1CIYA

Insecticidal toxin: structure and channel formation
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
577
structure length
577
Chain Sequence
YTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPSTIYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CRYIA(A)
publication title Bacillus thuringiensis CryIA(a) insecticidal toxin: crystal structure and channel formation.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 182
structure length 577
sequence length 577
ec nomenclature
pdb deposition date 1995-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00555 Endotoxin_M delta endotoxin
A PF03944 Endotoxin_C delta endotoxin
A PF03945 Endotoxin_N delta endotoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.190.10 Mainly Alpha Up-down Bundle Delta-Endotoxin; domain 1 Pesticidal crystal protein, N-terminal domain 1ciyA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1ciyA03
2.100.10.10 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Pesticidal crystal protein, central domain 1ciyA02
3SEEA 2J1AA 1UYXA 2W3JA 5LA0A 3WF0A 2VM9A 2VC9A 2C4XA 4ARXA 3I2JA 3NRUA 2JDAA 5EIYB 1JYXA 3ECQA 3P6BA 3ETPA 5JXHA 5JXIA 1XPWA 2QQIA 2VZUA 4ZZ5A 3ABZA 4Z2AA 3VD5A 3NJXA 3OEAA 3WNLA 3DYOA 3IIIA 5I0DA 1JZ3A 2W1WA 1JYNA 1DYOA 2WO3A 2QQNA 1JZ7A 2J1TA 1OT5A 2VZPA 1JYWA 2WO1A 2YB7A 3WNMA 4W50A 2WDBA 2Y6GA 3FHAA 3K77A 1JHJA 3WSOA 1W8NA 4DXRA 2WUHA 2VZTA 4M4RA 5IHRA 5IYYA 2W9XA 2VZVA 1O8SA 2VZRA 2WO2A 4CUAA 4LHSA 3U37A 2X09A 3GDBA 4A44A 2WQ8A 3MBWA 3T08A 1GUIA 5A1AA 2W87A 4JX0A 2YFZA 3T2PA 1I5PA 4HG6B 3GGLA 3IDAA 3OBAA 3GM8A 1CZVA 1J84A 2ZXQA 1W99A 2QQJA 4PQQA 2C9KA 4RN5A 2VZQA 1PX4A 3VD4A 1W9WA 4CU9A 1UMHA 3IAPA 4QB2A 2LS6A 1TG7A 3CDZB 3LEIA 3DYPA 2X05A 3LEKA 3OB8A 3W5MA 2XQXA 2WABA 1L7QA 3C8XA 5G04L 4JHZA 1NKGA 4DXSA 2CDPA 4JKLA 4QX2A 3C7EA 3E1F1 4ZZ8A 1JYVA 3VD3A 2W91A 3T0AA 3J7HA 4QPWA 4KWUA 4XURA 2VMCA 3JXSA 4XUTA 2C26A 2OKXA 1UWWA 4BJ0A 2W5FA 3WNKA 4QX3A 1UY1A 2JD9A 2VCCA 2VQTA 4P5YA 3P1IA 2VQUA 3C7OA 4XUQA 4QDSA 5F7UA 5EJZB 1L7RA 2EIDA 2Z4FA 3T0DA 5HPOA 4KI5M 2VMEA 2B9VA 2W1QA 3OGSA 3WNOA 4FI9A 2EIEA 5IFTA 3HNMA 2YC2A 3K46A 1W8OA 2PQSA 3HN3A 3WEZA 3IAQA 2BZDA 2W47A 3PUIA 3OG2A 2W92A 1GU3A 4CU6A 3SEPA 5LA2A 2VCBA 4D8MA 2XONA 3T09A 3WNPA 3FN9A 4MGQA 3BN6A 3LQCA 1XNTA 3T2OA 5JXJA 2ORXA 4GWIA 2J1VA 5JR2A 5JXGA 2ZEYA 2VMFA 3UESA 4DEVA 1ULPA 3ACHA 5DN2A 4DEQA 2LW8A 2VJXA 1OF3A 3HNBM 2XHNA 3WF3A 4ARYA 5CZKA 1PMHX 1EUUA 3MV01 4BXSV 5DMYA 4LPLA 1P8JA 1T2XA 3WF4A 1UMIA 2Y6KA 4XUPA 4AG4A 1F4AA 1UX7A 4IUGA 2QQOA 4QAWA 3HJRA 2DCJA 3WQBA 1W9SA 5LCWL 2WN3A 4P08A 3T0BA 2ZEXA 4OYUA 1CZTA 4A4AA 2VCAA 1NAEA 1H6XA 4QX0A 1YQ2A 3WF2A 1JU3A 1SHWB 3CZUA 4CU8A 1UY2A 2Y8KA 3C7HA 1EUTA 1KGYA 3LE0A 2VMDA 2ZEZA 1GOHA 3LEGA 3UETA 2J1UA 4YPJA 2DDUA 5J1XA 3CMGA 3I97A 4XZUG 4CVUA 1GQPA 4MADA 3IB3A 1CIYA 2CDOA 1UXXX 2W95A 4E8DA 5B4XA 3CQOA 2WBKA 2YG0A 4JKKA 2WZEA 3A7QA 5JUVA 4CU7A 4UOJA 4XUOA 1RYYA 4PF1A 3CZJA 1OF4A 2E32A 2VZ1A 4LKSA 4MGSA 1JI6A 3FHQA 4BK5A 2JE8A 4KMQA 3OGVA 2YFUA 3EYPA 1US3A 3FL7A 1JZ5A 3I3BA 1GOGA 1UY0A 3I2HA 4M4PA 3HEIA 3W5NA 2QBXA 1HN1A 2ORZA 1SG3A 1XNAA 3K75B 1UYZA 3NQHA 4QDQA 1DP0A 1DLCA 3WNNA 4CUCA 4AAXA 1NUKA 2Y6JA 4W8JA 4L0PA 3THDA 1JZ8A 2Y6HA 1K42A 2V5DA 4LQRA 3A22A 2W1UA 4XVHA 3HOBA 2VZOA 1GOFA 2L9LA 1K45A 1US2A 3ACIA 5C70A 2R7EB 2HYXA 5C71A 5CYYA 4QDRA 3I2IA 4GZ9A 1PX3A 3MUY1 2VOTA 1KEXA 3MUZ1 2ID4A 3A23A 1JZ4A 3HNYM 2YC4A 2V72A 2VTFA 4DXTA 4OMCA 3PUHA 3GXUA 5FUIA 2VR4A 1UYYA 2QQMA 4DUXA 5JMOA 5HXMA 3UNPA 5DQ0A 1K12A 3VDAA 3SKVA 1OD3A 1XC6A 4A45A 4XUNA 3A21A 3DECA 5B4NA 4W4ZA 3X0UA 4OUEA 5EJ1B 4A6OA 3K4DA 1W0NA 1TVGA 3T2QA 2BBAA 4P02B 4BDVB 4UI9L 3DYMA 3ACGA 3MV11 4DUVA 1D7PM 2KD7A 2VZSA 2J1SA 2Y6LA 2E33A 1MPXA 3C7FA 4TXWA 3NJVA 1CX1A 3AC0A 3MO4A 2Y64A 2W1SA 2J1EA 4RYDA 4A3ZA 2X10A 4E8CA 4CUBA 4A41A 2HLEA 2W46A 2VO5A 2ZEWA 3NNGA 4ZY9A 3VD9A 2DCKA 4BK4A 5G05L 2WAAA 2BERA 1GMMA 1WKYA 4GWJA 1NX9A 3VDCA 1IQDC 3THCA 3OGRA 1GNYA 1F4HA 1O59A 2QQKA 3LPFA 1CZSA 1OH4A 2EICA 4UAPA 1ULOA 1UZ0A 1JZ6A 2W94A 3HPNA 2E26A 3K4ZA 4QX1A 4QB6A 3I2GA 1UXZA 1WCQA 1H6YA 2J22A 4ZXEA 3CIHA 4D0QA 4OZOA 1LNSA 2RVAA 4QB1A 3K4AA 4P00B 1SDDB 2B4KA 1JZ2A 2RJ2A 3BGAA 2WN2A 5C7GA 1R64A 3WF1A 3F2ZA 3D3AA 4MOAA 1J83A 2V4VA 1O8PA 3SKJE 2VZ3A 3CKHA 2J1RA 4DUWA 3I2KA 3LPGA 1UY4A 1PMJX 3I2FA 2JKXA 2WYSA 2WAOA 4MO3M 2J7MA 3EB7A 3ACFA 2XOMA 3VD7A 2VL4A 4OMDA 2QQLA 1W9TA 5IFPA 2BGOA 2E31A 2RV9A 1K3IA 2WZ8A 4ET7A 1JU4A 5DPNA 1BHGA 3ZM8A 5IJRA 3VDBA 3I3DA 3I3EA 5LA1A 3OEBA 4JKMA 3C7GA 1UY3A 2EIBA 4TTGA 4PT6A 4A42A 2BGPA
chains in the Genus database with same CATH superfamily
1JODA 3DPRB 4B1LA 4W6XA 5A32B 1UYXA 5LA0A 1YQCA 5J36A 3P3NA 4HKCA 4S2DA 3QH6A 4ARXA 1WLTA 2GC2A 4XFBA 1YC61 5A7WA 4FPFA 3VB9A 4CEWA 1JYXA 3AKRA 4KWKA 4P9IA 3PTRB 4GALA 4MSVA 1SQ4A 5JXHA 1W3VA 1QJY1 1J58A 3RDHA 3VN4A 4ZZ5A 4L99A 1EY2A 3DEMA 2BGCA 4IXLA 4XQDA 5A7NA 5A7OA 3WDYA 5KXEA 1DLLA 4MQ0A 4D7TA 3S5AA 4XILA 4PIYA 4Y22B 4Z2AA 2HWF3 3J8F1 3FE5A 4IL7A 3VD5A 2VPVA 4CCJA 3WNLA 3GNEA 3IIIA 2VNVA 4QQOA 5GZCA 1NYWA 4Y32A 1DQ6A 1RHI1 2R041 4GB33 1W6MA 2JJ6A 1CAVA 3H8UA 5AFBA 4WVVA 2QQNA 3U9XA 2ZGSA 5F6LB 3ATGA 5FO8B 1G9AA 2WO1A 2WDBA 2K9ZA 3WSOA 3NNMA 5F1RA 1AR81 1UL9A 5IHRA 3DCQA 3SMOA 1SLAA 3NV2A 1O8SA 3LOBA 3AP4A 1AHSA 3AYEA 3LWCA 4GJYA 3O0VA 3U37A 2DYCA 1ODMA 4XTPA 3JQWA 3U1XA 2GNTA 1RUG3 1UOGA 3NNFA 4YZ4A 3TNPB 1O4TA 5H9RA 1REFA 1V9U2 3T08A 4JX0A 2XMLA 2I2SA 2YFZA 1NLQA 1W2OA 2GMPA 3T2PA 3MIUA 1WA6X 1R092 4PCRA 4V2VA 4XMIA 3K3NA 1CZVA 1W99A 4FR3A 4H7MA 3BUCA 4ASLA 4MG2A 2D6PA 4QXBA 2VZQA 5KC6A 3T1MA 3B3QE 5BV6A 3AMPA 2D93A 2D43A 3HBKA 4HETA 5GALA 4CP2A 2W0XA 4WOGA 2EALA 2BOJA 2B45X 2LS6A 5A6YA 1I6XA 2DCZA 3JZVA 2ZJCA 3CDZB 4FQZA 5C9AC 1MS3A 1AF9A 3VBSA 2O1QA 3LEKA 4XZPA 3SQOA 1HN0A 4KH9A 4AKDA 2DVAA 2CWMA 2IFWA 3IPVA 3JD73 4Q4W1 4DINB 4RFT0 5DAXA 3VBOC 1NKGA 1AX0A 2WA3A 1VRH3 3VY6A 1RUJ2 2YZ4A 1VMOA 5JSRA 4GWNA 1IHMA 1BXHA 