;  1LOA A;  5K9Y A;  1ST8 A;  1S0E A;  5IW0 A;  1COV 1;  2PHR A;  1DBN A;  3RVH A;  3CQG A;  2FQP A;  3IB3 A;  4MGS A;  4NHX A;  1LCL A;  1SDW A;  1CAX B;  1Q8S A;  2P34 A;  2VVD A;  2RDS A;  4OZX A;  1AYM 3;  4D6Q A;  1UX6 A;  2IFW A;  2TNF A;  1SZB A;  5C9A C;  1PX3 A;  1BEV 3;  5DG2 A;  3TN9 3;  3THC A;  3I3M A;  5J51 A;  2CAU A;  2BVB A;  1UZZ A;  1BMV 2;  3LIG A;  1NT0 A;  4P14 A;  4B1M A;  1POQ A;  3TBD A;  5LEK A;  3M3I A;  4W4Z A;  5FKB A;  1QHD A;  2JG8 A;  5IK8 A;  3LD8 A;  2H6C A;  1H4G A;  1R1A 2;  3WUD A;  1BVV A;  1L7L A;  2OVU A;  3AX4 A;  5FZO B;  4X8P A;  2X09 A;  1RUG 2;  3MPB A;  2ZOE B;  1BBT 3;  1GQP A;  2J22 A;  3O0X A;  3OPZ A;  3WQ0 A;  4DO0 A;  1PGL 2;  5JOX A;  1JOJ A;  1ZBE 3;  3T1L A;  1UIJ A;  3LFM A;  4HKL A;  1LJ7 A;  1G8W A;  2F6B A;  1LOE A;  2FBE A;  2VW2 A;  4LUL A;  3B9C A;  3EXU A;  1N3Q A;  1A6C A;  2WSV A;  4IGQ A;  2CWM A;  4OHV A;  2GAL A;  1VMF A;  3TOJ A;  1J3P A;  1J3Q A;  2RVA A;  1AL2 3;  2JG9 C;  2ARX A;  1KD7 A;  3WOB A;  1AZD A;  2RS1 3;  3KCC A;  4JKK A;  1GSL A;  1SEF A;  1O7F A;  2Z5W A;  4FI9 A;  4GD4 A;  2W39 A;  3H1M A;  5FZK A;  1O3S A;  3ZXE A;  4RGA A;  4UBG A;  4ZKT B;  2J1R A;  5CIR A;  5JDB A;  4IEA A;  1JZ3 A;  1ASJ 1;  4URT A;  4XEZ A;  5IVE A;  4IV1 B;  2BU9 A;  4Q2F A;  3I4I A;  3RSJ A;  1HRV 3;  3IQU A;  4MH0 E;  1JYV A;  3MIT A;  1XXR A;  3MFA A;  4LIT A;  2WN2 A;  4BG6 A;  2E7A A;  1G86 A;  4JDD A;  5IT6 A;  1V6O A;  1S0J A;  1NQJ A;  2E7T A;  5EQU A;  4YVS B;  3M8L A;  2F4L A;  3ECQ A;  1BK1 A;  4RR3 C;  5I93 A;  5LA0 A;  1LTE A;  2BJS A;  4LOS A;  3BIW E;  4I3P A;  5E16 A;  1QOT A;  1SBE A;  3T0A A;  3WF3 A;  4ORF A;  5HCA A;  1XNA A;  4Y20 B;  4BH9 A;  4C0B A;  3POY A;  1MPX A;  5DAQ A;  3K46 A;  1K45 A;  1EYB A;  3JXS A;  4BE3 A;  4QAW A;  3LOB A;  3AKP A;  4IL7 A;  3NO8 A;  5FYM A;  1CAV B;  1CAU B;  1V6N A;  3WW1 A;  2JIG A;  4BU2 A;  3FLR A;  2A6V A;  3Q8A A;  3L9J T;  2WQ4 A;  3ZFG B;  3MV0 1;  4JGY A;  4F3J A;  4DHT A;  3M7A A;  4N43 A;  1PM4 A;  3FBY A;  3KHB A;  4JRL A;  4AW7 A;  4Q5O A;  3ALQ A;  2HYQ A;  2ZXQ A;  1T6B X;  4N90 A;  3FHQ A;  2FDK A;  1NKG A;  1PVX A;  3HVD A;  1MS1 A;  1SLA A;  5FY8 A;  2DFB A;  2YPD A;  4Y5T A;  2I07 B;  1AR8 1;  4CPB D;  5A32 A;  5EXG A;  2WZR 1;  4W50 A;  1NA1 B;  4HXC A;  4KG0 A;  5F5A A;  2Q8O A;  3RWN A;  4IE5 A;  1AR6 1;  3ZDS A;  3P1Q A;  4DAT A;  2JEM A;  2DU0 A;  5IVF A;  2ZEY A;  2BVV A;  2HH9 A;  4XXP A;  3VZJ A;  1PGS A;  1XSR A;  4KI5 M;  1VRH 1;  4LTA A;  3UGH A;  1EY2 A;  3DV8 A;  3H9A A;  4UXA A;  1ZYB A;  1RTV A;  5F37 A;  3GZE A;  4BDV B;  1U5Z A;  2QQM A;  1B09 A;  2CDP A;  2XH6 A;  5JI7 A;  2UWA A;  3UBW A;  2BV4 A;  1X50 A;  3EYP A;  4NE9 A;  4OYU A;  1KJR A;  5C8C C;  5CG8 A;  5CIS A;  1MQT C;  1GQH A;  2RM2 2;  2RS3 3;  1EAH 3;  1H2K A;  3JBG 1;  4Y32 A;  4CDX B;  2HWC 3;  4N7I A;  3POJ A;  4JHZ A;  1FPN 2;  4R9A A;  5JPM B;  3PVB B;  1I1E A;  1VBC 1;  4EWD A;  3BOD A;  5I8Y A;  2GSY A;  1NLS A;  2WZE A;  1R09 1;  5DDJ 3;  5EYX A;  3LEM A;  4DHU A;  2P3K A;  2VNG A;  2P3Y A;  5D3F A;  3OY8 A;  4OZO A;  4B4Q A;  4CEW C;  5ABJ B;  5FYS A;  2X5I B;  1ZZ8 A;  2ZPX A;  5I0R A;  3AXD A;  3SQO A;  5EJ3 A;  1ZGS A;  1C8N A;  5FXV A;  2LW8 A;  2B45 X;  2KM2 A;  4QU2 A;  1UOF A;  4LMF A;  2OZJ A;  3ZYI B;  3AZY A;  3O1M A;  4AK3 A;  1G6N A;  3VBH B;  3MPP G;  5IAX A;  1ZM1 A;  4MGI E;  2BBA A;  1CJD A;  4K9S A;  4YG3 A;  3NAP C;  4FBF A;  3O1T A;  4B3N A;  1YQ2 A;  1CAW A;  2VZV A;  4RFR B;  2DCK A;  4B4R A;  1LGN A;  3VDD B;  2CU5 A;  2W87 A;  2PAM A;  4QWN A;  3VKF C;  4AED C;  1ZZ9 A;  3ZYH A;  1JU3 A;  2A73 B;  1W0P A;  3MLK A;  5F39 A;  2YGL A;  1DGW A;  4BPZ A;  4LJH A;  2P37 A;  4L2N A;  3DKW A;  4FPH A;  3U4X A;  3BOP A;  3AZZ A;  1XYO A;  3VBU A;  1PO1 3;  2D6M A;  3POW A;  5FZH A;  2EF6 A;  1R1Z A;  2X05 A;  1W2O A;  1E5R A;  2PEL A;  4K1Y A;  3OBT A;  1WBF A;  4YRD A;  1OKO A;  2R49 A;  4R6P A;  4Y33 A;  2B4K A;  2XGX A;  2YGM A;  4JTO A;  3WP5 A;  3KHC A;  1OHF A;  5FYH A;  5I0S A;  1CZT A;  4UT5 A;  2D3P A;  2JEC A;  5FRE A;  1JZ2 A;  3RZJ A;  3RS6 A;  4FAH A;  4GWJ A;  4A4A A;  5F9T A;  1D2S A;  2FDH A;  4MXV A;  4LO4 B;  1MZ6 A;  4ZS2 A;  3MBW A;  3OCP A;  1IZ3 A;  3WDW A;  3VD9 A;  2QQJ A;  4LOR A;  3NRU A;  4FPJ A;  2XJQ A;  5J50 A;  2XJP A;  4Q4Y 1;  3DCQ A;  1DG6 A;  3N9M A;  1QXJ A;  3B69 A;  1C28 A;  1QJY 2;  1R1A 3;  4BOW A;  4I30 A;  2D3R A;  4CP9 A;  5F5I A;  1RUG 3;  1QGL A;  5T5P A;  3ZHE B;  2WS9 1;  5DPN A;  1WGP A;  1JHJ A;  3HNB M;  5A7N A;  3MLJ A;  5FYU A;  3T09 A;  4CXY A;  3VBR A;  2W1U A;  2VU9 A;  5FUI A;  2JDM A;  4BXF A;  5JOW A;  4K20 A;  1RUJ 2;  4Q1P A;  1D0G A;  2WWS A;  3FWE A;  1H2L A;  3HJR A;  3TYJ A;  5J96 B;  5JOY A;  3AQG A;  4FOQ A;  3SNM A;  5I91 A;  3I3B A;  2XG3 A;  1W9S A;  1W90 A;  3KV4 A;  3QH6 A;  4P5H A;  4MGZ E;  2ZGR A;  3RG0 A;  1KRI A;  3K4Z A;  4GB3 2;  1LU1 A;  3PUR A;  3FZ3 A;  1XXN A;  4H2A A;  2O98 A;  4Y1V A;  3UYJ A;  2VD7 A;  4CEY A;  3MIC A;  4FXK B;  3AP4 A;  5LA2 A;  5J36 A;  1AUY A;  1XE7 A;  2AEY A;  1YJL A;  5C71 A;  1XEZ A;  2RMU 2;  5BUV A;  3LEK A;  1PK6 C;  3HEI A;  4XPV A;  3O0V A;  2VZO A;  3PUI A;  4YNI A;  5FZ1 A;  4XQW A;  2HWF 2;  5A3O A;  4XQ4 A;  4LO7 A;  2GC3 A;  3I2K A;  5T3N A;  3ZLI A;  3FLP A;  2JEN A;  4ASL A;  3NVC A;  2QKD A;  2YMZ A;  1GP6 A;  3UES A;  2JE9 A;  2WNV A;  1AR7 3;  4U36 A;  4IND A;  4CCO A;  1RMU 3;  2WO7 A;  3CBN A;  3IWZ A;  3NL1 A;  2CGP A;  2VMC A;  2V5Y A;  5IWF A;  4LK7 A;  1YIP A;  3ZKU A;  4HPK B;  1H30 A;  2SBA A;  2BOJ A;  1NQD A;  4PJY A;  1TMF 1;  2ZEZ A;  4JGZ C;  4G3Y C;  4NIA A;  3T30 A;  4D3W A;  1HQN A;  4O9G A;  4EV0 A;  1N1S A;  4Y1X A;  4HSL A;  1LOF A;  4MVT A;  5A1F A;  3ZX7 A;  4AEJ A;  2RJK A;  3OEA A;  1G7Y A;  4KBB A;  1COV 2;  4LBQ B;  4MUV A;  4ISR A;  1QQP 2;  5E1R A;  4BM8 A;  2IVI B;  1CGP A;  2HWD 3;  3WP4 A;  1X8M A;  1HRI 1;  3S7I A;  4BK4 A;  1WS5 C;  3GBG A;  3NNF A;  4Y1Y A;  5AVP A;  1W8T A;  2HWB 1;  3WDV A;  3FUO A;  4EN0 A;  1WS4 A;  1H9P A;  5FPX A;  3P8S A;  3EO6 A;  4IEV A;  5LY2 A;  1N3P A;  3D4K A;  3RYP A;  5D2D A;  1TME 2;  3ACL A;  1F2N A;  5DZF A;  2ZGK A;  3JU9 A;  3PUA A;  3WQ1 A;  4GZ9 A;  3ETQ A;  2B42 B;  4P9J A;  1HXS 2;  4XUN A;  4QKB A;  3G6J B;  4XBQ A;  5C9A B;  3USU B;  5GLW A;  3U75 A;  3RMY A;  4OI2 A;  4P9Y A;  4A42 A;  2Z42 A;  1A78 A;  1OLM A;  1W8H A;  3I2G A;  3WG2 A;  4FFI A;  3GF6 A;  1I6X A;  3OYW B;  1UGW A;  4YYO A;  4AWD A;  1AX1 A;  1DGW X;  2WA3 A;  2LS6 A;  3A0N A;  3ZSE A;  1WZX A;  1GWM A;  2VY0 A;  4NOT A;  2BMY A;  1OH4 A;  1OF3 A;  2CSG A;  2VZT A;  5DQ0 A;  1DYO A;  4ZQ0 A;  1RGS A;  2DCJ A;  3E5X A;  1POV 3;  4N53 A;  4QX3 A;  1QDO A;  4BZ4 A;  3FBM A;  2ZMN A;  2C1J A;  4QKF A;  4F8A A;  1EP0 A;  3VN4 A;  5CFD C;  5FP3 A;  2FCV A;  1YXW A;  1KUJ A;  1U5I A;  2OUH A;  3CQC A;  2CV6 A;  1J59 A;  3ZIW A;  4FFH A;  5LBC A;  1MZ5 A;  4ATF A;  1VBB 2;  3M1H A;  2R6Q A;  2VXJ A;  5FWE A;  3N4M A;  3O1V A;  2FDG A;  1K3I A;  3LQC A;  1D4V B;  1B35 B;  4HN0 A;  3WDT A;  4Q4V 1;  4WRQ A;  2YC4 A;  4OHY A;  1UZ0 A;  3A22 A;  1V6J A;  1PVC 2;  5ANQ A;  4ES9 A;  1UMI A;  3R4D B;  3RWK X;  3A21 A;  3VBO A;  4YGD A;  2AH2 A;  1GZ9 A;  4LBL A;  1HV1 A;  2BDR A;  3OEB A;  3I2I A;  4IGO A;  4XFF A;  1V9U 1;  4FOV A;  1G9B A;  2QBX A;  3HMY A;  2PN5 A;  5SV5 A;  1FI2 A;  2EVX A;  2JE8 A;  5JXG A;  5H9R A;  2G4I A;  4CUC A;  1US3 A;  1ZRR A;  3L2H A;  3KQR A;  1FOD 1;  4NRP A;  3SKJ E;  3FN9 A;  4XTP A;  1EPW A;  2RR1 2;  3K4D A;  4BQ3 A;  2QQK A;  4XUO A;  1QJZ A;  3V0B A;  2P4E A;  5KHK A;  5FY7 A;  1CPN A;  4RR3 B;  5FJH A;  5EYY A;  3U11 A;  4XW3 A;  2FDI A;  3CU7 A;  3F2Z A;  2VMD A;  1FAT A;  2J1T A;  3EBR A;  3LFI A;  3NV2 A;  1RUE 2;  5FAX A;  3WDX A;  3SH5 A;  2FZ2 A;  3H8X A;  1ZBA 1;  3VKN A;  4LXL A;  3PL0 A;  5FO7 B;  4I09 A;  4QXC A;  2XHK A;  1KFX L;  5AC9 1;  4Q0U A;  1DHK B;  3HT1 A;  3T2O A;  2Q1M A;  2VG9 A;  3OUJ A;  3CO2 A;  1ENX A;  1PNG A;  1Z7S 1;  1CQ9 A;  2F4P A;  2MHF A;  1QJY 3;  4KWK A;  4UFH A;  1DGR N;  4YM1 A;  3JB4 C;  1HW5 A;  1WD4 A;  2PHL A;  4AHX A;  3CJI C;  3W59 A;  3DYM A;  4R6O A;  1OA3 A;  2Y0O A;  4DHQ A;  3D3A A;  1LU2 A;  2Y6J A;  1S2E A;  1EUT A;  2AR6 A;  2HKX A;  3LGR A;  3POE A;  4PBP A;  5LB6 A;  4A3X A;  3BIE A;  1RUJ 3;  1VMO A;  1NLR A;  4KH9 A;  4BMB A;  1E5I A;  3NNJ A;  2JG8 B;  2GP3 A;  4UF0 A;  1EV1 1;  2DFC A;  3KF3 A;  3W58 A;  4CUG A;  3FHI B;  1DF0 A;  2JXA A;  4IES A;  3O12 A;  2ARB A;  1X7N A;  1YZ5 A;  1C8M 2;  4A6S A;  1JZ7 A;  1X1V A;  3MHR A;  2NMN A;  4WVV A;  3JD7 2;  2ZGO A;  4M0N A;  4GB3 3;  4TWT A;  1PXD A;  1V6K A;  1AR9 3;  1JOB A;  2VTF A;  3UJQ A;  1VBC 2;  3ZPY A;  3O14 A;  4I0W B;  2J1A A;  4PIX A;  4Q29 A;  1NG0 A;  3ZXK A;  5A1A A;  4ARY A;  2WNU C;  3M3O A;  1PHM A;  1SG3 A;  2RMU 3;  2ZML A;  4GUL A;  4OLL A;  4XUR A;  5C8C B;  3THD A;  1H4H A;  2HWF 3;  1TNR A;  3KQ4 B;  2DV9 A;  4Y4Y A;  3AP9 A;  2ZHM A;  5FZE A;  5JUV A;  2FCT A;  3ON7 A;  4YWA A;  4CUA A;  3EMR A;  3Q8F A;  4XBL A;  4WM8 C;  2W91 A;  2JB4 A;  2W52 A;  1M06 G;  2R06 1;  4NII A;  4MX3 A;  1BQP A;  1RUC 1;  4V1P A;  2XL7 A;  1GR3 A;  3CNA A;  4QPI A;  1URJ A;  2MEV 3;  1DLC A;  1SFY A;  2P3J A;  4FOY A;  3THT A;  2BZD A;  3I2O A;  1W9T A;  2ES3 A;  4H7L A;  5FLJ A;  4IEZ A;  4QXH A;  2JX9 A;  1LRH A;  2SLI A;  2XJV A;  2QZ3 A;  1COV 3;  1Q8Q A;  1PMH X;  3HNM A;  5EV7 A;  2WYS A;  4AL9 A;  2JDA A;  3LB9 A;  2C9A A;  3N7M A;  4M3C E;  4CCJ A;  4ZDR A;  1JOP A;  4PDW A;  4BWO A;  4XHX A;  1WLD A;  5J31 A;  2C26 A;  4AED B;  4FJ3 A;  3ILN A;  2NPI A;  1JZ5 A;  1LHO A;  4GKY A;  5D1I A;  3HBK A;  4AFM A;  3IDB B;  4QX0 A;  4OMD A;  4Q4W 1;  4DXR A;  4XJU A;  3MIG A;  2OQ7 A;  1KU8 A;  4UFL A;  1D4M 1;  1LEN A;  1Y3T A;  3IAQ A;  4F7Z A;  1EPZ A;  1WW6 A;  1UZW A;  4KNC A;  1BJQ A;  1OFS A;  1IKQ A;  2CDO A;  4IQP A;  5EXO A;  4BQW A;  2ENR A;  2QQO A;  4CA9 A;  3S57 A;  1G9C A;  3KVB A;  2GTY A;  1MVQ A;  4BIO A;  1W03 A;  1UQX A;  3D0J A;  1QJU 