1DQ0A 3RFRA 1FV3A 1V9U3 3PUSA 3J7HA 1X8EA 4W65A 5KR7A 4KWUA 2RS12 4XEZA 1QXJA 2LROA 2YV8A 3O1PA 1OUWA 3ES4A 3CU7A 5ABJA 5E1RA 5CFDA 4NIDA 3HMYA 1QJAA 3N3HA 1AYM2 1QJFA 3MIBA 5FLJA 1BJQA 2A7AA 5GJ6A 1DGWA 2YU1A 1QJBA 1MS4A 2OUHA 2PHWA 4WM7C 2IZWA 4NHXA 2WINB 3O14A 1O91A 4HL0A 5D8AC 1UY1A 2JD9A 3BTAA 3H0OA 3AKTA 2YU2A 4TWTA 5BY9A 5JPNB 3EMRA 3R05A 3IIAA 1R1A1 2ZPXA 3R4DB 3ZIWA 1VBB1 5L9BA 4QPGB 1MZFA 1DG6A 2VQUA 1A3KA 3C7OA 5FK8A 4DHNA 4UF0A 4CXYA 4DDNA 1QJEA 3T3YA 4MH0E 5FMOL 4YSFA 4CPBD 4P9XA 1L7RA 2P1BA 4KL1A 2GC0A 1KFUL 1W0OA 2ZAHA 3AMQA 5LATA 4NUBA 4YZ1A 5A3OA 2ZZJA 1MACA 5D3FA 3HIFA 3RI9A 2VMEA 2VVEA 2B9VA 2RS13 4NJ4A 1I5ZA 3WNOA 2V7DA 5C3RA 2GUDA 1LAJA 1SPPB 2WSUA 1DF0A 5IFTA 4PI0A 4AQ6A 2BTVC 4LO8A 1V6OA 4QMAA 3VBRC 1LOAA 3DV8A 4CXXA 1XXNA 2RS51 1AYM3 1OLRA 1VBE3 2W39A 3HAGA 2QQVA 4CCOA 3J8F2 3T0MA 1NCQC 2R1DA 3DGTA 5FQ0B 1Z7S1 1TNFA 5CEHA 1IG3A 1EPWA 3VZNA 5FY1A 1JH5A 1RHI2 4IV1C 5FZ9A 4XF9A 4I3PA 3H1MA 3OF1A 1JHNA 3WEZA 5D21A 5FJKA 1PIV1 2A70A 4R9AA 1WCDJ 2JDZA 2BDRA 1ZA4A 1NLSA 5L9VA 4ZQ0A 4PHZA 4PDWA 4UBHA 3SEPA 4QT6A 2V5YA 1AR82 1U12A 1UNBA 5DAVA 5LA2A 3D0SA 3SNMA 5I8YA 1POV3 3WDXA 1UZZA 1UU4A 4NR1A 3BN6A 5FPZA 3P1SA 4W6WA 4JZRA 3OPZA 3LSEA 3A0NA 2A5ZA 2G9FA 1ENXA 2O0OA 1YWTA 5J4XA 3LQCA 3POJA 4PF5A 5JXJA 2DUPA 4ATEA 2Y33A 2ORXA 2J1VA 4RGKA 5JXGA 2ZEYA 1W2AX 1ZBE2 1SBDA 4EN7B 5BTVA 1SZBA 3ACHA 5IATA 1ZGRA 3TEXA 4FPOB 1LKNA 1CAWB 2LW8A 4D6RA 3RMYA 2HWC2 3HNBM 1PO21 2FDKA 4FPCA 5AV7A 4XPVA 3BOWA 2QUOA 1O3SA 1OBNA 2Z42A 2DBNA 3LA7A 3R4UA 1XB9A 4P9LA 2JZ4A 2RG4A 5SV8A 4A7YA 2AC1A 4LE4A 4LO6B 2TNFA 2YPJA 2FZ2A 2DTYA 4QPIC 3ILRA 4TLGA 1SLIA 4Q4W2 3OYWB 3SMHA 1T2XA 3H9AA 3WF4A 2YGMA 5C9AB 4AVTA 5T5LA 4XUPA 3WT3A 1F4AA 1A8DA 3NV1A 3LOIA 4IUGA 4QAWA 2H6CA 1VALA 4N7UA 5J48A 1DIWA 3DN7A 2H0VA 4P08A 3T0BA 1CZTA 3TN91 3KQRA 3VBOB 4WZFA 4A4AA 2BFUS 3ZVXA 3M3OA 4AVBA 2ZMNA 3K2OA 1ZBE3 2NPIA 3P3PA 1OPOA 4QX0A 4X8NA 5LHOA 4BIFA 3RDIA 1JOJA 2XBO3 5CKQA 2FHRA 2R6QA 4ZU4A 1VPHA 3MYXA 4JDDA 2GMEA 1KGYA 2HWC3 5FLIA 5FOJB 3RGBA 5LB6A 1W2NA 2BYVE 4QKDA 1QIQA 4AHYA 4ZU5A 4AEDA 2UY8A 1BVP1 3LEGA 2R071 2RDSA 4FCAA 1W8HA 3LEMA 5FP9A 3KB5A 4HOOA 3SCHA 3N9OA 2F17A 4PLOA 2D40A 5J1XA 3I97A 3T2TA 1ZRIA 1IQAA 1AYN1 1R1A2 4YW3A 5KBFA 4NHMA 1VBB2 2OPWA 3ZXEA 3LSDA 1NE6A 4WM7B 3USSA 4MADA 5C5TA 3IB3A 2VOXA 3PJYA 5D8AB 4Y20A 5DXDA 5FMBA 2ATFA 5SV5A 5FZFA 1CD3G 2W95A 1M4WA 2BNMA 3CQOA 4LKEA 2UWBA 5F37A 1DU3D 2RDQA 3WDUA 2BP6A 3A7QA 1C4RA 1UH1A 5BNPC 4JRLA 5J3UA 5JAXA 3M3QA 1RUOA 2ILMA 2DCYA 1RYYA 2NUOA 3EHKA 5C8CC 1WBFA 2P6CA 3VY7A 2NMOA 4FSJA 2JDYA 3LGRA 4K8RB 2RS52 4BK5A 4R6NA 1D4M3 4URTA 3VBRA 1ZA7A 1CAXB 1Z7S2 3FL7A 1G86A 2WZR3 1BEV1 4NMIA 2VULA 4CUGA 1CVNA 3I3BA 1GOGA 2Y0OA 3GZTB 1BQPA 1W9YA 4M4PA 3VBRB 2QBXA 4YVWC 1PIV2 1A78A 3FLRA 4YARA 2E7AA 1LOBA 1RMU3 4U36A 3AJZA 1MS5A 1NCQB 4QDQA 4FBFA 4F7ZA 4ORFA 2RR11 1DLCA 1MQTC 4FOQA 4Q29A 4Z07A 1EV11 4K8FA 4AAXA 3D5OA 2JIJA 4IV1B 3JU9A 3LKYA 3WXPA 4ITCA 2Y6JA 4LLOA 2VUAA 3PVNA 4RGAA 3VGIA 1CX4A 1KXGA 4DHTA 1BCXA 1BYHA 1GP5A 4LBQB 3OGJA 4LULA 2LALA 2RS31 3HQXA 3VZMA 4F83A 1LEMA 2DUQA 2W1UA 4XVHA 1PGW1 5JOZA 5F2SA 5EXOA 2RS53 4AF9A 5F32A 4OI1A 1U5YA 1K45A 3ACIA 1GP4A 1AR63 1BBT1 3N9MA 5LK7B 3P1PA 1M06G 5A1LA 4CE8A 5FAXA 2VH9A 1PO22 3PUQA 2WLPA 1FPN1 3WINE 1GNHA 5F3IA 5F3EA 4HVQA 2GZWA 4AK4A 1TEIA 1FT9A 1UKRA 3ZX7A 2MNGA 3ZXLA 2VTFA 3W58A 3HWJA 2C24A 3BPSA 4M0HA 4E2GA 2C6SA 2VR4A 1UYYA 4KG8A 1O9CA 2CHHA 3AP9A 4RHV3 3SPRA 3V0AA 1MZ6A 3BI3A 1NCRC 3IWZA 4LKDA 3PU3A 1JBCA 4FFIA 5FZ4A 1SDWA 4QPIB 4XUNA 3A21A 1ND2C 4BYYA 3DECA 1VP6A 1XNBA 5FXVA 4UWDA 4XDOA 3TN92 5IK8A 5EP9A 4AWDA 3F95A 1J59A 3X0UA 1X82A 2WWUA 4LHKA 2HEWF 3ZFFC 5CA6A 2XJQA 2FCUA 1TVGA 1RB8G 1TMF3 4P02B 4HSLA 3ACGA 2HWB3 4GKYA 4XF1A 5CBLA 1RUH1 4HLTA 5FKCA 2HKXA 1D7PM 1WD3A 2E33A 2CU5A 3C7FA 1OVSA 1W04A 1CX1A 5LBCA 5JSPA 3BU0A 5TSWA 1K5MA 1QXPA 2O8PA 4PIXA 3GHMA 4CCNA 1AYN2 1REDA 2V09A 5FJHA 5LA9A 4CUBA 2W46A 4O65A 1J1TA 1LHUA 2JE7A 4G4FA 2YBPA 3RYPA 2GDFA 2WIIB 3MHRA 5D1IA 1WGPA 4BK4A 4XFHA 2QCSB 5F5CA 2VUCA 1BMV1 5FZ1A 5E88A 1GMMA 2PFWA 4NWWA 1UOBA 4K40A 4FQ4A 5DUUA 2CYFA 1CZSA 1FNZA 1H1MA 1OH4A 2EICA 3M8LA 1LENA 1Q56A 1UCXA 2ZGKA 4JVAA 1NLRA 3O0WA 4UAPA 5FMCA 4BQ4A 5KHGA 4L97A 4LK6A 4CEYA 4A3XA 1UZ0A 2WA4A 4FFHA 4NHYA 3ZXDA 4BLJA 4IHLA 5L7OC 5D3EA 2VBBA 3URFA 5BNPB 2EAAA 2FZ1A 4DY3A 2AEYA 4QB6A 1ACCA 1R1ZA 2HWE3 1GZWA 4D69A 3ZO0B 5C8CB 3I2GA 1UXZA 1RJ8A 1BEV2 1YEWA 2XG3A 2IXIA 2WL1A 3H1WA 3P8SA 1CN1A 3MEPA 3FUOA 4M3CA 2DF7A 5HV0A 2RVAA 1OFNA 5EQUA 4DNYA 4EN0A 2B4KA 2RR12 1JZ2A 4BU2A 2JDMA 1EV12 1MS1A 4H14A 4XBLA 5DG2A 2GH2A 2WN2A 1LHNA 3ZMOA 1ZZ9A 3VLBB 1JW6A 3D3AA 4L11A 4OUSA 3RNSA 3ST7A 2JG9A 3U10A 4YVWB 1WA4A 3ACLA 3SKJE 4QKNA 5C5UA 4DUWA 2ZS6B 4P9JA 1MQTB 1T6BX 3I2KA 1H2NA 5AC93 4QX5A 3R50A 1UY4A 1IS4A 1PMJX 4COWA 2PXJA 5HXVA 4RA0A 5LU1A 2RS32 2WAOA 4MO3M 4Y26A 1J4SA 3ACFA 2AH2A 3ZKUA 1PGW2 1YFXA 2A1XA 2AR6A 2AUYA 4KBBA 3ZXAC 4D7YA 5IVBA 2QDRA 1QU0A 4V1PA 3VD7A 2K2SA 4XTMA 1W6NA 5IFPA 1BBT2 4Q1RA 4GH4C 5CB7A 5K0UC 1LB2A 1HV1A 1FPN2 1JU4A 2XVKA 1S4CA 1W6NB 3AP7A 5GLZA 1E5IA 3H42B 4PBPA 5FZKA 5FY8A 4ES9A 1AXZA 4Q0VA 3O1MA 3I3EA 4HFSA 5LA1A 2FDHA 1HB2A 3S57A 4J1WA 5KHHA 2VOVA 5FY7A 1V6NA 2EIBA 1UW8A 3LW1A 1TQ5A 2QE3A 3D0JA 4I02A 2FD8A 2WNUC 4BWOA 3AX4A 2VM9A 2VC9A 4IEYA 2BEOA 3NRUA 5C6CA 1BK0A 3B01A 1N1VA 2QJVA 3ECQA 1URJA 4UW5A 3OUIA 1AX1A 3ETPA 5JXIA 1GR3A 2FBEA 4WM8A 2QQIA 2XDVA 4S2FA 5LY2A 2VZUA 1DCSA 1NCRB 4DNKA 3GJBA 4NVPA 4YZ5A 1ZRFA 2ENRA 4YVSC 1QDCA 1ZGSA 3VZFA 4Y5SA 1ND2B 4DB5A 1WS5A 3OPTA 5DZGA 2WS91 3AFKA 1WUVA 5FREA 1RUI3 1UGYC 1IZ3A 2NZ9A 1OPMA 2I45A 3ZFFB 2ZACA 4YG6A 1EP0A 2D6KA 1PZ8A 2D6OX 2ADEA 3IBMA 1V6MA 1ND3C 3WCSA 3SH4A 2F4LA 2VQ0A 2O8OA 3LL0A 2J1TA 2VZPA 5FZHA 4JGZA 2OT7A 1AR91 2BU9A 1HB1A 3UNPA 3TOWA 4W50A 3K77A 2W08A 1Z78A 1W8NA 1QMJA 1QNYA 2D5FA 5DDJ1 2P3IA 2XUMA 4AKCA 3QBQA 3APBA 4N9IA 2W9XA 3M3IA 4QGLA 1DGWX 2VZRA 2WO2A 5FOBB 1BMV2 4XJUA 3UGGA 2ZX0A 3DL3A 3QD6A 2X09A 4XFGA 2QVSB 3GDBA 4Q0SA 4UYBA 3AFGA 4O9EA 3POEA 3FC0A 1G9CA 5A1AA 5FYIA 4KU8A 1HXS3 4U2AA 2MEV3 4M01A 5EZWA 3IDAA 5FFOC 3GM8A 4EWDA 3P1NA 1I9RA 5FYMA 1TME3 2RE9A 3ZKYA 4LIUA 3SISA 1OA3A 1SFPA 4GIQA 1HB4A 1X9PA 4GMP0 1UMHA 4HANA 2B39A 4RQPC 2YXSA 1CAUA 4RS5A 5JI9A 4IEAA 1OLME 3LEIA 3T4HB 5L7OB 5LRRA 4FP2A 4CDQC 3NW4A 3DYPA 2X05A 3D4KA 3OB8A 3RZJA 3E6BA 3B9IA 3KV9A 4S2GA 4BE3A 4RS5B 3H8OA 3SMMA 4CDUC 3TYJA 4JHZA 1SFNA 1RUF1 2CWSA 2Y26A 3CEWA 3I7DA 4LJHA 2CDPA 2IXHA 4JKLA 3FJSA 4LNVA 4XQWA 3WOBA 1VBC1 1LTEA 1V6IA 3IMNA 3E1F1 3R4SA 4CCLA 2PQQA 4F8AA 3TEWA 1JYVA 3ZYIB 1QXRA 4FVVA 1Z0HA 3ZR5A 1LR5A 2PHXA 2CGNA 3CF6E 4Q4Y1 3KGZA 4XURA 2NQYA 1W2TA 3N9NA 3TOJA 4BH9A 3NV4A 3WOCA 4PIKA 3B93A 4CCMA 2RM23 2I74A 1QH6A 2E6VA 3L9JT 3VDDA 4N8MA 4BJ0A 1QOTA 2W5FA 3WNKA 4GX7A 3LIHA 4QGNA 1PNFA 1N1YA 4OQ9A 1X50A 4QKFA 2AACA 2Q8CA 4Y3OA 4AVSA 3J4UH 1O3TA 4YW5A 2VCCA 2VQTA 3BALA 4MGYE 4N53C 4GH4B 4YW4A 2FMYA 2ARBA 4XUQA 2JDNA 5K0UB 1AXYA 5CFCC 3ZHEB 3KGLA 4IE4A 3JB8A 5EJZB 1C1LA 4B3NA 5F7UA 2ZGOA 3PLQA 2K46A 4JDNA 4KU7A 1ZREA 4LIVA 4LOTA 3VBUA 1HB3A 3T0DA 5HPOA 1J3PA 1W6PB 5FR3A 5FZ6A 4K20A 4CDXC 4KI5M 1HRI1 2WWSA 2JICA 4XBQA 2VVDA 2C5DA 4FXGB 5BN6E 3DPRA 3Q8EA 4XHXA 1PM7A 2WNUB 2EIEA 1XE7A 3BVCA 1LJ7A 5ISLA 4DHUA 1HLCA 4E4DX 1AUYA 3GF6A 2XB6C 5FP3A 2HBTA 4EZ4A 1W8OA 2WS92 2PLV1 3GZUC 2ES3A 5E16A 3UZDA 2HWD3 5APAA 1JS9A 2BZDA 3HQRA 4YVSB 2OA2A 1KJRA 4OUMA 4Y22A 1ASJ3 1K5JA 4Q0PA 1Y4WA 4I3GA 1Y43B 4NPRA 1VB2A 1G9BA 4LA2A 4AAPA 1AR92 1DGRN 1QQP1 4X6RB 3FFQA 1LU2A 2DVFA 4E2EA 4GMP3 3VUOA 5DDJ2 3WHTA 1BLZA 1ND3B 3Q8FA 4FP3A 4O61A 4MGQA 3T09A 5HBAA 5DABA 4IV3C 4B8EA 4ZS2A 4NRQA 5FMOS 4D6SA 1QJU1 1QNWA 2PHFA 1J4UA 3NNJA 1XNTA 2Q0AA 2G19A 2EAKA 3KVBA 4YFWA 2Z69A 1LECA 1YRZA 2VAUA 3AYDA 4HN1A 3H3ZA 5FYHA 5C4WC 2GMMA 2P3JA 3J9SA 3AVRA 2P17A 3ZN6A 3LKJA 4Y4RA 2JECA 4FL5A 4EN9B 4TSVA 1MZ5A 1T6GC 1Y9GA 2VJXA 5FYSA 3TBDA 2ZAAA 2XWJB 3AL6A 4IESA 3ZN6B 4XYXA 5LRSA 4X8PA 4Y33A 5I0TA 3X29B 3ZFEC 2X53S 2CNAA 5IAXA 3CQGA 1ALYA 1ZBA1 1PMHX 4C8DA 2A6ZA 2BNNA 2GH8A 1OUXA 4BXSV 2JKBA 4Q4X1 1YQ5A 4LPLA 1FOD1 3OGGA 4LEJA 1P8JA 2UURA 4RQPB 5HCFA 2Q8OA 1APNA 2JB4A 3O0XA 1RUF2 4NO4A 2B8MA 2OQ7A 4CDQB 1YIPA 3APAA 3ME2A 2QQOA 1AL21 1E5SA 3VZJA 3HJRA 3WOGA 1KQRA 1POV0 1GZTA 5FTTC 3WQBA 4BQ1A 5LCWL 3THTA 2DU0A 4FPHA 2ZEXA 2VUDA 5GLVA 4M0NA 3VL9A 4CDUB 1RITA 1IS6A 5GLUA 2VCAA 1CWPA 1ZNPA 3MLJA 1WS4A 2C1NA 1H6XA 4HKOA 1C3MA 4JCKA 3FMGA 1YQ2A 4LUMA 1JU3A 1SHWB 4N90A 2X29A 5IVYA 3VHOA 4CDWC 4M00A 5IVEA 3PDQA 4AHXA 3LE0A 5A3LA 3WX5A 1C28A 1YXWA 3WG4A 3I2OA 2WNEA 5LY1A 4RR3C 1TOQA 4IEOA 4KWLA 4H55A 3H8RA 1PVC1 3LDBA 1MS8A 2MPFA 3LFMA 3IKWA 3JCIA 3WP5A 2DDUA 2Y0IA 2I07B 4BZ4A 1C3KA 4IEPA 1R093 2UYAA 3N7LA 1WMFA 2GN3A 3SLIA 3WW3A 5LEKA 1O9FA 2VXJA 4MHRA 1CIYA 3UKTA 1OSGA 2CDOA 5JOXA 1WMXA 4FOYA 5CKNA 1PNGA 1F2NA 4E8DA 4GQ7A 4QU1A 5B4XA 4OZXA 2OVUA 4AGGA 2YG0A 4N53B 2YGLA 5DUWA 2A3YA 4JKKA 4QPGA 1OA2A 4GJZA 1A6CA 5JI7A 1HRI2 4CU7A 5FZOB 5CFCB 5JUVA 1FYUA 2VW0A 3AZZA 2XKOA 2B05A 2JG8C 4PF1A 4QHOA 5IW0A 3PURA 2E32A 2VZ1A 4F3JA 3ZYRA 1RUD1 2NMNA 2PYTA 1XSQA 3NVCA 1H2KA 5GLWA 3O5SA 4ZKTB 2YBSA 3ZSMA 2JE8A 1DHKB 1RUJ3 3JBG1 3VBHC 3WW4A 1V70A 2YFUA 2PLV2 3H7YA 5JZGC 3TEYA 1F5JA 1V0AA 1SPPA 1JZ5A 2KM2A 4XCBA 1OOPC 1UY0A 2P6HA 4BPZA 1NG0A 5JIUA 1VBOA 1C5HA 2JDUA 4LLFA 3ZDVA 1HX6A 4E4HA 1QJY2 1SG3A 4FTSA 3NQHA 5FBJA 4E2QA 5FQ0A 1DP0A 5A6QA 4QXKA 2D44A 2ZX4A 1QY4A 4QX7A 1S0DA 5IQPA 4G3YC 2XGXA 4DFSA 2VW2A 5CADA 3U4SA 3BB6A 3Q8AA 4JHTA 4YGEA 3AM2A 4AYUA 2R042 1LHOA 1IGOA 1LCLA 2C9AA 2WNVC 2Y6HA 2JWPA 1QJX1 5JR7B 3WQ1A 5J09A 2DWRA 4IW3A 3RPQA 5A7SA 1YWKA 3L2HA 3HOBA 4IV3B 4YGBA 5EJ3A 5I8SA 5AVPA 4HSJA 2R7EB 3ZR6A 3B69A 2HYXA 5FZLA 4CPBA 1XU2A 4HKLA 1OD5A 4FPLA 1DDLA 3I2IA 4GZ9A 4AI8A 4ES8A 5C4WB 4OHXA 1QJY3 1KEXA 4K21A 1CAWA 1Q8QA 2CAVA 2WJSA 2YHJA 1JZ4A 1MVEA 4E4SA 3ZLIA 1ZBA2 5FWJA 3MFCA 4R9DA 4KBZA 2XLGA 4DXTA 4EWAA 3ENRA 1ZRDA 3AZWA 1MEC1 3J8F3 4NAMA 3B00A 2EXJA 4Q4X2 2QQMA 5F39A 1FOD2 4DUXA 4BHPA 5JMOA 3ZFEB 2CSGA 1BK1A 1UZVA 1K12A 3GCXA 1RHI3 1WLDA 2R043 1S0CA 4LO5B 5DQ0A 3M4FA 2W68A 3VDAA 4Z92B 2AZ5A 3MW3A 1AL22 3SCGA 4A45A 2DV9A 5FPUA 2NLRA 3OYWA 5B4NA 3U4XA 4K1YA 2QNKA 5C9AA 5FZAA 1KRIA 5GZDA 1XSRA 2JIGA 2O14A 2WKKA 3POFA 1AR83 2WC2A 5FP7A 3EXUA 3P5BA 3VKLA 3GHNA 1HKDA 3T2QA 1WW6A 2YROA 2BBAA 4HKWA 5C3OA 4BDVB 4AI9A 5BXXA 2WFPA 1YJLA 4Y24A 5FO7B 3I3MA 2HBUA 3VBOA 2UY9A 1GANA 1CJDA 1UPSA 2KD7A 1MR5A 2OQ6A 3DKQA 3QLQA 3ROUA 3O1TA 1MPXA 3N35A 5ANNA 5EWZA 5M0TA 2GUCA 3E6YA 1UN1A 3AC0A 4CDWB 1EAH1 1PVC2 2C63A 3S6PA 4MXWB 3I49A 2D3PA 1YNAA 3T0LA 1L3JA 1XNCA 4E8CA 2VOWA 1HIXA 1ENQA 5IT6A 4A41A 3NNGA 4N43C 2ZEWA 4RR3B 4ZY9A 4IE5A 3ZYBA 3VD9A 4Q4V1 4WVMB 4B4RA 3BTYA 1UOJA 1H1IA 2D6NA 2F4PA 2BTPA 4V2WA 1ODNA 3POSA 2XXZA 3HN1A 3S5QA 2LTNA 5JCTA 3VDCA 3OGRA 2QQKA 1XOYA 1RL3A 2MHFA 3S7IA 4WM7A 5D8AA 5FP8A 3AZYA 1JMUB 4Q4W3 1KITA 1UOFA 1YFUA 1RUD2 1V6KA 2W94A 1DZTA 2IXJA 2OW4A 4IE0A 5FZ7A 4LBQD 2E26A 1BVVA 1D0HA 3VBFC 1W6OB 1LOFC 2SBAA 1C8M1 2NU5A 1ZM1A 3JBG2 2OUJA 5KHIA 3GALA 3SXWA 4FAHA 3QH7A 4N7GA 1KDKA 2LUWA 1ENSA 4NPMA 5JSOA 2OIIA 3LCPA 1COV1 4FOWA 4QX8A 5ACA1 1IS3A 3V64A 3I54A 3RJRA 3VBHB 5FZ8A 3K4AA 1IOAA 1CAXA 1JUIA 3ORJA 4P00B 4LHNA 4QU2A 5EXAA 1ONAA 2WYFA 4UW3A 5FYBA 1HRV1 3RYRA 4DRRA 5JZGB 1VIWB 5C7GA 3O1VA 1OOPB 2KR2A 4MOAA 1J83A 3NSTA 3UYJA 1O8PA 1TZOA 2FMDA 4PBOA 1RUNA 1NCQA 4LORA 5L9RA 4XAEA 3CKHA 4FFGA 4AHZA 4HK8A 3LPGA 1LESA 1ZRCA 1QJX2 4IV1A 1GKBA 2WYSA 1R1A3 2WO7A 2J7MA 1VBB3 3FLTA 4BLIA 3FFZA 2VECA 2CL2A 1RUD3 5BYNA 4Q27A 4R9BA 2D5HA 2EXIA 2PHTA 2QQUA 2WNVB 4DPNA 2FDFA 1VE0A 5HCHA 4LBQA 2QQLA 3BYWA 4XXPA 4KQ7A 5T50A 1DBNA 3MIGA 2WZ8A 5F3GA 2NN8A 2G4IA 2VNRA 3CO2A 4GD4A 4ZONA 1WCSA 2D98A 3VV1A 3Q8CA 5T5PA 4DHRA 3BPZA 4JTOA 1WBLA 1ZZCA 4LBNA 4DIQA 4OI0A 4KNCA 5IJRA 3UGFA 4A2UA 5JOYA 3VDBA 4AOCA 1XBFA 2YUEA 4BQXA 1RTVA 2RMU1 4AKBA 1XJAA 1H9WA 4DXZA 3PVEA 4PT6A 3ALQA 1UZYA 2ZTNA 1Z7S3 