1;  3WT3 A;  1OVP A;  1F5J A;  1HXS 3;  4JGY B;  2TBV A;  5FZD A;  3RI8 A;  4D7S A;  3TEZ A;  1W8Z A;  2ZKN A;  4DHP A;  3CIH A;  4L92 A;  3E6Y A;  2GP5 A;  2VCB A;  3V0A A;  4BQ5 A;  1BEV 2;  2MPF A;  3M51 A;  4IER A;  3TN9 2;  1JBC A;  5A32 B;  4YG0 A;  2XWB B;  1UX7 A;  3J7N A;  4CPB A;  4E9K A;  1OBN A;  3ZFF A;  1LAJ A;  4CVU A;  5B4N A;  3ZFE A;  2VUL A;  1U0A A;  3ILF A;  3WUC A;  3ITQ A;  4RL7 A;  3SC7 X;  1BBT 2;  2F17 A;  2BOI A;  2JJ6 A;  2W1W A;  2WIN B;  2ZGP A;  1VBB 3;  2A1X A;  3MW3 A;  1M26 A;  3SMO A;  4CDX C;  5GZC A;  5CVR A;  1V00 A;  2BER A;  2YDE A;  4JZR A;  3TRS B;  1QWR A;  1W99 A;  5KWR A;  2VQU A;  5ABJ C;  5HCH A;  2V73 A;  5A7P A;  2X5I C;  2IWG B;  5CG9 A;  1PVC 3;  1LEC A;  3P1N A;  2VZS A;  2XLF A;  3D8C A;  1PMI A;  1PZ8 A;  1LOG A;  3N7J A;  5H9S A;  4URA A;  2RS1 2;  5A1L A;  1XJA A;  3K75 B;  2JDY A;  1MS0 A;  4WZF A;  4YPJ A;  2GME A;  5CAZ A;  5CNA A;  5GLZ A;  3FLT A;  3VBH C;  2DUO A;  1LNS A;  2VUJ A;  5DN2 A;  3AL6 A;  5FY5 A;  3OY8 B;  2HEW F;  1C1L A;  4WV8 A;  5FYZ A;  2IXL A;  3P1R A;  1RHI 1;  3VDD C;  2Y33 A;  3WD5 A;  3VDB A;  2Y38 A;  4UW6 A;  2X29 A;  3GDB A;  2WFF 1;  5LU1 A;  4IGP A;  1AX2 A;  1HRV 2;  2ZX1 A;  2P17 A;  4ZU5 A;  4UOJ A;  2P6H A;  4RGG A;  1UAI A;  1NZI A;  4OI4 A;  3ZR6 A;  4ASM B;  2IZW A;  4CCL A;  4R9D A;  5BNQ A;  1CAW B;  4Q4X 1;  4MGQ A;  5J4T A;  4OI1 A;  1WA6 X;  2D98 A;  3UKV A;  2QQU A;  2NZ9 A;  1RUE 3;  5JVV A;  4QB6 A;  2V5D A;  5C5U A;  3U1X A;  4XDQ A;  1QJX 1;  4W6W A;  1YI9 A;  2EAA A;  1HQW A;  4SLI A;  3VBU B;  3GZU C;  5KXD A;  1AR8 3;  1US2 A;  3JCI A;  5FP7 A;  5C3R A;  4Q27 A;  4E8D A;  1DQ1 A;  2D6O X;  3AKS A;  4KU7 A;  1GV9 A;  3VZG A;  2Z2S B;  3NKG A;  4QPG A;  2DYC A;  1ALY A;  1IPJ A;  1APN A;  1DLL A;  2UWB A;  4NHL A;  4WVM A;  4AI0 A;  2W2I A;  1YC6 1;  2BNO A;  1D2Q A;  2DDU A;  4YVW C;  4XZP A;  1CWP A;  1QOO A;  2WN3 A;  1GOH A;  4RQP A;  4UW3 A;  4YW6 A;  5JXI A;  1OD5 A;  2DVG A;  5APA A;  1X36 A;  2PAE A;  2WNO A;  1UPI A;  1QNW A;  3MIB A;  2O14 A;  2ZX4 A;  1OD3 A;  1D7P M;  3LDR A;  4LPL A;  4WM7 C;  3MYX A;  1C8M 3;  1BXH A;  4XC9 A;  4E8C A;  5BNN A;  1V6L A;  4IV3 C;  5D2A A;  1QJB A;  2IXJ A;  3JD7 3;  4YM0 A;  3VBS A;  2IXC A;  3JBG 3;  3IBM A;  2IXI A;  4IET A;  1DQ0 A;  5JSO A;  1DP0 A;  2HWE 2;  1NE6 A;  2GU9 A;  1VBC 3;  2WII B;  3KS7 A;  5FZC A;  2VME A;  4CDQ A;  4PIT A;  4C90 A;  2P3I A;  2R1B A;  5HBA A;  2GC1 A;  5F2S A;  1XXQ A;  1ND2 A;  2KR2 A;  3ZXJ A;  3GXU A;  4NWW A;  3NJZ A;  4PF1 A;  3N7K A;  4NWV A;  3I59 A;  4HK8 A;  4QQH A;  4H7M A;  3RZH A;  2R04 1;  2E33 A;  2R7E B;  2E6V A;  1BZW A;  1UH1 A;  5HI0 A;  2QNK A;  1EAH 2;  1A34 A;  2UY9 A;  2WQ8 A;  3FC0 A;  1W04 A;  4CEY B;  1F35 A;  2HWC 2;  4DAU A;  1DQ5 A;  5FYB A;  3MGU A;  5E8A A;  3R52 A;  2XR4 A;  5H9P A;  5DDJ 2;  1VE0 A;  1KQR A;  4J1X A;  2D43 A;  2WYF A;  3NKX A;  1S0B A;  3LL0 A;  4Y5Z 0;  1CJP A;  3RZG A;  3AFG A;  2O8P A;  4Y3B A;  1BVP 1;  1QJF A;  4QQ2 A;  5DUW A;  1H8T A;  1UY2 A;  2VH9 A;  3SMM A;  2ZAA A;  1JS9 A;  1G9D A;  1YI7 A;  2JE7 A;  4LBK A;  3MDP A;  3ZYP A;  4AI2 A;  5LZ6 A;  4IUG A;  2C23 A;  1JZ8 A;  1W6Q B;  5JZG C;  2YUE A;  3T4V A;  3NV3 A;  1OC1 A;  1O9C A;  2IVJ A;  3FMG A;  3LAG A;  4CE8 A;  4AOC A;  1C3N A;  2ZAC A;  3MFC A;  3NNL A;  1NZC A;  3I49 A;  3AZX A;  3WCS A;  4FOW A;  4GWN A;  1Q8O A;  3O8I A;  5CU1 A;  2GUC A;  5ACA 2;  1UW8 A;  1PO1 2;  3FFQ A;  1YLL A;  2QUO A;  3RRD A;  3VD7 A;  3KV5 A;  4BLJ A;  4AQT A;  1E5H A;  4XDO A;  5CKM A;  3WNO A;  2Q1F A;  5FPZ A;  2Y6H A;  1VMH A;  1VBE 1;  3NJX A;  2WS9 3;  3GGL A;  4P9X A;  4OUS A;  2ADE A;  1AF9 A;  1RUI 1;  2EA7 A;  4QHZ A;  4I0A A;  5BV6 A;  2BQ0 A;  1UIK A;  1DQ4 A;  2JDH A;  1ULE A;  1H2M A;  1MEC 2;  3O1O A;  5LRS A;  5CYY A;  1YNA A;  5FQ0 B;  5A3T A;  2Q30 A;  3N36 A;  4O7X A;  4BCU A;  2B5H A;  1JAC A;  2OQ6 A;  2J7M A;  1O8P A;  2W9X A;  4DIQ A;  3CJI B;  1RUF 1;  2ZGN A;  5JOZ A;  4OI0 A;  1NCR C;  5FBZ A;  2Y60 A;  1G9A A;  4CP2 A;  3WNX A;  4AEM A;  2VVF A;  3OGS A;  3AZW A;  3SH3 A;  3H3Z A;  3DPR A;  5F1R A;  4Y4R A;  3ETP A;  4A2U A;  2PLV 2;  2JD9 A;  2VMG A;  2ZTN A;  3QLQ A;  1ZRD A;  3BTX A;  5G04 L;  1KIT A;  2EAL A;  1ULG A;  2WT1 A;  3ZXG A;  4D6R A;  4QHB A;  3T3Y A;  2BUK A;  1B35 C;  3HT2 A;  4RSU A;  1F5F A;  2ZEW A;  1YFU A;  3AJZ A;  1W28 A;  1RXG A;  2VTX A;  3NMB A;  4YM2 A;  2W3J A;  4UW5 A;  1IS6 A;  3KT7 A;  2JD4 A;  4MXW A;  2Z79 A;  3GM8 A;  2A71 A;  4ATE A;  1S1A A;  4JVA A;  4AVB A;  4F83 A;  2WNU B;  1A8D A;  1ZRI A;  2R06 2;  3BTZ A;  4ZPI A;  1MZF A;  4Y1U A;  3SEE A;  1RUC 2;  1IPS A;  1O8S A;  3ES1 A;  2CWS A;  3LCP A;  2OT7 A;  5FZA A;  3TWI A;  3E6C C;  1JYT A;  1LES A;  1Z78 A;  2IXK A;  4CP1 A;  5J1X A;  3AXY C;  3BI3 A;  2VL4 A;  1CON A;  3O44 A;  4P08 A;  2O8Q A;  3WW4 A;  2VBP A;  1I5Z A;  4WBB A;  5I8T A;  5IVC A;  2HYR A;  2ARC A;  4WM8 B;  4BIS A;  1XNC A;  3VBO B;  2PQS A;  1H1A A;  2ZJC A;  4DUW A;  5HV0 