1F31A 1GV9A 1RUE1 1JOTA 3LL1A 4MX3A 2J1AA 2W3JA 1E57A 3WF0A 3O1UA 1S0GA 2C4XA 1QJX3 1PIV3 2BVBA 2WWJA 5EIYB 5KXDA 2BWAA 1AR71 3I2DA 1UX6A 4LR4A 5K7PA 1W3XA 2WSVA 3KF3A 2VCMA 1JACA 1UU5A 3ABZA 4LITA 1XNKA 2WR9A 2HYRA 2QZ2A 1R081 1U5ZA 3VZEA 4QPIA 4JGYC 2VGDA 3NJXA 3MW4A 3OEAA 1YUDA 4QXHA 3DYOA 5EYXA 1JZ3A 1PO11 1ULDA 2OZJA 1HQNA 1VR3A 5KHKA 1JYNA 1DYOA 4LO7A 3EQEA 1M26A 2BFUL 2XL7A 4IGQA 1J4TA 1EAH2 3UX0A 1RUC1 1BKZA 3GZAA 1JZ7A 4JDMA 3AP6A 2ZHLA 1NY71 4IETA 5JLVA 5BNOC 2YB7A 1D0GA 2ZABA 4QQLA 5FYTA 5FZBA 3WNMA 2Y6GA 3OPWA 1OQ1A 3KCYA 2BQ0A 1B35C 2DCTA 3CJIC 2VZTA 4DXRA 3AVSA 4Q4V2 4NIIA 1VBD1 3HD8B 1PO23 2VE1A 5IK7A 3ZXJA 3MIHA 2VZVA 1ULGA 1OMIA 4CUAA 5BNNC 4LTAA 3U07A 5LBBA 3AXEA 4LHSA 3LF7A 3SMNA 4Y1XA 2R072 4K7JA 4AEKA 4N43B 1N3QA 4YNIA 3R52A 5HCBA 5FPXA 3MIEA 3FX3A 4A44A 4Y1YA 3Q8BA 4J25A 4YW2A 2X5IC 1I5PA 1DFQA 3O12A 5J51A 4DY5A 5F74A 3ZN5A 4WBBA 2QQJA 4GNTA 5A3WA 1C8M2 4DHMA 3VD4A 1W9WA 3PVOA 3IQUA 2GP3A 3MPPG 4INDA 1ZYBA 1GZCA 3AP5A 2WZPP 3NJYA 3J26N 3TN93 1X8MA 4CZSA 1O3QA 1VMFA 4YW6A 1PGL1 5FPBA 1COV2 4R4ZA 5ACA2 3K51A 5BNPA 1D4VB 3CU8A 2FCVA 3VBFB 1V6JA 4WRQA 4XMAA 3ZMNA 3WD5A 1CIWA 1NA1C 2EIGA 1BZWA 3KLSA 4CP9B 5C8CA 1L7QA 5JM1A 1GFF2 4XJWA 5G04L 1NXD1 2ZCWA 1PZ7A 2P3YA 3W20A 3ZFGC 4DHQA 4DXSA 4YZ2A 5KXBA 2R16A 4RL7A 2R073 4QX2A 1G9DA 3J7NA 1S0BA 3C7EA 4TN7A 4YW1A 3GJAA 3UJQA 3T1LA 4A7ZA 5FWEA 4BQYA 4COVA 1IB1A 3VD3A 5LWBA 4C0HA 4DHOA 1F5FA 2OXBA 2ZX1A 4Y5TA 1AYN3 4QPWA 3T0AA 2D7FA 4YVWA 4EWEA 2WFF1 2N7GA 3VKOA 4LXLA 1VBA1 4XC9A 5GM0A 4NHKA 2VMCA 2R1BA 3JXSA 2IWGB 2ZX3A 4MLOA 1MQTA 1RVF1 4QM8A 2C26A 1OKQA 1XYOA 1UF2C 2JENA 1AJKA 5T52A 2E7QA 4OCTA 4YLZA 2Z5WA 1W9FA 4WV8A 5FY5A 5FMDA 1OKOA 1H8TC 1AVBA 4KGQA 2XJSA 3IQJA 3NMBA 1L7LA 5FPVA 2NM1A 4WZCA 1RIRA 2UU8A 4P5YA 5JPMB 1S2XA 4Z82A 3UV9A 5HV4A 4OQ8A 2WT2A 2TUNA 5C8WA 1O6UA 4PI2A 3AKQA 4RSUA 2EF6A 3ES1A 4NROA 4E27A 3M3CA 1REEA 1RUE2 1NQJA 3NAPC 1DQ5A 4B4QA 2ZMLA 4EN8B 3RI8A 1BEV3 1JYIA 4FTBA 4AVCA 5FZEA 2GU9A 1VMJA 3KV6A 5A3MA 3GBWA 4IQPA 4X6QB 4I09A 1AR72 1OXCA 2W1QA 2C1JA 2RR13 2XJUA 4MGKE 2WNOA 1EV13 2RJLA 3ZSJA 5FZCA 2BOIA 4C90A 1OVPA 1QH7A 3JQXA 1YYNA 3I59A 1R082 3MIDA 4IE6A 5FYZA 3K46A 1S2EA 3UALA 1VAVA 2DVGA 1EPZA 3AYCA 2IVIB 2ARAA 1YZ5A 1RC6A 3N9QA 2PMWB 2PQSA 3PTYA 5EFUA 4ZS3A 5FPLA 3WY6A 1FXZA 1FAYA 1PO12 3RZKA 4JC3A 1HW5A 1NCRA 1W6QA 3I59B 1OHFA 1YO8A 2ZBJA 1G6NA 2RS33 1GYKA 5LVZA 2G9GA 3IAQA 5ANQA 3WG1A 3BTZA 3P1OA 1ND2A 1RUC2 4J1XA 4XXAA 1W6QB 1F8VA 3R51A 1NY72 3OG2A 5F6KA 4IEXA 1GLHA 3MITA 5EWSA 3ZFFA 2GNDA 1O9EA 4CU6A 2XR4A 3NL1A 1BBT3 1RUE3 2DVDA 2QQWA 4EJRA 1UGWC 1Q3EA 4XJ8A 4Y1VA 2VCBA 1VBD2 1Q43A 1XQNA 1RUH2 2XONA 4YZ3A 1FPN3 2HWF1 3CJXA 1ZZ8A 4IEVA 1Y7BA 5LU2A 1F9KA 5BNOB 3AXDA 3TNQA 1DQ4A 3J7MA 1SEFA 4Z2WA 5BNNA 1SLTA 3P1RA 1N1SA 3MI8A 4GB31 1B35B 3CJIB 4XOGA 3RZMA 1LGBA 1PK6C 5AFEA 4XHBA 4Y5Z0 1QF3A 5D2DA 5L73A 1JN2P 5BNNB 1TP8A 2EXKA 3IZOA 3KS7A 3MPBA 4K9SA 4NWVA 2G9ZA 2VMFA 3KT4A 3WNXA 4DEVA 3RWKX 2G1MA 4NOTA 2P34A 4QWNA 2YYOA 1MVQA 2GUXA 2JB8A 4M3CF 1OF3A 3VKNA 1AX2A 4CEWC 4XABA 2UYBA 2X5IB 4COUA 1E5HA 1XE0A 2TBVA 2PELA 4AI0A 2XHNA 3WF3A 1PGL2 1X33A 1SBEA 4XFIA 5CZKA 2PN5A 1RUG1 3FLPA 5T54A 4AQTA 2XJPA 1XRUA 5IAVA 1EUUA 3MGUA 2VD7A 2TEPA 2E63A 2VY0A 1VLNA 4XIOA 2GNBA 2OYZA 5DMYA 4AEMA 4QGMA 4CA9A 4COYA 3U0ZA 1RUH3 5HI0A 5LZ6A 5AVAA 5L7OA 4AG4A 4K3UA 1UX7A 4BM8A 1NA1B 3UL2A 4UXAA 2LRPA 4N7YA 2WN3A 3OY8A 4PLMA 5IVCA 4YRDA 1RJ7A 3VHPA 3ZFGB 3T4VA 4FPKA 4GAZA 3M51A 2WFF2 3E5QA 1VBA2 3H3LA 3OY8B 4YM3A 3CZUA 1RVF2 1UY2A 3JD71 1G7YA 1XU1A 3C7HA 1Q5OA 1VJ2A 1VB4A 4OI2A 4FJ3A 2ZHMA 3BIWE 3DXTA 3TWIA 5CAZA 2VMDA 4FPJA 3H3UA 1VRH1 3R0RA 5EYYA 4BMEA 2J42A 4I30A 5B2GB 4QQPA 2J1UA 2YDEA 1LODA 1OFSA 1S2BA 3RS6A 1W8FA 3W21A 4AE2A 4AQ2A 4OI4A 1U0AA 2GC1A 4R52A 3ZSLA 4ISRA 1G8WA 1GP6A 2ZZQA 3IQVA 2FQPA 4AFMA 2HYKA 1GQPA 1H8TB 2DTWA 3AKPA 3USUB 3PJQA 1UD1A 3BU7A 1UXXX 2ZGNA 3LZZA 4PIZA 3FBYA 3O7OA 2OZ6A 3SP5A 4GH4A 1STMA 4P9YA 4XF0A 3WQ7A 5K0UA 2DVBA 2BVVA 3UK9A 3VBSC 4P9WA 5LASA 4UOJA 4HN0A 5EV7A 3SCFA 5E6HA 4XUOA 1SFYA 4ASMB 3NAPB 2C23A 3AJYA 3TAYA 1HDKA 1LRHA 1NQDA 5EHDA 1OC1A 1W6PA 4LKSA 4MGSA 4TYSA 1JI6A 3FHQA 4QXCA 2D97A 2P4EA 2ZGUA 4KMQA 4NRPA 5KHJA 3EYPA 1O5UA 3BTXA 3MLKA 5I91A 2WNUA 2QKDA 4N7IA 4DO0A 3AMHA 4XBNA 3O1OA 3KWVA 4QHZA 3I2HA 4NIGA 5A80A 3HEIA 4XJ9A 3W5NA 1HN1A 3OD0A 2V73A 2QTWB 3K75B 1C57A 3LAGA 1S2KA 3WNNA 4CUCA 3KD4A 2GC3A 5ABJC 2BW8A 4URAA 2FCTA 3B94A 3WW2A 1NUKA 5FLHA 5BNQA 5CFDC 1D2QA 5KWRA 2JXAA 3G7DA 1U5XA 4YVSA 5F2WA 4R6PA 4W8JA 2WQ4A 2VUJA 1AYM1 1VBE1 5KXCA 3T30A 2HWF2 3MLLA 5LK5A 5FV3A 1SLBA 3WW1A 1QJZA 1JZ8A 1UGYA 1LHWA 1K42A 3OSDA 2W2IA 3WP3A 1VAMA 3MIVA 4GB32 2V5DA 3DKWA 4LQRA 1YQ6A 3AMNA 4QPYA 1ND3A 1Y9QA 2QFEA 3TEZA 2WT1A 4PITA 1GOFA 1W06A 5F5QA 4BIOA 2L9LA 4NHLA 1SMVA 4JAAA 1WW7A 5J4TA 4HVOA 2DUOA 1IKQA 3LIGA 1PK6B 3KT7A 1OURA 5CYYA 1POV1 4PIFA 4LBMA 2ZA9A 3N36A 1H30A 4QDRA 3H7JA 4JDOA 2WH0A 3N9LA 3MUY1 4Y1ZA 4CRQA 2VOTA 3U11A 3A23A 2B46X 3VHRA 1AZDA 2Q1FA 1B09A 1WLCA 1RUG2 2V72A 2P5BA 4G9SB 2VMIA 2P3KA 3PHMA 5A7WB 3THPA 4BOWA 4CEWB 3GXUA 4DMIA 3O44A 4XF3A 1CPNA 1LOGA 2WS93 5JOWA 4MVTA 4UFJA 5D2AA 1W05A 2GN7A 4ZPIA 5HXMA 3S0MA 3GYDA 5CU1A 1JYCA 2YBKA 4DRVA 5FUNA 4M3CE 1OLQA 4PLNA 5DAQA 1UMZA 2XJTA 1N3OA 5A7PA 3N7JA 3VHNA 1XXQA 3ELNA 4RQPA 5GZFA 1KD7A 1AR93 3MHZA 3KCXA 3NV3A 2DURA 4Q8KA 3IM0A 4ATFA 4OUEA 2BQPA 3RYKA 4CDQA 4PDWC 1W0NA 1W6MB 5DDJ3 4CP0A 3KCCA 1CAVB 5T5JA 4C1XA 3SITA 4UI9L 3JD72 2BN0A 4CDUA 3ZYFA 3MV11 4DUVA 4XE9A 3ZXFA 4EQVA 1SBFA 1VBC2 3PMEA 1VRH2 3ZPOA 2VZSA 3RZLA 2P2KA 1O9DA 3QCWA 2XVLA 1PMIA 5FXXA 2JDPA 4Z1VA 4ISQA 3MO4A 5A3TA 1VBPA 2W1SA 3RWNA 2J1EA 2ERFA 4DHSA 4JQRA 4A3ZA 1JOBA 2BRTA 5I0SA 4Q4Y2 1DYKA 4YGDA 2X10A 4L9BA 3D6EA 5FIXA 5A33A 2WLQA 1YLLA 1ZBE1 2JDHA 4P9GA 1KS4A 5C3PA 2RJKA 5H9SA 4QD2A 2DCKA 4ASKA 1H2MA 2CAUA 3WHUA 2XBO1 3A0KA 3K48A 3M3EA 4FO9A 3KQ4B 2VMHA 2RHPA 2HWC1 2VBPA 4JC1A 3RSJA 1WKYA 3ZYJB 5A33B 1KU8A 3THCA 2OX0A 