A;  2XB6 C;  5EXA A;  1EUU A;  5J3U A;  4QX1 A;  1AR7 2;  2GMM A;  1RMU 2;  3UKN A;  1AYN 1;  2WJS A;  2YBK A;  1AHS A;  1W2U A;  1KDK A;  4KG8 A;  4M0H A;  2OKX A;  1HJG A;  2CGO A;  3B94 A;  3DN7 A;  4LUM A;  4YGB A;  4CDU A;  3VLB B;  5KXE A;  1GWK A;  5GZG A;  2HWB 3;  1C5H A;  4LKD A;  4AAP A;  1JUH A;  4AGV A;  1C1F A;  1OQD A;  2VE1 A;  4GWM A;  1UOB A;  4NHK A;  1VAV A;  5FFO C;  5GZF A;  5EWZ A;  2IFR A;  1NXM A;  5A6X A;  4NID A;  4FR3 A;  3K48 A;  4QHO A;  4JAA A;  5K7P A;  3FE5 A;  1S2X A;  1GOF A;  1FV2 A;  2XBO 2;  1Q8V A;  1XNK A;  3P1I A;  4ZON A;  1CD3 G;  1NY7 1;  1HB2 A;  1W39 A;  4J6S A;  1O5L A;  2HWD 2;  3DEC A;  3ELN A;  3HN1 A;  4HKC A;  4EZ4 A;  3P1O A;  3TNQ A;  1N1T A;  2DTY A;  5L7O A;  3PMS A;  1RVF 2;  1LOB A;  5A7W A;  5T50 A;  3MF6 A;  5FPU A;  3ZN6 A;  1MS9 A;  4DNK A;  2Y6G A;  4CDW A;  2JG8 C;  4O65 A;  1UKG A;  4RS5 A;  4LK6 A;  1ZNP A;  3AZV A;  1GFF 2;  3APB A;  1OUR A;  2P6C A;  4SBV A;  2VQT A;  1FV3 A;  2HWE 3;  5IK4 A;  3AL5 A;  4QPY A;  1MS8 A;  5FZM A;  4DQA A;  5KR7 A;  3RPQ A;  4LBO A;  4HN1 A;  1RC6 A;  1J1T A;  5BYN A;  3I2H A;  5FYV A;  2XVK A;  4Q4V 3;  4UF0 B;  4R8H A;  3WDY A;  4XDP A;  4RHV 2;  2WO1 A;  1F8V A;  2A3X A;  3SMH A;  1HLC A;  1SLB A;  1W6N A;  3E5U A;  5FY1 A;  3I3Q A;  4D94 A;  2XJT A;  1FYU A;  2D3S A;  1RL3 A;  2YG0 A;  3C7E A;  3GJB A;  3IT8 A;  2HEV F;  2GZW A;  3N9P A;  3X29 B;  4BHP A;  5C70 A;  3SXW A;  1AXY A;  3AM2 A;  4W65 A;  1P8J A;  4GH4 A;  4BQ1 A;  5FWJ A;  1OVS A;  1V9U 3;  2B39 A;  1NCQ A;  5CB7 A;  3OD4 A;  4DS0 A;  2ZMK A;  3LOI A;  2XPJ A;  3PJY A;  5GLV A;  5FY4 A;  3PU8 A;  5D8A A;  2P1B A;  1E57 A;  4HET A;  3USS A;  2ET7 A;  4HLT A;  4DB5 A;  1LR5 A;  5DUU A;  2NUO A;  2HLE A;  1J1L A;  1CR7 A;  4XFB A;  2D97 A;  1ULF A;  5BNO A;  1YO8 A;  3CMG A;  1J3R A;  5B2G B;  5KC6 A;  4LNV A;  1OQE A;  3WP6 A;  3LW1 A;  3T0B A;  1LHN A;  4Q4X 2;  1JH5 A;  2R07 2;  4XXA A;  1JI6 A;  4QQO A;  4QD2 A;  4QPI B;  3ASI A;  1V6M A;  3TEY A;  3SH4 A;  2WLQ A;  3KSC A;  1F31 A;  4M01 A;  1QJX 2;  5FRA A;  4ZY9 A;  3VBF A;  4UBH A;  3P6B A;  5AC9 3;  3AMM A;  3W20 A;  5FTT C;  1PM7 A;  2EIE A;  5ACA 3;  1ACC A;  5IK5 A;  1VMJ A;  4LIV A;  5GAL A;  2WR9 A;  1Z7S 3;  5JXJ A;  3T2P A;  5LW9 A;  1UOJ A;  1R64 A;  4Q0V A;  1IQA A;  2XHN A;  5LBE A;  2D6K A;  1XPW A;  4JX0 A;  4WZC A;  3ZSK A;  2ZGU A;  4I0B A;  2K0G A;  4JGY C;  4N43 C;  1Y4W A;  1S0D A;  5C4W A;  3J8F 1;  2WRA A;  3RGB A;  1RYY A;  4A7Y A;  1DQ6 A;  3C7H A;  1RXF A;  2YC2 A;  1SFP A;  1MEC 3;  1KS5 A;  2DUQ A;  1OA4 A;  1W0N A;  2VPV A;  2UYB A;  2W46 A;  4GAZ A;  4LBN A;  2TEP A;  4P5Y A;  4PT6 A;  3TNP B;  5C3S A;  3ME2 A;  1EV1 3;  1VBD 1;  4FL5 A;  1W6O B;  3P5B A;  5JXH A;  1HIX A;  3LA7 A;  4YVW B;  3SKV A;  4MO3 M;  3PTR B;  4P9W A;  4QX7 A;  4S2H A;  1F9K A;  3K4A A;  4YGE A;  5FYI A;  2Q8C A;  3B00 A;  4AKD A;  1O9E A;  2YXS A;  4FFG A;  1JYC A;  2C9K A;  1QNY A;  3V0A B;  5DZG A;  4GAL A;  3OTF A;  4OMC A;  3WG4 A;  2PLV 3;  1XOY A;  4AZZ A;  4MG2 A;  3T08 A;  2WUH A;  5CFC A;  2Y6K A;  3WNL A;  3BTA A;  3GBW A;  4WM7 B;  4EN9 B;  4IV3 B;  4LA3 A;  5DAV A;  3ZFE B;  4AHZ A;  4I2O A;  4XUQ A;  4D7Y A;  2XL9 A;  5FKC A;  4FPC A;  5IAV A;  3T0D A;  3WV6 A;  2OW4 A;  4QMA A;  4IEW A;  5CZK A;  4K40 A;  3J7L A;  4MV2 A;  2BNN A;  5FIX A;  4A7K A;  1AR9 2;  1GYK A;  1Z0H A;  2R06 3;  4AI8 A;  3PUS A;  1N3O A;  2XLG A;  1RUC 3;  3C3V A;  1MAC A;  3BUC A;  3IPV A;  3SIS A;  1OMI A;  1U5Y A;  4XFH A;  2VMF A;  2DBI A;  3VZO A;  3AMQ A;  1W8F A;  3WP3 A;  5A33 A;  3RZM A;  1WMF A;  3H8O A;  5FZG A;  1H2N A;  2HJI A;  2UUR A;  1MVE A;  3D6E A;  1TP8 A;  1H1M A;  3AVS A;  2OX0 A;  1OT5 A;  4R9B A;  4X8N A;  2B8M A;  2RS5 1;  1JOT A;  4S2G A;  4IEU A;  3AYE A;  1X82 A;  3CQO A;  1W6P A;  3C7G A;  1CIW A;  3MIE A;  5KHH A;  3ZIX A;  1VAL A;  1ZBE 1;  2LRP A;  2MEV 2;  5FOB B;  1D4M 3;  5FMD A;  1WCD J;  2ARA A;  4AFD A;  1RUD 2;  3GZA A;  4XAB A;  4E2S A;  1YRZ A;  2XBO 3;  1AL2 1;  1OOP A;  3ACI A;  3VBU C;  5JLV A;  4V2V A;  3AP5 A;  2OPW A;  3WSO A;  4XJZ A;  4PLM A;  1JMU B;  2QQV A;  3OB8 A;  4FPK A;  5K0U A;  3WR0 A;  3PME A;  4OUE A;  4PQQ A;  5JZG B;  4IEX A;  4XIK A;  1WLW A;  1VBE 2;  2VCA A;  3M3Q A;  5T5O A;  4MOA A;  4B7K A;  4N7Y A;  1RVF 3;  2GN7 A;  2VEC A;  1IKP A;  3E5Q A;  2R30 A;  2QQI A;  3BOW A;  3B01 A;  5JMC A;  1TNF A;  1V0A A;  3AXE A;  3WW2 A;  2VZQ A;  4COW A;  4KL1 A;  3WDU A;  4XMA A;  2HBT A;  3UX0 A;  3PNA A;  4P00 B;  2VZR A;  2AEZ A;  1NE4 A;  1OI6 A;  1ZA7 A;  5I0T A;  3IMN A;  1ZZ7 A;  2XLA A;  4AQ2 A;  1UGY A;  1VLN A;  3EHK A;  2HEY F;  1UU6 A;  4L11 A;  4RQP B;  1DZQ A;  2O0O A;  4HSJ A;  4C1X A;  1CAX A;  3B7M A;  4ZHN A;  2JZ4 A;  4DHN A;  3KF5 A;  5BNP A;  3VBR C;  4DUX A;  3III A;  5FBJ A;  4NRM A;  2WO2 A;  3AYC A;  2ZEX A;  5K8S A;  1ZX5 A;  2A70 A;  2ZX2 A;  3C2U A;  4QKD A;  4TYS A;  4RHV 3;  1Y7B A;  5BNN B;  2BWC A;  1O3T A;  2BTV C;  1NCR B;  2D6N A;  2VNR A;  3MW4 A;  