1XE8A 4A6SA 3O1RA 2ARXA 3LPFA 5CNAA 5LX2A 3DF0A 1SCSA 1UIJA 2FDJA 3I4IA 4META 5J37A 4AW7A 4ONUA 3OUHA 1GWLA 3PU8A 4AEJA 1V6LA 5FZDA 2GP5A 2VNOA 5F9TA 4N53A 4A7KA 1RUF3 3SH3A 3GBFA 2XQRA 3K4ZA 3VBSB 4CTEA 5CFCA 5FZOA 1VBC3 4UT5A 2ETEA 5J7MA 2IVJA 2FDIA 4FPYA 3IPVB 1VRBA 1WCQA 2GALA 3JB4C 4LE3A 3E6CC 1H6YA 1HJFA 2J22A 4FAGA 3KM5A 3HVDA 3CIHA 1Q8VA 4YGCA 4ZXEA 4Q4Y3 4CDXA 4D0QA 4LHLA 1XYNA 2GUEA 5IUQA 4NN0A 3WR0A 5F3CA 4Z8BA 3BGAA 4Y1UA 4XETA 4CDXB 2HYQA 3F2ZA 2A71A 1KJLA 5FPAA 2V4VA 4LBOA 1FX5A 3LA3A 4AEDC 1IPSA 1D4M1 1VBE2 5DUXA 2GSYA 2A6XA 1LOEA 3AQGA 1XYPA 4UFKA 2UWCA 4GA9A 2WZR1 4NRMA 5ABJB 1A4OA 4JTNA 1RINA 5CFDB 5J96B 4HXCA 1X1VA 3RQ0A 4Q5OA 3KSCA 4C91A 3EB7A 4CYDA 1QQP2 1IG0A 1RMU1 4UFMA 5HF3A 4CCDA 1Q8SA 1W0PA 3WDWA 4IEQA 5DZEA 4AI2A 3P1QA 3B9CA 4OMDA 4QKBA 2XPJA 4EYUA 2X8KA 3FBMA 2BGOA 2RV9A 3VKMA 3NNLA 2ARCA 4YM2A 5ERLA 4ET7A 1ULCA 4IV3A 1QJU2 1HRI3 3B02A 3U75A 4UF0B 5DAPA 4B1MA 1MS9A 4HK9A 1BHGA 1H8VA 3ZM8A 1S0FA 1W90A 1A37A 2C0ZA 2DFBA 3KMHA 5A6ZA 3NJZA 2YC0A 4TLFA 4Q0UA 3OEBA 4L8QA 1UPIA 5J98B 1S0IA 1QWRA 1YFYA 4UBGA 5FBZA 1S0EA 4E9KA 2R061 5C4WA 5JWPA 4TTGA 2O02A 3OD4A 5DUVA 2PLV3 3SEEA 1AR61 1QEXA 1PXDA 4IE7A 2V4AA 4FXKB 4YW7A 2A3XA 4D3WA 3I2JA 4Y3BA 1FATA 1S0JA 2WRAA 2JDAA 3P6BA 3V56A 3LFIA 4ZU7A 4D94A 2B42B 1XPWA 3SMLA 1QQP3 2BV4A 3PIGA 3ZFEA 5A6XA 2BBVA 4NPLA 1LU1A 2UWAA 4R6OA 5J31A 3FZ3A 1V00A 4XF4A 3WUCA 1JTZX 4XDPA 4YYOA 2BJSA 4RHV1 3DUIA 1QJU3 2JE9A 5I0DA 3ZOIA 2GNMA 3PL0A 5FYYA 2W1WA 5FY0A 3WLUA 4PDWB 2ZKNA 4GWMA 4UFIA 1X7NA 5A3PA 3IDEA 2WO3A 4FOVA 5CVRA 4I0BA 1TE1B 2OS2A 2VXRA 4QQHA 4E4ZA 1JYWA 1OT5A 3OTFA 3O1SA 1URXA 2WQZC 2BUKA 2H0BA 5FP4A 3FHAA 1O7FA 5F8PA 1JHJA 3SC7X 2Q1ZB 2CV6A 1AXKA 4BA6A 4PIUA 2WUHA 3E5XA 3N7MA 4LBLA 4M4RA 5H9QA 4S2HA 4CDWA 1TMF1 5IYYA 2XBO2 1JOPA 2R30A 3KV5A 4MXWA 2HWB1 2HEYF 2XHKA 1GICA 3CHXA 2H6BA 2R0FA 2YY1A 3BOPA 2SLIA 2Q4SA 4RR3A 4WVMA 1ZBA3 1TNRA 2WQ8A 1YI9A 2IXCA 1DGRA 3MBWA 5F5IA 3POIA 4OHWA 4R6RA 3RRDA 1GUIA 4BISA 2W87A 1S1AA 2Y60A 4Q4X3 3GZEA 1J3QA 1FOD3 3A4UA 3GGLA 3MW2A 3OBTA 3OOXA 4HG6B 3S30A 3OBAA 3WVJA 2XH6A 1J84A 2ZXQA 1DQ1A 2JX9A 1N47A 4PQQA 2C9KA 1IPKA 4RN5A 5LBFA 3N4MA 3SHRA 1AL23 1PX4A 2VG9A 4N9HA 1LOCA 2PAEA 4FPGA 4CU9A 4B7EA 3NKXA 2IC1A 4JRAA 3IAPA 4L92A 4UW4A 4OHYA 1LHVA 4QB2A 4BQ5A 1N1TA 3POYA 1TG7A 1QDOA 1W6OA 1ZVFA 5CG8A 4FTEA 5GZEA 4OHVA 1W39A 3W5MA 2JG8A 3CQCA 2QDNA 3AMMA 2XQXA 3LLYA 2WABA 2C74A 1HQLA 4Q1PA 4DATA 1DZRA 1FI2A 3C8XA 5GLTA 1IPJA 5FZIA 1H9PA 1WD4A 2R49A 4FFFA 3N7KA 4MXVA 2B9UA 3OCPA 2JG8B 2ZGRA 4AVVA 4IEUA 3VBHA 1D4M2 2Y38A 2XWBB 4Y4YA 4AGVA 4R6QA 2EXHA 1PVC3 5JZGA 2HWE1 5JVVA 3ZYPA 1OQEA 3WDTA 4AVAA 4ZZ8A 2WZR2 1K5MC 3ON7A 3EFZA 3PUAA 1I1EA 1OOPA 2W91A 3D82A 4F7RA 4DOUA 4MHUA 3BCWA 5JIAA 3RVHA 4AEDB 4AXOA 5FZ0A 1RMU2 3K3OA 3LD8A 4XUTA 5C3SA 4EE2A 5C33A 4C1WA 2Q8DA 3C3VA 2OKXA 2HJIA 4IDZA 2WT0A 4XFAA 1UWWA 1EYBA 4E2SA 5K9YA 4NE9A 4B29A 2XJRA 4BQ2A 3ZXKA 2D6MA 1UKGA 1QKQA 2OPKA 2WNVA 1ST8A 4N84A 4Y20B 5AC91 3NWKA 4QX3A 4XDQA 3AYAA 4CEYC 1KUJA 2JDKA 3TRSB 3AKSA 5FK7A 3P1IA 1SCRA 2F6BA 1C8NA 1ENRA 1UU6A 1WCUA 2ZHKA 3FUQA 4QDSA 1N3PA 2XKPA 2R062 3JBG3 4HVRA 4NIHA 5FZGA 3KVAA 4I2OA 5F5AA 1HJGA 3WP4A 4XQ4A 2EIDA 2Z4FA 3AB0A 2Q5TA 1AR62 3ZIXA 2Z79A 3AK0A 4FPEA 3JUUA 5CIRA 4CCEA 4AQSA 1XXRA 4UW6A 5FY4A 3V65A 5K4LA 3WZ1A 3ILNA 2A6YA 5KC5A 4K6BA 3OGSA 4DHPA 1JXNA 4FI9A 4YWAA 3MF9A 2ZHNA 2BMYA 3MICA 4LKFA 1VMHA 1MEC2 3MIFA 3HNMA 1OLMA 5DAWA 2JG9C 4D7SA 2YC2A 3E6DA 1OA4A 3FHIB 3KV4A 3WCRA 2K0GA 4ZXKA 2HEVF 3HN3A 4RHV2 3Q9OA 2GAUA 5A3UA 3MZHA 1DZQA 4RGGA 1J3RA 3S7EA 3B5LB 1JUHA 4AFCA 5JMCA 1OQDA 2A75A 1NZIA 2PAMA 3IDBB 4SBVA 4BXFA 3BKZA 2W47A 1H1AA 3PUIA 2KA3A 3WQ0A 4BB3A 2R063 1GU3A 2Q30A 2W92A 4RD7A 1UO9A 3BODA 2A73B 1OI6A 2YPDA 5I0RA 4BQ3A 2AYHA 2ZGMA 4D8MA 3HBZA 3WNPA 2C1FA 1SACA 1TMF2 3FN9A 5CISA 1YJKA 2HWB2 4TZDA 2IUWA 3I4RA 1RUI1 1GNZA 1GWMA 3UGHA 1NT0A 2A3WA 2CY6A 2BR9A 3ETQA 3I3QA 3T2OA 1VAKA 1I3HA 3E97A 2ZKLA 5JDBA 4GWIA 4HMZA 1NOVA 1MEC3 3UBWA 5FZMA 5JR2A 4YM0A 3H50A 2VU9A 3UESA 1ULPA 2AENA 5DN2A 4DEQA 3TB0A 4P14A 1QOOA 3D8CA 4N43A 3LDKA 1O5LA 4DZGA 3LM1A 1C1FA 2EA7A 3ZSKA 4AI1A 2PAKA 3H1YA 3RZHA 4CSWA 1YQ8A 1ZZBA 4RFRB 3U14A 3QACA 2VW1A 3E5UA 5J50A 3V0AB 4ARYA 4WM8C 5BY5A 3RMXA 1KS5A 1YHFA 2LM3A 5K8SA 4DAUA 3M70A 1UQXA 3RG0A 4LMFA 3MV01 4MZUA 1WMDA 4C0BA 2FDGA 3KHCA 2CGPA 2BWCA 3QOPA 2JEMA 1HXS1 4XJZA 2MEV1 4B4PA 5LEJA 4MGTA 1WS5C 4SLIA 4B7KA 1UMIA 4GULA 4JQTA 4BQWA 2Y6KA 3N9PA 2ZOEB 3J7LA 3OBZA 3VBFA 3DXUA 1LOFA 1TME1 3PNAA 1W03A 1HV0A 2IXKA 1EAH3 4MGIE 1CR7A 2DCJA 4CP9A 3W9AA 1W9SA 2HWE2 4O46A 1UGXA 4OYUA 5GKAC 4BCUA 4JGZC 5IWFA 5IVJA 5FXWA 5L36A 3FWEA 3SMKA 4XAAA 2XLAA 1F15A 1NAEA 3EO6A 4HPKA 3V0BA 3OBRA 5FYCA 2VBDA 4Q4V3 1FNYA 5I8TA 1HRV2 3WF2A 3RZZA 2ET1A 4CU8A 3POWA 2Y8KA 1EUTA 1DGLA 1K5MB 1IS5A 4HPKB 3V0BB 3U78A 3W59A 4YFZA 2ZEZA 2VOKA 4IGPA 3GBGA 1GOHA 3VZKA 3IT8A 3UETA 1OUSA 1RXFA 2O98A 1GWKA 2KXLA 3CBNA 4YPJA 1FMD1 4QLIA 1YCIA 1CJPA 5FYUA 3ZXGA 4EROA 3KT1A 4R4XA 5AC92 3CMGA 4EN6B 3RJ2X 4XZUG 4CVUA 3M50A 4AR2A 2PHLA 4I01A 1C8M3 1GQHA 2CGOA 4PJYA 5IK4A 1A38A 1POQA 2RM21 2VVFA 3ZN4A 1GSLA 4CEYB 1WMEA 4DS0A 5FDBA 4DX0A 1W8WA 2WBKA 1COV3 2VQAA 1D2SA 4XIKA 2ADDA 1E5RA 2AGSA 5ACA3 2WZEA 4RS5C 2Q1MA 1YI7A 4O7XA 2R0HA 4CXWA 1CGPA 3SH5A 5FRAA 1O3RA 3CZJA 1GZWB 1HRV3 1OF4A 4HT1T 4DQAA 2RMU2 2W52A 4OHZA 1A8MA 4I0WB 2ZMKA 3L2YA 1WCKA 5GZGA 3O8IA 1H4HA 4M3CB 3PMSA 4NAOA 3WV6A 2ZGTA 3OGVA 5LBEA 4LK7A 5CKMA 1US3A 1H0BA 1XEZA 3LB9A 4JV4A 4O9GA 2ET7A 4W6YA 2DU1A 1LEDA 3GCWA 3LA2A 3VKFC 4AZZA 2JG9B 4EV0A 2ORZA 4QHBA 3M1HA 3ZYGA 1XNAA 1CQ9A 1UYZA 4KG0A 4HONA 2HH9A 2E7TA 3KZ4C 5L19A 5FY9A 1ULEA 1PZ9A 3VDDC 3H8XA 1NXMA 3IN9A 3NKGA 4KWJA 1PHMA 4JGYA 4J6GA 4L0PA 4LA3A 5A1FA 3THDA 4L2NA 1RUI2 2PTMA 3POGA 5FXZA 1DQ2A 2PHDA 2YMZA 2HWD1 3CNAA 3IDCB 4JGYB 5T5OA 3A22A 2XJVA 5T55A 4COZA 3AZVA 4P5HA 2RMU3 1ASJ1 3M2MA 2BNOA 1UYPA 2RDNA 2DBIA 1GBGA 2VZOA 5BNOA 2NP0A 5FYVA 3WUDA 1QGLA 1CESA 