3AMN A;  5LU2 A;  1QXP A;  2W68 A;  2FCU A;  2LTN A;  1HV0 A;  3WG1 A;  2K46 A;  1SLC A;  2GNB A;  3CZU A;  4PIZ A;  4CDQ B;  2VCM A;  3U0Z A;  4Y1Z A;  4BB3 A;  4CEY C;  1ND2 B;  1SFN A;  1U12 A;  4QGM A;  5FDB A;  3H42 B;  1ASJ 2;  1RIR A;  3BGA A;  5FLI A;  2E51 A;  5A80 A;  4A3Z A;  1RHI 3;  3IMM A;  5FUP A;  4XJW A;  4D7T A;  4LIU A;  4PQ9 A;  2WFF 3;  1GBG A;  2WZ8 A;  4XFI A;  2VZ1 A;  3HD8 B;  1BKZ A;  3ZO0 B;  4XOG A;  5HPO A;  2D40 A;  4Q1R A;  4Z82 A;  4FQZ A;  4HMZ A;  2DUP A;  4JDN A;  4MYE A;  5FK7 A;  4XIO A;  1VB4 A;  3VHR A;  5A3N A;  5CA6 A;  1WCQ A;  2AC1 A;  2N7G A;  4Q4X 3;  4XUT A;  2WNV C;  2R07 3;  3KGZ A;  2GN3 A;  3SHR A;  4KQ7 A;  5F7U A;  2BNM A;  3SMK A;  1W6M B;  4Y22 B;  1C57 A;  1ULC A;  3FX3 A;  5FO9 B;  4NAM A;  1GLH A;  2GAU A;  1KXG A;  1PO2 1;  1QJX 3;  3CDZ B;  4XE9 A;  5JIA A;  4CCC A;  1UO9 A;  1Q3E A;  3WY6 A;  4K3U A;  2HBU A;  1IG3 A;  1JUI A;  1LOF C;  1UD1 A;  1H8T B;  4IV1 A;  1XE8 A;  3ZN5 A;  3KZ4 C;  1A37 A;  4LO6 B;  4Z2W A;  5LAS A;  5A3M A;  3UGF A;  3S5A A;  2RS3 1;  2VO5 A;  2GNT A;  1XYN A;  4CCE A;  5LEJ A;  3BYW A;  2YB7 A;  3NJY A;  2QQP A;  2JDZ A;  2KA3 A;  5ERL A;  1YFW A;  3IZO A;  4YVS A;  4GQ7 A;  3LSD A;  3OBR A;  1ULD A;  2PHX A;  4OCT A;  2R0F A;  3D82 A;  1WS4 C;  2VR4 A;  4EYU A;  1NAE A;  1C4R A;  4EWE A;  1SLL A;  3DYO A;  1AR8 2;  4FXG B;  2JB8 A;  1J84 A;  2VM9 A;  3SLI A;  5C5T A;  4N7G A;  1RJ8 A;  2WZR 2;  5IVY A;  2EIB A;  2XQR A;  2XKP A;  4GA9 A;  4XJ9 A;  1AR6 2;  1CX1 A;  3X0U A;  3JB8 A;  5FZB A;  4DEQ A;  3WQ7 A;  3HQR A;  3ABZ A;  3IIA A;  1LHV A;  1N1Y A;  2B46 X;  2WSU A;  3O1U A;  1CAU A;  1CAV A;  1XND A;  1L7Q A;  1AX0 A;  1VRH 2;  4QU1 A;  4DOU A;  3ZFG A;  4UFJ A;  2OA2 A;  1UGW C;  4HKO A;  1BLZ A;  1WLT A;  2Y8K A;  3NW4 A;  5FO8 B;  3OGJ A;  3S7E A;  4KMQ A;  4QM8 A;  5FZ0 A;  4BJ0 A;  4Z2A A;  5LHO A;  2X53 S;  4JCK A;  2RV9 A;  4JDO A;  4PIU A;  4N53 C;  4KWU A;  1OQ1 A;  5AVA A;  5FZ8 A;  5T5J A;  4YLZ A;  2RHP A;  1QF3 A;  3RDH A;  1NA1 A;  1XSQ A;  1JTZ X;  1UYY A;  3JBG 2;  4MET A;  1W2N A;  3DPR B;  4M3C A;  3T1M A;  1UY3 A;  4BIF A;  1NUK A;  3QH7 A;  3OPT A;  1OSG A;  3I54 A;  1R09 2;  1ZVF A;  4IEP A;  4AXO A;  4IDZ A;  2ZGQ A;  5E6H A;  4YZ2 A;  3PVE A;  1DYP A;  1BMV 1;  1SCR A;  4YW2 A;  3E1F 1;  2PYT A;  4N8M A;  1J4S A;  1F15 A;  4MXW B;  3ZOI A;  1ENR A;  1KEX A;  2W47 A;  3BVC A;  3WNK A;  2YU2 A;  3VBO C;  1R1A 1;  1UY1 A;  3UKT A;  5IFP A;  4Q0S A;  1LGB A;  1NXD 1;  2ID4 A;  1J4T A;  2HYX A;  1PGL 1;  2X10 A;  4RGK A;  3U9X A;  5SV8 A;  1RB8 G;  5L9R A;  4PIF A;  2CY6 A;  4NPR A;  3SIT A;  3P3P A;  4KWJ A;  4UI9 L;  4COZ A;  3PDQ A;  4XJA A;  1RUD 3;  1F4H A;  5JWP A;  1ZZ6 A;  1K5J A;  3OUI A;  3MIH A;  3R05 A;  2WH0 A;  2ZGT A;  5IFT A;  3OPW A;  5LRR A;  3CU8 A;  4QGN A;  3TAY A;  1MZE A;  2OUJ A;  4GJY A;  2RDQ A;  3WNN A;  4AGR A;  5EIY B;  1VBE 3;  2I2S A;  3TOW A;  5FMC A;  5T55 A;  2LRO A;  3OJB A;  2FHR A;  3J8F 2;  1DIW A;  3ZPO A;  1UL9 A;  1YQ6 A;  2VC9 A;  2TUN A;  2C1F A;  1UMH A;  2CHH A;  1UYZ A;  5JSP A;  5L73 A;  2JIJ A;  3AVR A;  1W8U A;  3LA3 A;  2FMD A;  3EJK A;  1UCX A;  3MO4 A;  1CVN A;  4Q4Y 2;  5AV7 A;  5JM1 A;  4CP0 A;  4YSF A;  1RUF 3;  4PIY A;  5I0D A;  4G4F A;  4N43 B;  1YCI A;  4LE3 A;  3GZT B;  1DU3 D;  1S0F A;  4FTB A;  3IAP A;  2G19 A;  2CAV A;  2E9Q A;  3GNE A;  3ZXF A;  2ZKL A;  4JTN A;  2WS9 2;  1LHU A;  4GXL A;  4XUP A;  2QCS B;  5DAP A;  2K9Z A;  4DXS A;  5A7W B;  1WBL A;  4ZU4 A;  3BTY A;  1VIW B;  3ES4 A;  1REF A;  2NM1 A;  1SPP A;  2EIC A;  2QQL A;  3IKW A;  2WA4 A;  1FX5 A;  2ERF A;  3MIF A;  5LY1 A;  4BLI A;  1UOG A;  4M4P A;  3PJQ A;  4AFC A;  4CCN A;  2D5F A;  3RMX A;  5A6Z A;  2C63 A;  2A3Y A;  3IM0 A;  1XYP A;  3AC0 A;  4QKN A;  3SMN A;  3K3O A;  3UAL A;  2I74 A;  3VKM A;  1CZV A;  3O1P A;  1IB1 A;  5FPB A;  3PUQ A;  1JXN A;  2ADD A;  2ETE A;  1ASJ 3;  2FD8 A;  2IC1 A;  5FYY A;  3O7O A;  4ZZ8 A;  2VMH A;  3A7Q A;  1PIV 1;  3AKR A;  4S2D A;  4ES8 A;  3RYK A;  3RZK A;  1ZRF A;  1UZV A;  2YFU A;  3DUI A;  3U10 A;  4QT6 A;  2WAB A;  3W9A A;  4HVO A;  3AP7 A;  2ZX3 A;  4XFA A;  1DYK A;  1ZA4 A;  3OSD A;  3B9I A;  3I7D A;  5IHR A;  4HON A;  2XDV A;  4C91 A;  2B7Y A;  3HWJ A;  2KXL A;  2XKO A;  1VBP A;  2W1S A;  3ZXL A;  4I3G A;  5C33 A;  4RD7 A;  1TMF 2;  4FPF A;  1WUV A;  2DF7 A;  4XZU G;  4QPI C;  4AKB A;  3NV4 A;  1VAK A;  1LEM A;  4HBN A;  1ND3 A;  4QM9 A;  2W92 A;  5BNO B;  3CKH A;  4HZF A;  1V70 A;  1WKY A;  2VBD A;  3DXT A;  5DUV A;  5M0T A;  3KMH A;  5F74 A;  5FYT A;  1POV 1;  3UET A;  3VHN A;  2RM2 1;  4PDW C;  1UZY A;  1RED A;  1HRI 2;  1O4Y A;  2YPJ A;  1KGY A;  1FPN 1;  3I2D A;  5KXC A;  4YFZ A;  1XRU A;  2PTM A;  3AK0 A;  2HWB 2;  1W3X A;  3VBF B;  4E4S A;  1DCS A;  2BYV E;  2ZBJ A;  3NQH A;  4ARX A;  4E4Z A;  3HAG A;  1SDD B;  5FYC A;  1V6I A;  1DGR A;  3RJ2 X;  1JZ6 A;  1IOA A;  2WZR 3;  3G7D A;  5EJ1 B;  1YWT A;  1O3Q A;  1WCS A;  4LLO A;  1AR6 3;  1VJ2 A;  5DMY A;  3NST A;  1LKN