1US2A 5HCAA 5C70A 3ZDSA 1B35A 3CJIA 3VBUC 4J6SA 3INAA 2AREA 4GMP1 2P37A 5BPXA 3AL5A 4EZHA 5C71A 1RGSA 2A6WA 3EBRA 1WW5A 4HZFA 2VMGA 3VZGA 1C3HA 2ZX2A 1AR73 1PX3A 5I0UA 3MUZ1 1F35A 2ID4A 3DPRC 4KGGA 3ZYHA 4LT5A 4OLLA 2BPA2 1S55A 1UIKA 3HNYM 3MDPA 2YC4A 3UT0A 4XCAA 3NKTA 3UKVA 1R083 4R9CA 4OMCA 3PUHA 4PQ9A 5FUIA 2X5IA 4QQ2A 3R6SA 3KF5A 1HXS2 2D3SA 2MEV2 1G9FA 4WM8B 1PO13 1WW4A 3PIJA 4CCKA 1ZRRA 4UFHA 3SKVA 2B5HA 1TME2 1OD3A 5E8AA 1XC6A 4R8HA 1DYPA 1RUC3 1QOSA 3I8TA 4IGOA 2IXLA 3POBA 1NE4A 1OH3A 5A3NA 3BIEA 4XJAA 4W4ZA 2Q8EA 2VTXA 5EJ1B 4FT8A 1ULFA 4A6OA 4AFAA 3VL8A 4H3WA 4BMBA 2AEZA 1Q8PA 3K4DA 5IVVA 5CG9A 1NA1A 2XL9A 1VBD3 1Q8OA 1LGCA 2XVGA 3DYMA 1W2UA 4JGZB 5H9PA 1ZZ7A 4IEZA 1A34A 3ZFGA 1MS0A 4QM9A 1J1LA 5IVFA 2J1SA 2VTXJ 2Y6LA 4TXWA 2D3RA 3NJVA 1RXGA 1X36A 4YG0A 5E89A 4ZHNA 3HT2A 2Y64A 4K1ZA 1WWYA 1W8UA 4MYEA 4XW3A 2EVXA 1FMD2 5A7QA 5T3NA 4RYDA 2D6LX 1ZZ6A 1YFWA 3LDRA 2XUEA 2NYYA 1KDMA 3ILFA 3WG2A 4Y5IA 2HLEA 4BG6A 2VO5A 3UKNA 1CPMA 4OFGA 2XLFA 5DZFA 1W8TA 5G05L 2DFCA 2NPMA 2WAAA 3PVBB 1YIFA 2RM22 4LBJA 2BERA 1GZ9A 1AJOA 4GWJA 1NX9A 1IQDC 1MZEA 2ZGLA 1GNYA 1F4HA 1O59A 4OULA 5LW9A 2QP2A 4D6QA 5FCCA 2Z2SB 4AL9A 1H8TA 3IMMA 3WG3A 1XNDA 3EJKA 3USUA 1ULOA 3MFAA 1V9U1 4AHWA 1HQWA 1KFXL 3ZSEA 2CTVA 2E9QA 3CLPA 1NZCA 4I0AA 4AGRA 1R091 1JZ6A 4LBKA 3ITQA 4WVWA 2A6VA 3HPNA 1CAUB 3HQUA 2QQPA 1QHDA 2B7YA 2VNGA 1C5IA 4QX1A 1O4ZA 1PVXA 3G6JB 4LO4B 1FV2A 4XACA 1LULA 3NAPA 5EXGA 4IERA 4WVZA 4XFCA 1FMD3 4YG3A 1W28A 1JYTA 2O8QA 1SLCA 2WFF3 4H2AA 1WS4C 4OZOA 4LOSA 1LNSA 1VBA3 5FO9B 3RZGA 2Y34A 3OUJA 4HBNA 4QB1A 1C3NA 1X9TA 4NIAA 4MUVA 1RVF3 1SDDB 4CP1A 2PHUA 4GKXA 3C2UA 1SLLA 2RJ2A 3AZXA 4YM1A 1Y9MA 3HT1A 1CONA 1WZXA 1R64A 3CL1A 5EPAA 3WF1A 4CCCA 1GQGA 1O4YA 4IEWA 5A70A 2VZ3A 1PM4A 4Q8LA 1RUJ1 4OVEA 2J1RA 2RDRA 1ZX5A 3WP6A 4AI3A 5FZ3A 2IFRA 3VZLA 3OJBA 3VZOA 1WLWA 2HWD2 1Y3TA 3I2FA 3VDDB 2E53A 2JKXA 3MF6A 4AFBA 3LL2A 1LGNA 5C3QA 5IK5A 2RS11 3ZPYA 3M7AA 1ASJ2 2JD4A 1U5IA 2XOMA 4UFLA 3B7MA 3ASIA 5I93A 4Q2FA 3WDVA 5FUPA 3NO8A 2VL4A 4MV2A 1W9TA 4Q0QA 3LLZA 4AFDA 1UGWA 2Y6FA 4ZDRA 1PGSA 2E31A 1AL0G 1K3IA 4GXLA 3UJOA 4LUKA 1W8ZA 4QPGC 2PHRA 5DG1A 4AK3A 5FKBA 4H7LA 1IKPA 5DPNA 2GTYA 4Q26A 1UZWA 3HR9A 5BUVA 3VBUB 2ZGQA 1PK6A 2PA7A 1UH0A 3I3DA 1H4GA 2BMZA 5A32A 2ZGPA 4MGZE 2R32A 1UAIA 2QZ3A 1H2LA 4JKMA 3C7GA 1UY3A 3KHBA 2E51A 4A42A 2BGPA 3AXYC 4XFFA
chains in the Genus database with same CATH topology
3SEEA 2J1AA 1UYXA 2W3JA 5LA0A 3WF0A 2VM9A 2VC9A 2C4XA 4ARXA 3I2JA 3NRUA 2JDAA 5EIYB 1JYXA 3ECQA 3P6BA 3ETPA 5JXHA 5JXIA 1XPWA 2QQIA 2VZUA 4ZZ5A 3ABZA 4Z2AA 3VD5A 3NJXA 3OEAA 3WNLA 3DYOA 3IIIA 5I0DA 1JZ3A 2W1WA 1JYNA 1DYOA 2WO3A 2QQNA 1JZ7A 2J1TA 1OT5A 2VZPA 1JYWA 2WO1A 2YB7A 3WNMA 4W50A 2WDBA 2Y6GA 3FHAA 3K77A 1JHJA 3WSOA 1W8NA 4DXRA 2WUHA 2VZTA 4M4RA 5IHRA 5IYYA 2W9XA 2VZVA 1O8SA 2VZRA 2WO2A 4CUAA 4LHSA 3U37A 2X09A 3GDBA 4A44A 2WQ8A 3MBWA 3T08A 1GUIA 5A1AA 2W87A 4JX0A 2YFZA 3T2PA 1I5PA 4HG6B 3GGLA 3IDAA 3OBAA 3GM8A 1CZVA 1J84A 2ZXQA 1W99A 2QQJA 4PQQA 2C9KA 4RN5A 2VZQA 1PX4A 3VD4A 1W9WA 4CU9A 1UMHA 3IAPA 4QB2A 2LS6A 1TG7A 3CDZB 3LEIA 3DYPA 2X05A 3LEKA 3OB8A 3W5MA 2XQXA 2WABA 1L7QA 3C8XA 5G04L 4JHZA 1NKGA 4DXSA 2CDPA 4JKLA 4QX2A 3C7EA 3E1F1 4ZZ8A 1JYVA 3VD3A 2W91A 3T0AA 3J7HA 4QPWA 4KWUA 4XURA 2VMCA 3JXSA 4XUTA 2C26A 2OKXA 1UWWA 4BJ0A 2W5FA 3WNKA 4QX3A 1UY1A 2JD9A 2VCCA 2VQTA 4P5YA 3P1IA 2VQUA 3C7OA 4XUQA 4QDSA 5F7UA 5EJZB 1L7RA 2EIDA 2Z4FA 3T0DA 5HPOA 4KI5M 2VMEA 2B9VA 2W1QA 3OGSA 3WNOA 4FI9A 2EIEA 5IFTA 3HNMA 2YC2A 3K46A 1W8OA 2PQSA 3HN3A 3WEZA 3IAQA 2BZDA 2W47A 3PUIA 3OG2A 2W92A 1GU3A 4CU6A 3SEPA 5LA2A 2VCBA 4D8MA 2XONA 3T09A 3WNPA 3FN9A 4MGQA 3BN6A 3LQCA 1XNTA 3T2OA 5JXJA 2ORXA 4GWIA 2J1VA 5JR2A 5JXGA 2ZEYA 2VMFA 3UESA 4DEVA 1ULPA 3ACHA 5DN2A 4DEQA 2LW8A 2VJXA 1OF3A 3HNBM 2XHNA 3WF3A 4ARYA 5CZKA 1PMHX 1EUUA 3MV01 4BXSV 5DMYA 4LPLA 1P8JA 1T2XA 3WF4A 1UMIA 2Y6KA 4XUPA 4AG4A 1F4AA 1UX7A 4IUGA 2QQOA 4QAWA 3HJRA 2DCJA 3WQBA 1W9SA 5LCWL 2WN3A 4P08A 3T0BA 2ZEXA 4OYUA 1CZTA 4A4AA 2VCAA 1NAEA 1H6XA 4QX0A 1YQ2A 3WF2A 1JU3A 1SHWB 3CZUA 4CU8A 1UY2A 2Y8KA 3C7HA 1EUTA 1KGYA 3LE0A 2VMDA 2ZEZA 1GOHA 3LEGA 3UETA 2J1UA 4YPJA 2DDUA 5J1XA 3CMGA 3I97A 4XZUG 4CVUA 1GQPA 4MADA 3IB3A 1CIYA 2CDOA 1UXXX 2W95A 4E8DA 5B4XA 3CQOA 2WBKA 2YG0A 4JKKA 2WZEA 3A7QA 5JUVA 4CU7A 4UOJA 4XUOA 1RYYA 4PF1A 3CZJA 1OF4A 2E32A 2VZ1A 4LKSA 4MGSA 1JI6A 3FHQA 4BK5A 2JE8A 4KMQA 3OGVA 2YFUA 3EYPA 1US3A 3FL7A 1JZ5A 3I3BA 1GOGA 1UY0A 3I2HA 4M4PA 3HEIA 3W5NA 2QBXA 1HN1A 2ORZA 1SG3A 1XNAA 3K75B 1UYZA 3NQHA 4QDQA 1DP0A 1DLCA 3WNNA 4CUCA 4AAXA 1NUKA 2Y6JA 4W8JA 4L0PA 3THDA 1JZ8A 2Y6HA 1K42A 2V5DA 4LQRA 3A22A 2W1UA 4XVHA 3HOBA 2VZOA 1GOFA 2L9LA 1K45A 1US2A 3ACIA 5C70A 2R7EB 2HYXA 5C71A 5CYYA 4QDRA 3I2IA 4GZ9A 1PX3A 3MUY1 2VOTA 1KEXA 3MUZ1 2ID4A 3A23A 1JZ4A 3HNYM 2YC4A 2V72A 2VTFA 4DXTA 4OMCA 3PUHA 3GXUA 5FUIA 2VR4A 1UYYA 2QQMA 4DUXA 5JMOA 5HXMA 3UNPA 5DQ0A 1K12A 3VDAA 3SKVA 1OD3A 1XC6A 4A45A 4XUNA 3A21A 3DECA 5B4NA 4W4ZA 3X0UA 4OUEA 5EJ1B 4A6OA 3K4DA 1W0NA 1TVGA 3T2QA 2BBAA 4P02B 4BDVB 4UI9L 3DYMA 3ACGA 3MV11 4DUVA 1D7PM 2KD7A 2VZSA 2J1SA 2Y6LA 2E33A 1MPXA 3C7FA 4TXWA 3NJVA 1CX1A 3AC0A 3MO4A 2Y64A 2W1SA 2J1EA 4RYDA 4A3ZA 2X10A 4E8CA 4CUBA 4A41A 2HLEA 2W46A 2VO5A 2ZEWA 3NNGA 4ZY9A 3VD9A 2DCKA 4BK4A 5G05L 2WAAA 2BERA 1GMMA 1WKYA 4GWJA 1NX9A 3VDCA 1IQDC 3THCA 3OGRA 1GNYA 1F4HA 1O59A 2QQKA 3LPFA 1CZSA 1OH4A 2EICA 4UAPA 1ULOA 1UZ0A 1JZ6A 2W94A 3HPNA 2E26A 3K4ZA 4QX1A 4QB6A 3I2GA 1UXZA 1WCQA 1H6YA 2J22A 4ZXEA 3CIHA 4D0QA 4OZOA 1LNSA 2RVAA 4QB1A 3K4AA 4P00B 1SDDB 2B4KA 1JZ2A 2RJ2A 3BGAA 2WN2A 5C7GA 1R64A 3WF1A 3F2ZA 3D3AA 4MOAA 1J83A 2V4VA 1O8PA 3SKJE 2VZ3A 3CKHA 2J1RA 4DUWA 3I2KA 3LPGA 1UY4A 1PMJX 3I2FA 2JKXA 2WYSA 2WAOA 4MO3M 2J7MA 3EB7A 3ACFA 2XOMA 3VD7A 2VL4A 4OMDA 2QQLA 1W9TA 5IFPA 2BGOA 2E31A 2RV9A 1K3IA 2WZ8A 4ET7A 1JU4A 5DPNA 1BHGA 3ZM8A 5IJRA 3VDBA 3I3DA 3I3EA 5LA1A 3OEBA 4JKMA 3C7GA 1UY3A 2EIBA 4TTGA 4PT6A 4A42A 2BGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEE A;  2J1A A;  1UYX A;  2W3J A;  5LA0 A;  3WF0 A;  2VM9 A;  2VC9 A;  2C4X A;  4ARX A;  3I2J A;  3NRU A;  2JDA A;  5EIY B;  1JYX A;  3ECQ A;  3P6B A;  3ETP A;  5JXH A;  5JXI A;  1XPW A;  2QQI A;  2VZU A;  4ZZ5 A;  3ABZ A;  4Z2A A;  3VD5 A;  3NJX A;  3OEA A;  3WNL A;  3DYO A;  3III A;  5I0D A;  1JZ3 A;  2W1W A;  1JYN A;  1DYO A;  2WO3 A;  2QQN A;  1JZ7 A;  2J1T A;  1OT5 A;  2VZP A;  1JYW A;  2WO1 A;  2YB7 A;  3WNM A;  4W50 A;  2WDB A;  2Y6G A;  3FHA A;  3K77 A;  1JHJ A;  3WSO A;  1W8N A;  4DXR A;  2WUH A;  2VZT A;  4M4R A;  5IHR A;  5IYY A;  2W9X A;  2VZV A;  1O8S A;  2VZR A;  2WO2 A;  4CUA A;  4LHS A;  3U37 A;  2X09 A;  3GDB A;  4A44 A;  2WQ8 A;  3MBW A;  3T08 A;  1GUI A;  5A1A A;  2W87 A;  4JX0 A;  2YFZ A;  3T2P A;  1I5P A;  4HG6 B;  3GGL A;  3IDA A;  3OBA A;  3GM8 A;  1CZV A;  1J84 A;  2ZXQ A;  1W99 A;  2QQJ A;  4PQQ A;  2C9K A;  4RN5 A;  2VZQ A;  1PX4 A;  3VD4 A;  1W9W A;  4CU9 A;  1UMH A;  3IAP A;  4QB2 A;  2LS6 A;  1TG7 A;  3CDZ B;  3LEI A;  3DYP A;  2X05 A;  3LEK A;  3OB8 A;  3W5M A;  2XQX A;  2WAB A;  1L7Q A;  3C8X A;  5G04 L;  4JHZ A;  1NKG A;  4DXS A;  2CDP A;  4JKL A;  4QX2 A;  3C7E A;  3E1F 1;  4ZZ8 A;  1JYV A;  3VD3 A;  2W91 A;  3T0A A;  3J7H A;  4QPW A;  4KWU A;  4XUR A;  2VMC A;  3JXS A;  4XUT A;  2C26 A;  2OKX A;  1UWW A;  4BJ0 A;  2W5F A;  3WNK A;  4QX3 A;  1UY1 A;  2JD9 A;  2VCC A;  2VQT A;  4P5Y A;  3P1I A;  2VQU A;  3C7O A;  4XUQ A;  4QDS A;  5F7U A;  5EJZ B;  1L7R A;  2EID A;  2Z4F A;  3T0D A;  5HPO A;  4KI5 M;  2VME A;  2B9V A;  2W1Q A;  3OGS A;  3WNO A;  4FI9 A;  2EIE A;  5IFT A;  3HNM A;  2YC2 A;  3K46 A;  1W8O A;  2PQS A;  3HN3 A;  3WEZ A;  3IAQ A;  2BZD A;  2W47 A;  3PUI A;  3OG2 A;  2W92 A;  1GU3 A;  4CU6 A;  3SEP A;  5LA2 A;  2VCB A;  4D8M A;  2XON A;  3T09 A;  3WNP A;  3FN9 A;  4MGQ A;  3BN6 A;  3LQC A;  1XNT A;  3T2O A;  5JXJ A;  2ORX A;  4GWI A;  2J1V A;  5JR2 A;  5JXG A;  2ZEY A;  2VMF A;  3UES A;  4DEV A;  1ULP A;  3ACH A;  5DN2 A;  4DEQ A;  2LW8 A;  2VJX A;  1OF3 A;  3HNB M;  2XHN A;  3WF3 A;  4ARY A;  5CZK A;  1PMH X;  1EUU A;  3MV0 1;  4BXS V;  5DMY A;  4LPL A;  1P8J A;  1T2X A;  3WF4 A;  1UMI A;  2Y6K A;  4XUP A;  4AG4 A;  1F4A A;  1UX7 A;  4IUG A;  2QQO A;  4QAW A;  3HJR A;  2DCJ A;  3WQB A;  1W9S A;  5LCW L;  2WN3 A;  4P08 A;  3T0B A;  2ZEX A;  4OYU A;  1CZT A;  4A4A A;  2VCA A;  1NAE A;  1H6X A;  4QX0 A;  1YQ2 A;  3WF2 A;  1JU3 A;  1SHW B;  3CZU A;  4CU8 A;  1UY2 A;  2Y8K A;  3C7H A;  1EUT A;  1KGY A;  3LE0 A;  2VMD A;  2ZEZ A;  1GOH A;  3LEG A;  3UET A;  2J1U A;  4YPJ A;  2DDU A;  5J1X A;  3CMG A;  3I97 A;  4XZU G;  4CVU A;  1GQP A;  4MAD A;  3IB3 A;  1CIY A;  2CDO A;  1UXX X;  2W95 A;  4E8D A;  5B4X A;  3CQO A;  2WBK A;  2YG0 A;  4JKK A;  2WZE A;  3A7Q A;  5JUV A;  4CU7 A;  4UOJ A;  4XUO A;  1RYY A;  4PF1 A;  3CZJ A;  1OF4 A;  2E32 A;  2VZ1 A;  4LKS A;  4MGS A;  1JI6 A;  3FHQ A;  4BK5 A;  2JE8 A;  4KMQ A;  3OGV A;  2YFU A;  3EYP A;  1US3 A;  3FL7 A;  1JZ5 A;  3I3B A;  1GOG A;  1UY0 A;  3I2H A;  4M4P A;  3HEI A;  3W5N A;  2QBX A;  1HN1 A;  2ORZ A;  1SG3 A;  1XNA A;  3K75 B;  1UYZ A;  3NQH A;  4QDQ A;  1DP0 A;  1DLC A;  3WNN A;  4CUC A;  4AAX A;  1NUK A;  2Y6J A;  4W8J A;  4L0P A;  3THD A;  1JZ8 A;  2Y6H A;  1K42 A;  2V5D A;  4LQR A;  3A22 A;  2W1U A;  4XVH A;  3HOB A;  2VZO A;  1GOF A;  2L9L A;  1K45 A;  1US2 A;  3ACI A;  5C70 A;  2R7E B;  2HYX A;  5C71 A;  5CYY A;  4QDR A;  3I2I A;  4GZ9 A;  1PX3 A;  3MUY 1;  2VOT A;  1KEX A;  3MUZ 1;  2ID4 A;  3A23 A;  1JZ4 A;  3HNY M;  2YC4 A;  2V72 A;  2VTF A;  4DXT A;  4OMC A;  3PUH A;  3GXU A;  5FUI A;  2VR4 A;  1UYY A;  2QQM A;  4DUX A;  5JMO A;  5HXM A;  3UNP A;  5DQ0 A;  1K12 A;  3VDA A;  3SKV A;  1OD3 A;  1XC6 A;  4A45 A;  4XUN A;  3A21 A;  3DEC A;  5B4N A;  4W4Z A;  3X0U A;  4OUE A;  5EJ1 B;  4A6O A;  3K4D A;  1W0N A;  1TVG A;  3T2Q A;  2BBA A;  4P02 B;  4BDV B;  4UI9 L;  3DYM A;  3ACG A;  3MV1 1;  4DUV A;  1D7P M;  2KD7 A;  2VZS A;  2J1S A;  2Y6L A;  2E33 A;  1MPX A;  3C7F A;  4TXW A;  3NJV A;  1CX1 A;  3AC0 A;  3MO4 A;  2Y64 A;  2W1S A;  2J1E A;  4RYD A;  4A3Z A;  2X10 A;  4E8C A;  4CUB A;  4A41 A;  2HLE A;  2W46 A;  2VO5 A;  2ZEW A;  3NNG A;  4ZY9 A;  3VD9 A;  2DCK A;  4BK4 A;  5G05 L;  2WAA A;  2BER A;  1GMM A;  1WKY A;  4GWJ A;  1NX9 A;  3VDC A;  1IQD C;  3THC A;  3OGR A;  1GNY A;  1F4H A;  1O59 A;  2QQK A;  3LPF A;  1CZS A;  1OH4 A;  2EIC A;  4UAP A;  1ULO A;  1UZ0 A;  1JZ6 A;  2W94 A;  3HPN A;  2E26 A;  3K4Z A;  4QX1 A;  4QB6 A;  3I2G A;  1UXZ A;  1WCQ A;  1H6Y A;  2J22 A;  4ZXE A;  3CIH A;  4D0Q A;  4OZO A;  1LNS A;  2RVA A;  4QB1 A;  3K4A A;  4P00 B;  1SDD B;  2B4K A;  1JZ2 A;  2RJ2 A;  3BGA A;  2WN2 A;  5C7G A;  1R64 A;  3WF1 A;  3F2Z A;  3D3A A;  4MOA A;  1J83 A;  2V4V A;  1O8P A;  3SKJ E;  2VZ3 A;  3CKH A;  2J1R A;  4DUW A;  3I2K A;  3LPG A;  1UY4 A;  1PMJ X;  3I2F A;  2JKX A;  2WYS A;  2WAO A;  4MO3 M;  2J7M A;  3EB7 A;  3ACF A;  2XOM A;  3VD7 A;  2VL4 A;  4OMD A;  2QQL A;  1W9T A;  5IFP A;  2BGO A;  2E31 A;  2RV9 A;  1K3I A;  2WZ8 A;  4ET7 A;  1JU4 A;  5DPN A;  1BHG A;  3ZM8 A;  5IJR A;  3VDB A;  3I3D A;  3I3E A;  5LA1 A;  3OEB A;  4JKM A;  3C7G A;  1UY3 A;  2EIB A;  4TTG A;  4PT6 A;  4A42 A;  2BGP A; 
#chains in the Genus database with same CATH topology