A;  1IS5 A;  2JDU A;  2IUW A;  2G9F A;  2DUR A;  3HN3 A;  3LPF A;  4LBQ A;  3M50 A;  5C4W B;  1Y43 B;  1UGX A;  1ULP A;  5IVV A;  1OXC A;  1VRH 3;  3HQU A;  1JHN A;  2XUM A;  3T4H B;  2EIG A;  1KDM A;  3AB0 A;  3AP6 A;  3EFZ A;  4YFW A;  2DCT A;  4XET A;  1PX4 A;  4YW3 A;  3R4U A;  4HVR A;  2E32 A;  1REE A;  3ACF A;  1D0H A;  3D5O A;  1T2X A;  2GH8 A;  5TSW A;  1K5M A;  4I02 A;  3U14 A;  1WMD A;  3B93 A;  2VOK A;  1M4W A;  3QD6 A;  4CP9 B;  3ZFF C;  3ZFE C;  1W8W A;  1YFX A;  2OXB A;  3B3Q E;  4QB1 A;  1ZGR A;  4Q8K A;  5FP8 A;  2BEO A;  2VQ0 A;  4QDR A;  1I3H A;  3I2F A;  3VBR B;  3WF4 A;  4DY3 A;  4XF9 A;  1R09 3;  4YW1 A;  3PIJ A;  1X9T A;  3OGR A;  5C9A A;  4P02 B;  3ENR A;  4CU7 A;  5G05 L;  1FMD 1;  1BYH A;  1FXZ A;  4Q4V 2;  5I8S A;  3WXP A;  2GNM A;  1LED A;  3LIH A;  3VKO A;  1I9R A;  2XJU A;  3SP5 A;  4LEJ A;  5HXM A;  4PCR A;  4FPE A;  1STM A;  3MIU A;  1L7R A;  1X9P A;  2VUD A;  4IE7 A;  4B7E A;  1O91 A;  2VW0 A;  4WVW A;  4B29 A;  2ZAH A;  3HNY M;  3Q9O A;  1QJY 1;  2X8K A;  4LBJ A;  1KS4 A;  4ET7 A;  4UW4 A;  1V9U 2;  2Y6L A;  4F7R A;  1XE0 A;  2VW1 A;  1W8O A;  2A6Z A;  4GKX A;  3R51 A;  5A33 B;  4B1L A;  2Q5T A;  1RUJ 1;  4R4X A;  3LM1 A;  1O9D A;  3O0W A;  1R08 1;  5DAB A;  1A3K A;  1FOD 2;  1GZT A;  2JG9 A;  2WNV B;  4OQ8 A;  2A6Y A;  1RUH 1;  3PVN A;  4XF0 A;  3R50 A;  4W8J A;  5JR2 A;  3OG2 A;  2NMO A;  3U4S A;  4E4H A;  3K3N A;  4DRR A;  3WQB A;  3BPS A;  1AVB A;  4GB3 1;  2V09 A;  1Y9M A;  2WL1 A;  3LDB A;  4BXS V;  1IGO A;  3K51 A;  3J8F 3;  3KWV A;  3LZZ A;  3NV1 A;  4OFG A;  3ZKY A;  1ZBA 2;  5IJR A;  2VNO A;  1IS3 A;  5FMO L;  1ZRC A;  3NKT A;  2BW8 A;  3AYD A;  4EZH A;  1ODM A;  2J42 A;  2PAK A;  4WVZ A;  2RMU 1;  5AC9 2;  4OVE A;  5F6K A;  4Q4Y 3;  1VBD 3;  4R9C A;  5F5Q A;  4Y5S A;  5K0U B;  1NX9 A;  1Z7S 2;  3H7Y A;  3WF1 A;  4D69 A;  2PA7 A;  4OUM A;  3ZSL A;  3MI8 A;  4QPG C;  1GNH A;  2CTV A;  1YJK A;  4QPW A;  2L9L A;  3DGT A;  4P9G A;  4RR3 A;  4DRV A;  4RQP C;  2ZS6 B;  2Y64 A;  5BY5 A;  3N9L A;  5L36 A;  4LA2 A;  4L8Q A;  2ARE A;  4D8M A;  3S0M A;  2AZ5 A;  3ZSJ A;  1EV1 2;  2Y0I A;  5IUQ A;  2D93 A;  3S6P A;  3H1W A;  3ZR5 A;  2YBP A;  4AVS A;  5BNN C;  1O9F A;  1WW5 A;  4FPY A;  4JDM A;  4WOG A;  3P1S A;  3POI A;  1PGW 1;  4DFS A;  2VZP A;  1QQP 1;  3KV9 A;  3CF6 E;  5FY9 A;  5FZF A;  3ST7 A;  3VBS C;  4L97 A;  1YHF A;  3O1S A;  4QDQ A;  2BBV A;  3I4R A;  2A75 A;  3J7H A;  3LSE A;  3C8X A;  4Q8L A;  4AVT A;  3BPZ A;  2A6X A;  5BNP B;  2VVE A;  4CDQ C;  1UKR A;  1QJE A;  5BY9 A;  3A23 A;  4DXZ A;  1C3M A;  3VKL A;  1ND2 C;  1E5S A;  1QH6 A;  1O59 A;  3KT4 A;  4H55 A;  1QU0 A;  2QVS B;  4RA0 A;  4V2W A;  4YGC A;  3WX5 A;  3E6D A;  4N53 B;  1WMX A;  2D6L X;  3MF9 A;  2XJR A;  1SBF A;  2BGP A;  5EZW A;  4JRA A;  3PUH A;  2YC0 A;  4JC1 A;  1TME 1;  3ZN4 A;  1WW4 A;  2ILM A;  5FOJ B;  4Y24 A;  1L3J A;  2J1U A;  2JKX A;  2WAA A;  3H1Y A;  4IE0 A;  1RIT A;  2IXH A;  3POB A;  2RS5 3;  1HXS 1;  3BAL A;  2CL2 A;  4JQR A;  5KC5 A;  4OHX A;  1TMF 3;  4AVV A;  5A6Q A;  4N7U A;  4R6N A;  3JUU A;  5L19 A;  4IEY A;  3E97 A;  2DWR A;  1RUN A;  4N84 A;  2G9Z A;  2JWP A;  5FLH A;  2H6B A;  2YY1 A;  4K6B A;  2XVG A;  5L9B A;  2ORZ A;  3KT1 A;  3KGL A;  4A44 A;  2ZAB A;  4EWA A;  1H8T C;  5C8C A;  3H3L A;  3RFR A;  1MQT A;  2NP0 A;  4YZ3 A;  5K4L A;  1WLC A;  1H9W A;  2PHW A;  1HRI 3;  4TSV A;  3HQX A;  4AEK A;  1SBD A;  4UFM A;  4BME A;  1GOG A;  2ZHL A;  5H9Q A;  1PNF A;  4TZD A;  5T5L A;  3J7M A;  2R0H A;  1VBB 1;  3VD5 A;  1UN1 A;  4XAE A;  3R0R A;  2BRT A;  4LHS A;  4Q4W 2;  1JOD A;  2DTW A;  3MW2 A;  4OHZ A;  5DG1 A;  3ZDV A;  4CEW A;  1D4M 2;  2GC2 A;  3I97 A;  3PU3 A;  4R4Z A;  1UH0 A;  1W2T A;  4NVP A;  2BQP A;  2EXK A;  2VMI A;  2ZZJ A;  3O5S A;  3V0B B;  4XHB A;  1RIN A;  1PVC 1;  3BN6 A;  3RQ0 A;  3KD4 A;  1Q5O A;  1QJU 2;  3T2Q A;  1URX A;  2XON A;  5JSR A;  2LUW A;  3B5L B;  3NAP A;  4AI3 A;  2E53 A;  1YYN A;  1U5X A;  2BPA 2;  4AED A;  2EAK A;  2EID A;  3CL1 A;  5F8P A;  3O1R A;  4B4P A;  3CJX A;  4NO4 A;  3ZYB A;  3TB0 A;  3H7J A;  3ATG A;  2OPK A;  5FPV A;  3FL7 A;  2E31 A;  3LKY A;  4GJZ A;  3VDA A;  4AI9 A;  2ZCW A;  3QBQ A;  2ZHN A;  3N9N A;  3NNM A;  4GMP 1;  3LL1 A;  3BKZ A;  2RR1 1;  2I45 A;  3DYP A;  2PHD A;  1FT9 A;  4ZXK A;  3KCX A;  4CCM A;  1DQ2 A;  3HBZ A;  4CU6 A;  5FZI A;  1GIC A;  3DPR C;  1W06 A;  1RUE 1;  3JQW A;  4P9L A;  3UZD A;  5EFU A;  1PIV 2;  4H3W A;  1CX4 A;  3A0K A;  4O61 A;  1FNZ A;  3ZN6 B;  1H1I A;  3KB5 A;  2QTW B;  4M3C F;  3V64 A;  5FY0 A;  5A3L A;  3I2J A;  2G9G A;  3H0O A;  5LAT A;  4ASK A;  1ZRE A;  2BGO A;  3HPN A;  4Q26 A;  4RYD A;  5B4X A;  4COU A;  4EE2 A;  2VOV A;  4AGG A;  2H0B A;  4M3C B;  1W9Y A;  2AUY A;  4GX7 A;  1OPM A;  3R6S A;  1YUD A;  5FCC A;  3K2O A;  4CU8 A;  5FXW A;  1TEI A;  1NYW A;  1XNB A;  1YFY A;  1PO2 3;  3OD0 A;  1RHI 2;  1PZ9 A;  4LBM A;  4ZU7 A;  1QXR A;  5AFB A;  3V65 A;  1UWW A;  3MHZ A;  2WFF 2;  5C3O A;  1S2B A;  3AJY A;  1FOD 3;  1A8M A;  3CHX A;  3LKJ A;  4Z92 B;  4GMP 0;  3TEW A;  5GM0 A;  1JN2 P;  5J98 B;  2XQX A;  2WT0 A;  1C8M 1;  1GZW A;  2A7A A;  1VBA 1;  4Q0Q A;  4HL0 A;  3JD7 1;  1WCK A;  3AKQ A;  1HN0 A;  3GBF A;  1Q43 A;  4LLF A;  5FZ3 A;  3BU7 A;  4CDU C;  3P1P A;  1ZBA 3;  1UNB A;  2VZU A;  5JAX A;  2ZX0 A;  3UT0 A;  4KGG A;  1OLQ A;  1JYN A;  5FPA A;  1PK6 A;  2QDR A;  1MS5 A;  2EXJ A;  4IEO A;  4QX8 A;  4LHK A;  1YQC A;  4FTS A;  4NJ4 A;  4PDW B;  2WBK A;  4XF1 A;  4ITC A;  2VAU A;  2VOX A;  4NUB A;  5F6L B;  4KU8 A;  4YZ4 A;  4LBQ D;  4LKS A;  1SCS A;  1OH3 A;  1W3V A;  5IAT A;  3IQJ A;  4C0H A;  1XNT A;  1YQ5 A;  3R4S A;  4AI1 A;  3I3E A;  4JKM A;  1WWY A;  4JGZ A;  5L7O C;  1VRB A;  3KM5 A;  2JDP A;  2W0X A;  1DFQ A;  4MZU A;  1OUW A;  1N47 A;  1JYI A;  3LDK A;  4CDW C;  2VTX J;  3WG3 A;  4PI0 A;  4RS5 C;  2WC2 A;  2CNA A;  2DVF A;  3ZYR A;  2WNE A;  1XU2 A;  1TE1 B;  2V72 A;  2K2S A;  3SML A;  1MS4 A;  1VB2 A;  1S0G A;  4Y26 A;  1XC6 A;  3INA A;  1OUS A;  1WS5 A;  4LR4 A;  3MZH A;  1SPP B;  1O6U A;  2AYH A;  4QXB A;  5D3E A;  3NJV A;  4M4R A;  1FMD 2;  3GHM A;  3M4F A;  4R52 A;  4CZS A;  4D0Q A;  2BN0 A;  3LL2 A;  1XB9 A;  1BHG A;  1HB4 A;  1XQN A;  3ZFF B;  3RNS A;  1VPH A;  4DMI A;  5CBL A;  2C4X A;  2QZ2 A;  2R04 2;  1Q8P A;  2CYF A;  4I01 A;  4MQ0 A;  3OOX A;  3Q8C A;  2DCZ A;  5LK5 A;  1C5I A;  3B02 A;  3PHM A;  4Z8B A;  4JKL A;  4IE4 A;  4LUK A;  3ZM8 A;  2PHT A;  4QLI A;  5BN6 E;  5GLT A;  1AYM 1;  3F95 A;  4GH4 C;  4UFI A;  1AJO A;  4Q0P A;  4C1W A;  1OF4 A;  3IDA A;  1NCQ C;  4GIQ A;  1VAM A;  1BEV 1;  3GJA A;  3I8T A;  3KV6 A;  4L9B A;  4MSV A;  3TN9 1;  2WO3 A;  2QQW A;  5D8A C;  4BYY A;  1R08 2;  4UAP A;  3HOB A;  3LWC A;  3LEG A;  3APA A;  5BNO C;  1QY4 A;  3RDI A;  1RUH 2;  4QB2 A;  5JPN B;  4HT1 T;  2ZA9 A;  1QDC A;  4QXK A;  1LGC A;  5CFD A;  3W5N A;  5BTV A;  2V4A A;  3POG A;  3KLS A;  5GZE A;  2KD7 A;  2Z4F A;  3UL2 A;  2BMZ A;  2E63 A;  1SMV A;  1BBT 1;  2OZ6 A;  4EN6 B;  2FDF A;  2JKB A;  4K21 A;  4FAG A;  5L9V A;  4FP2 A;  1HQL A;  3HIF A;  4Q4W 3;  1ND3 B;  4B8E A;  3PLQ A;  4LT5 A;  4HK9 A;  1FNY A;  3VBF C;  3N3H A;  1HDK A;  3FJS A;  3AYA A;  4FQ4 A;  1H6Y A;  5KBF A;  3NWK A;  4XQD A;  2VQA A;  3AMP A;  4PLN A;  1QJU 3;  2RS1 1;  1H0B A;  4CCK A;  4BQX A;  3DEM A;  2LM3 A;  4AR2 A;  5HF3 A;  5ISL A;  5C3P A;  4MAD A;  1CN1 A;  3N9O A;  1RUI 2;  5C4W C;  4LKF A;  1TG7 A;  5FMB A;  4R6Q A;  1W6Q A;  5FXX A;  3IN9 A;  3MIV A;  4NAO A;  4PHZ A;  4ISQ A;  1XU1 A;  3DXU A;  4YAR A;  2GUD A;  3BCW A;  3QCW A;  2VUA A;  4IEQ A;  5IYY A;  2G1M A;  1GMM A;  2V4V A;  2YBS A;  4W6X A;  4KWL A;  1HRV 1;  3FFZ A;  4QPG B;  2OS2 A;  2VOW A;  3U07 A;  4WVM B;  3RJR A;  2H0V A;  5A7Q A;  1RUF 2;  4M00 A;  3IDE A;  4DIN B;  1PGW 2;  3J26 N;  3H8R A;  3T2T A;  4CUB A;  1GAN A;  5FR3 A;  4FSJ A;  2B9V A;  1X8E A;  5IQP A;  1GKB A;  5FZ9 A;  5F5C A;  4Y3O A;  3D0S A;  1TVG A;  1PIV 3;  2O1Q A;  1IQD C;  1K5M B;  1PMJ X;  1Y9Q A;  4FPL A;  2YRO A;  1W05 A;  4QQL A;  3WZ1 A;  1I5P A;  5CFC C;  2YHJ A;  2UYA A;  4BQY A;  3H8U A;  1GUI A;  3VBS B;  4E2Q A;  5FQ0 A;  4DHS A;  3MUY 1;  5E88 A;  2Y34 A;  4FPO B;  5A3W A;  1W0O A;  5LCW L;  1A4O A;  3WIN E;  3LA2 A;  3CJI A;  2ZHK A;  3ZYJ B;  1QOS A;  4CXW A;  3JQX A;  1GP5 A;  1TZO A;  5FZO A;  3RZL A;  4LHL A;  3WEZ A;  5JCT A;  3I59 B;  1KJL A;  2AEN A;  4AK4 A;  2QJV A;  3ILR A;  2Q0A A;  4UYB A;  5HCF A;  4YW7 A;  1GWL A;  1VP6 A;  4L99 A;  4YG6 A;  2WFP A;  5T52 A;  4A41 A;  4AVC A;  2R1D A;  4QX2 A;  2GMP A;  4A45 A;  3ACH A;  1JU4 A;  5E89 A;  2RM2 3;  3KCY A;  3OUH A;  4YM3 A;  4HFS A;  2PHU A;  3UNP A;  5LA1 A;  3T0M A;  1OLR A;  2DVA A;  1AYN 2;  5DZE A;  4AYU A;  3W5M A;  5CEH A;  3PVO A;  1FPN 3;  4DZG A;  3M3C A;  2HWE 1;  3QOP A;  4C8D A;  4PLO A;  3VZL A;  3LLY A;  2C6S A;  2Q1Z B;  2D7F A;  1H6X A;  1SLT A;  2WNU A;  4JC3 A;  3SEP A;  3ACG A;  1JW6 A;  4TXW A;  2NN8 A;  2BR9 A;  4XIL A;  1UY0 A;  4HG6 B;  3VZN A;  4GNT A;  4XMI A;  1FAY A;  4HAN A;  4AE2 A;  2JG9 B;  4A7Z A;  4CYD A;  2AGS A;  3WVJ A;  2LAL A;  2XML A;  4FFF A;  1OOP C;  5C6C A;  4LO8 A;  2GH2 A;  2Q4S A;  3VDC A;  3CZJ A;  3MID A;  4PI2 A;  1NY7 2;  4DNY A;  1EAH 1;  5K0U C;  1OLM E;  4TN7 A;  4WM8 A;  4TTG A;  3BU0 A;  4P9I A;  1VR3 A;  1S4C A;  1ODN A;  4K8F A;  2HWC 1;  5CAD A;  1W8N A;  3PTY A;  3WHU A;  4Y5I A;  2P5B A;  3VUO A;  4CU9 A;  5IK7 A;  1QKQ A;  3VD4 A;  2W1Q A;  5FK8 A;  1UXX X;  5F3E A;  1QIQ A;  5FZ4 A;  1SAC A;  4XF4 A;  4LO5 B;  1A38 A;  1F4A A;  1LOC A;  5DDJ 1;  3WHT A;  4BK5 A;  1JZ4 A;  4ZS3 A;  5LBF A;  2OII A;  2WZP P;  4S2F A;  4Y20 A;  4R6R A;  4AFA A;  2PQQ A;  1YQ8 A;  3VZE A;  2QQN A;  3OBA A;  2O02 A;  1UF2 C;  4HKW A;  3ZXA C;  3RYR A;  1UGY C; 
#chains in the Genus database with same CATH homology
 2W94 A;  2ORX A;  1KGY A;  1W9W A;  5DPN A;  3SEE A;  1JHJ A;  3HNB M;  3T09 A;  1O8S A;  2W1U A;  3NQH A;  4ARX A;  5FUI A;  1SDD B;  5J1X A;  2VL4 A;  5EJZ B;  4P08 A;  1JZ6 A;  4DUV A;  3HJR A;  5EJ1 B;  3LEI A;  3MV1 1;  1JYW A;  5DMY A;  2PQS A;  3I3B A;  4DUW A;  1W9S A;  1EUU A;  3C7F A;  4QX1 A;  3HN3 A;  3LPF A;  3K4Z A;  1ULP A;  4L0P A;  4GWI A;  2OKX A;  5LA2 A;  5C71 A;  1PX4 A;  3LEK A;  3HEI A;  3ACF A;  2E32 A;  2VZO A;  3PUI A;  1T2X A;  1GOF A;  3I2K A;  4QB1 A;  3P1I A;  3UES A;  3DEC A;  4QDR A;  3WF2 A;  3LE0 A;  2VMC A;  3I2F A;  3WF4 A;  2ZEZ A;  3OGR A;  4LQR A;  4P02 B;  4ZXE A;  4CU7 A;  5G05 L;  1K12 A;  2E26 A;  5HXM A;  2Y6G A;  3I3D A;  1L7R A;  3OEA A;  3WF0 A;  1ULO A;  3HNY M;  2VQT A;  4ET7 A;  3C7O A;  4BK4 A;  2Y6L A;  1W8O A;  3I2H A;  2WO1 A;  2YG0 A;  4W8J A;  3C7E A;  5JR2 A;  4GZ9 A;  3OG2 A;  2VJX A;  4XUN A;  5C70 A;  3WQB A;  4BXS V;  1P8J A;  4A42 A;  3I2G A;  5IJR A;  1SHW B;  1HN1 A;  2W5F A;  2LS6 A;  4DXT A;  1OH4 A;  1OF3 A;  2VOT A;  2VZT A;  2XOM A;  5DQ0 A;  1DYO A;  2DCJ A;  2HLE A;  3WNM A;  1NX9 A;  4QX3 A;  3WF1 A;  3CMG A;  3MUZ 1;  3T0B A;  4QPW A;  1JI6 A;  2L9L A;  2J1S A;  2Y64 A;  1J83 A;  1K3I A;  3LQC A;  4ZY9 A;  3P6B A;  2YC4 A;  4D8M A;  1UZ0 A;  2EIE A;  3A22 A;  1UMI A;  5JXJ A;  3A21 A;  3T2P A;  2VZP A;  1R64 A;  1UXZ A;  2XHN A;  1XPW A;  4JX0 A;  4QDQ A;  3J7H A;  3C8X A;  3OEB A;  3I2I A;  2QBX A;  1RYY A;  3C7H A;  2YC2 A;  1GU3 A;  3A23 A;  1O59 A;  2JE8 A;  1K42 A;  5JXG A;  1W0N A;  2W46 A;  4P5Y A;  4PT6 A;  4CUC A;  1US3 A;  2BGP A;  3PUH A;  3SKJ E;  3FN9 A;  2W95 A;  3K4D A;  2QQK A;  2JKX A;  2J1U A;  2WAA A;  4XUO A;  3SKV A;  5JXH A;  4MO3 M;  3K4A A;  4A6O A;  2C9K A;  3F2Z A;  2VMD A;  2J1T A;  4OMC A;  2VCC A;  2YFZ A;  3T08 A;  2RJ2 A;  2WUH A;  2Y6K A;  3WNL A;  3T2O A;  2ORZ A;  1CZS A;  4A44 A;  4XUQ A;  3U37 A;  3T0D A;  3K77 A;  1CIY A;  4AAX A;  5CZK A;  1GOG A;  2J1E A;  4QDS A;  3DYM A;  3VD5 A;  3D3A A;  2Y6J A;  4LHS A;  1EUT A;  2VMF A;  3I97 A;  3WNP A;  3VD3 A;  3BN6 A;  1JZ7 A;  1OT5 A;  3T2Q A;  3NNG A;  2XON A;  2VTF A;  3CQO A;  2EID A;  2J1A A;  3C7G A;  5A1A A;  4ARY A;  1SG3 A;  3FL7 A;  2E31 A;  4XUR A;  3THD A;  1UY4 A;  3VDA A;  3OGV A;  3ACI A;  3LPG A;  5JUV A;  4CUA A;  3WSO A;  3OB8 A;  3DYP A;  4OUE A;  2W91 A;  4PQQ A;  3FHA A;  2VCA A;  4CU6 A;  4MOA A;  4ZZ5 A;  1DLC A;  1GNY A;  2QQI A;  2BZD A;  1W9T A;  2VZQ A;  3I2J A;  4XVH A;  2BGO A;  3HNM A;  3HPN A;  1PMH X;  1UYX A;  2VZR A;  2WYS A;  2JDA A;  4P00 B;  4RYD A;  2J1V A;  5B4X A;  1JZ5 A;  2C26 A;  4CU8 A;  4DEV A;  4QX0 A;  4OMD A;  4DUX A;  4DXR A;  3III A;  2WO2 A;  3IAQ A;  1UWW A;  2ZEX A;  5C7G A;  2CDO A;  2QQO A;  2XQX A;  3CZU A;  4AG4 A;  3CIH A;  2VCB A;  4RN5 A;  2VZ3 A;  3BGA A;  4A3Z A;  2VZU A;  2WAO A;  5JMO A;  1JYN A;  3EB7 A;  2WZ8 A;  2VZ1 A;  1JYX A;  2WDB A;  1UX7 A;  5HPO A;  2WBK A;  4CVU A;  5B4N A;  1WCQ A;  3IB3 A;  4MGS A;  4XUT A;  5F7U A;  4LKS A;  1XNT A;  2W1W A;  3I3E A;  4JKM A;  1PX3 A;  3CDZ B;  2BER A;  3THC A;  1W99 A;  2VQU A;  4W4Z A;  2VZS A;  2V72 A;  3K75 B;  4YPJ A;  2VO5 A;  2X09 A;  2YB7 A;  1GQP A;  2J22 A;  1LNS A;  1XC6 A;  5DN2 A;  3NJV A;  4M4R A;  3VDB A;  4D0Q A;  2VR4 A;  1BHG A;  1NAE A;  3GDB A;  3DYO A;  2C4X A;  1J84 A;  2VM9 A;  2RVA A;  4UOJ A;  2EIB A;  1CX1 A;  3X0U A;  4JKK A;  4DEQ A;  4FI9 A;  4JKL A;  3ABZ A;  4MGQ A;  3ZM8 A;  1L7Q A;  2J1R A;  4QB6 A;  1OF4 A;  3IDA A;  2V5D A;  1JZ3 A;  2WO3 A;  2Y8K A;  4KMQ A;  4Z2A A;  4BJ0 A;  1US2 A;  1JYV A;  4UAP A;  4E8D A;  3HOB A;  2RV9 A;  3LEG A;  2WN2 A;  4KWU A;  4QB2 A;  3W5N A;  1UYY A;  2KD7 A;  2Z4F A;  1UY3 A;  2DDU A;  1NUK A;  3ECQ A;  2WN3 A;  1GOH A;  5LA0 A;  3T0A A;  3WF3 A;  5JXI A;  1XNA A;  1MPX A;  3K46 A;  1K45 A;  3E1F 1;  1H6Y A;  3JXS A;  4QAW A;  1OD3 A;  1D7P M;  4LPL A;  4E8C A;  1KEX A;  2W47 A;  3WNK A;  1UY1 A;  5IFP A;  1DP0 A;  3MV0 1;  4MAD A;  2ID4 A;  2HYX A;  2X10 A;  2VME A;  1TG7 A;  2ZXQ A;  4UI9 L;  3FHQ A;  3GXU A;  1NKG A;  5IYY A;  4PF1 A;  1F4H A;  1GMM A;  2V4V A;  5IFT A;  2E33 A;  2R7E B;  4W50 A;  2WQ8 A;  3WNN A;  4CUB A;  2ZEY A;  5EIY B;  2B9V A;  4KI5 M;  1TVG A;  2VC9 A;  1IQD C;  1UMH A;  1UYZ A;  4BDV B;  1PMJ X;  2QQM A;  2CDP A;  1I5P A;  3MO4 A;  3EYP A;  4OYU A;  1GUI A;  1UY2 A;  3MUY 1;  5I0D A;  5LCW L;  3IAP A;  4IUG A;  4JHZ A;  1JZ8 A;  4XUP A;  4DXS A;  2WZE A;  3WEZ A;  4OZO A;  2EIC A;  2QQL A;  2LW8 A;  4M4P A;  4A41 A;  4QX2 A;  4A45 A;  3ACH A;  1JU4 A;  3VD7 A;  3UNP A;  3AC0 A;  3WNO A;  5LA1 A;  2BBA A;  3W5M A;  2Y6H A;  1CZV A;  1YQ2 A;  3NJX A;  2VZV A;  3GGL A;  2DCK A;  2W87 A;  1H6X A;  1JU3 A;  3SEP A;  3ACG A;  3A7Q A;  4TXW A;  1UY0 A;  4HG6 B;  2YFU A;  5CYY A;  2WAB A;  2J7M A;  1O8P A;  2W9X A;  2X05 A;  3VDC A;  3CZJ A;  5IHR A;  4TTG A;  3OGS A;  1W8N A;  2B4K A;  2W1S A;  4CU9 A;  3VD4 A;  2W1Q A;  4ZZ8 A;  3ETP A;  1UXX X;  1CZT A;  1F4A A;  4XZU G;  2JD9 A;  1JZ2 A;  4BK5 A;  1JZ4 A;  4GWJ A;  5G04 L;  4A4A A;  2W92 A;  3MBW A;  3CKH A;  3VD9 A;  2QQJ A;  1WKY A;  3NRU A;  2ZEW A;  2W3J A;  2QQN A;  3UET A;  3OBA A;  3GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...