 1JOD A;  3DPR B;  4B1L A;  4W6X A;  5A32 B;  1UYX A;  5LA0 A;  1YQC A;  5J36 A;  3P3N A;  4HKC A;  4S2D A;  3QH6 A;  4ARX A;  1WLT A;  2GC2 A;  4XFB A;  1YC6 1;  5A7W A;  4FPF A;  3VB9 A;  4CEW A;  1JYX A;  3AKR A;  4KWK A;  4P9I A;  3PTR B;  4GAL A;  4MSV A;  1SQ4 A;  5JXH A;  1W3V A;  1QJY 1;  1J58 A;  3RDH A;  3VN4 A;  4ZZ5 A;  4L99 A;  1EY2 A;  3DEM A;  2BGC A;  4IXL A;  4XQD A;  5A7N A;  5A7O A;  3WDY A;  5KXE A;  1DLL A;  4MQ0 A;  4D7T A;  3S5A A;  4XIL A;  4PIY A;  4Y22 B;  4Z2A A;  2HWF 3;  3J8F 1;  3FE5 A;  4IL7 A;  3VD5 A;  2VPV A;  4CCJ A;  3WNL A;  3GNE A;  3III A;  2VNV A;  4QQO A;  5GZC A;  1NYW A;  4Y32 A;  1DQ6 A;  1RHI 1;  2R04 1;  4GB3 3;  1W6M A;  2JJ6 A;  1CAV A;  3H8U A;  5AFB A;  4WVV A;  2QQN A;  3U9X A;  2ZGS A;  5F6L B;  3ATG A;  5FO8 B;  1G9A A;  2WO1 A;  2WDB A;  2K9Z A;  3WSO A;  3NNM A;  5F1R A;  1AR8 1;  1UL9 A;  5IHR A;  3DCQ A;  3SMO A;  1SLA A;  3NV2 A;  1O8S A;  3LOB A;  3AP4 A;  1AHS A;  3AYE A;  3LWC A;  4GJY A;  3O0V A;  3U37 A;  2DYC A;  1ODM A;  4XTP A;  3JQW A;  3U1X A;  2GNT A;  1RUG 3;  1UOG A;  3NNF A;  4YZ4 A;  3TNP B;  1O4T A;  5H9R A;  1REF A;  1V9U 2;  3T08 A;  4JX0 A;  2XML A;  2I2S A;  2YFZ A;  1NLQ A;  1W2O A;  2GMP A;  3T2P A;  3MIU A;  1WA6 X;  1R09 2;  4PCR A;  4V2V A;  4XMI A;  3K3N A;  1CZV A;  1W99 A;  4FR3 A;  4H7M A;  3BUC A;  4ASL A;  4MG2 A;  2D6P A;  4QXB A;  2VZQ A;  5KC6 A;  3T1M A;  3B3Q E;  5BV6 A;  3AMP A;  2D93 A;  2D43 A;  3HBK A;  4HET A;  5GAL A;  4CP2 A;  2W0X A;  4WOG A;  2EAL A;  2BOJ A;  2B45 X;  2LS6 A;  5A6Y A;  1I6X A;  2DCZ A;  3JZV A;  2ZJC A;  3CDZ B;  4FQZ A;  5C9A C;  1MS3 A;  1AF9 A;  3VBS A;  2O1Q A;  3LEK A;  4XZP A;  3SQO A;  1HN0 A;  4KH9 A;  4AKD A;  2DVA A;  2CWM A;  2IFW A;  3IPV A;  3JD7 3;  4Q4W 1;  4DIN B;  4RFT 0;  5DAX A;  3VBO C;  1NKG A;  1AX0 A;  2WA3 A;  1VRH 3;  3VY6 A;  1RUJ 2;  2YZ4 A;  1VMO A;  5JSR A;  4GWN A;  1IHM A;  1BXH A;  1DQ0 A;  3RFR A;  1FV3 A;  1V9U 3;  3PUS A;  3J7H A;  1X8E A;  4W65 A;  5KR7 A;  4KWU A;  2RS1 2;  4XEZ A;  1QXJ A;  2LRO A;  2YV8 A;  3O1P A;  1OUW A;  3ES4 A;  3CU7 A;  5ABJ A;  5E1R A;  5CFD A;  4NID A;  3HMY A;  1QJA A;  3N3H A;  1AYM 2;  1QJF A;  3MIB A;  5FLJ A;  1BJQ A;  2A7A A;  5GJ6 A;  1DGW A;  2YU1 A;  1QJB A;  1MS4 A;  2OUH A;  2PHW A;  4WM7 C;  2IZW A;  4NHX A;  2WIN B;  3O14 A;  1O91 A;  4HL0 A;  5D8A C;  1UY1 A;  2JD9 A;  3BTA A;  3H0O A;  3AKT A;  2YU2 A;  4TWT A;  5BY9 A;  5JPN B;  3EMR A;  3R05 A;  3IIA A;  1R1A 1;  2ZPX A;  3R4D B;  3ZIW A;  1VBB 1;  5L9B A;  4QPG B;  1MZF A;  1DG6 A;  2VQU A;  1A3K A;  3C7O A;  5FK8 A;  4DHN A;  4UF0 A;  4CXY A;  4DDN A;  1QJE A;  3T3Y A;  4MH0 E;  5FMO L;  4YSF A;  4CPB D;  4P9X A;  1L7R A;  2P1B A;  4KL1 A;  2GC0 A;  1KFU L;  1W0O A;  2ZAH A;  3AMQ A;  5LAT A;  4NUB A;  4YZ1 A;  5A3O A;  2ZZJ A;  1MAC A;  5D3F A;  3HIF A;  3RI9 A;  2VME A;  2VVE A;  2B9V A;  2RS1 3;  4NJ4 A;  1I5Z A;  3WNO A;  2V7D A;  5C3R A;  2GUD A;  1LAJ A;  1SPP B;  2WSU A;  1DF0 A;  5IFT A;  4PI0 A;  4AQ6 A;  2BTV C;  4LO8 A;  1V6O A;  4QMA A;  3VBR C;  1LOA A;  3DV8 A;  4CXX A;  1XXN A;  2RS5 1;  1AYM 3;  1OLR A;  1VBE 3;  2W39 A;  3HAG A;  2QQV A;  4CCO A;  3J8F 2;  3T0M A;  1NCQ C;  2R1D A;  3DGT A;  5FQ0 B;  1Z7S 1;  1TNF A;  5CEH A;  1IG3 A;  1EPW A;  3VZN A;  5FY1 A;  1JH5 A;  1RHI 2;  4IV1 C;  5FZ9 A;  4XF9 A;  4I3P A;  3H1M A;  3OF1 A;  1JHN A;  3WEZ A;  5D21 A;  5FJK A;  1PIV 1;  2A70 A;  4R9A A;  1WCD J;  2JDZ A;  2BDR A;  1ZA4 A;  1NLS A;  5L9V A;  4ZQ0 A;  4PHZ A;  4PDW A;  4UBH A;  3SEP A;  4QT6 A;  2V5Y A;  1AR8 2;  1U12 A;  1UNB A;  5DAV A;  5LA2 A;  3D0S A;  3SNM A;  5I8Y A;  1POV 3;  3WDX A;  1UZZ A;  1UU4 A;  4NR1 A;  3BN6 A;  5FPZ A;  3P1S A;  4W6W A;  4JZR A;  3OPZ A;  3LSE A;  3A0N A;  2A5Z A;  2G9F A;  1ENX A;  2O0O A;  1YWT A;  5J4X A;  3LQC A;  3POJ A;  4PF5 A;  5JXJ A;  2DUP A;  4ATE A;  2Y33 A;  2ORX A;  2J1V A;  4RGK A;  5JXG A;  2ZEY A;  1W2A X;  1ZBE 2;  1SBD A;  4EN7 B;  5BTV A;  1SZB A;  3ACH A;  5IAT A;  1ZGR A;  3TEX A;  4FPO B;  1LKN A;  1CAW B;  2LW8 A;  4D6R A;  3RMY A;  2HWC 2;  3HNB M;  1PO2 1;  2FDK A;  4FPC A;  5AV7 A;  4XPV A;  3BOW A;  2QUO A;  1O3S A;  1OBN A;  2Z42 A;  2DBN A;  3LA7 A;  3R4U A;  1XB9 A;  4P9L A;  2JZ4 A;  2RG4 A;  5SV8 A;  4A7Y A;  2AC1 A;  4LE4 A;  4LO6 B;  2TNF A;  2YPJ A;  2FZ2 A;  2DTY A;  4QPI C;  3ILR A;  4TLG A;  1SLI A;  4Q4W 2;  3OYW B;  3SMH A;  1T2X A;  3H9A A;  3WF4 A;  2YGM A;  5C9A B;  4AVT A;  5T5L A;  4XUP A;  3WT3 A;  1F4A A;  1A8D A;  3NV1 A;  3LOI A;  4IUG A;  4QAW A;  2H6C A;  1VAL A;  4N7U A;  5J48 A;  1DIW A;  3DN7 A;  2H0V A;  4P08 A;  3T0B A;  1CZT A;  3TN9 1;  3KQR A;  3VBO B;  4WZF A;  4A4A A;  2BFU S;  3ZVX A;  3M3O A;  4AVB A;  2ZMN A;  3K2O A;  1ZBE 3;  2NPI A;  3P3P A;  1OPO A;  4QX0 A;  4X8N A;  5LHO A;  4BIF A;  3RDI A;  1JOJ A;  2XBO 3;  5CKQ A;  2FHR A;  2R6Q A;  4ZU4 A;  1VPH A;  3MYX A;  4JDD A;  2GME A;  1KGY A;  2HWC 3;  5FLI A;  5FOJ B;  3RGB A;  5LB6 A;  1W2N A;  2BYV E;  4QKD A;  1QIQ A;  4AHY A;  4ZU5 A;  4AED A;  2UY8 A;  1BVP 1;  3LEG A;  2R07 1;  2RDS A;  4FCA A;  1W8H A;  3LEM A;  5FP9 A;  3KB5 A;  4HOO A;  3SCH A;  3N9O A;  2F17 A;  4PLO A;  2D40 A;  5J1X A;  3I97 A;  3T2T A;  1ZRI A;  1IQA A;  1AYN 1;  1R1A 2;  4YW3 A;  5KBF A;  4NHM A;  1VBB 2;  2OPW A;  3ZXE A;  3LSD A;  1NE6 A;  4WM7 B;  3USS A;  4MAD A;  5C5T A;  3IB3 A;  2VOX A;  3PJY A;  5D8A B;  4Y20 A;  5DXD A;  5FMB A;  2ATF A;  5SV5 A;  5FZF A;  1CD3 G;  2W95 A;  1M4W A;  2BNM A;  3CQO A;  4LKE A;  2UWB A;  5F37 A;  1DU3 D;  2RDQ A;  3WDU A;  2BP6 A;  3A7Q A;  1C4R A;  1UH1 A;  5BNP C;  4JRL A;  5J3U A;  5JAX A;  3M3Q A;  1RUO A;  2ILM A;  2DCY A;  1RYY A;  2NUO A;  3EHK A;  5C8C C;  1WBF A;  2P6C A;  3VY7 A;  2NMO A;  4FSJ A;  2JDY A;  3LGR A;  4K8R B;  2RS5 2;  4BK5 A;  4R6N A;  1D4M 3;  4URT A;  3VBR A;  1ZA7 A;  1CAX B;  1Z7S 2;  3FL7 A;  1G86 A;  2WZR 3;  1BEV 1;  4NMI A;  2VUL A;  4CUG A;  1CVN A;  3I3B A;  1GOG A;  2Y0O A;  3GZT B;  1BQP A;  1W9Y A;  4M4P A;  3VBR B;  2QBX A;  4YVW C;  1PIV 2;  1A78 A;  3FLR A;  4YAR A;  2E7A A;  1LOB A;  1RMU 3;  4U36 A;  3AJZ A;  1MS5 A;  1NCQ B;  4QDQ A;  4FBF A;  4F7Z A;  4ORF A;  2RR1 1;  1DLC A;  1MQT C;  4FOQ A;  4Q29 A;  4Z07 A;  1EV1 1;  4K8F A;  4AAX A;  3D5O A;  2JIJ A;  4IV1 B;  3JU9 A;  3LKY A;  3WXP A;  4ITC A;  2Y6J A;  4LLO A;  2VUA A;  3PVN A;  4RGA A;  3VGI A;  1CX4 A;  1KXG A;  4DHT A;  1BCX A;  1BYH A;  1GP5 A;  4LBQ B;  3OGJ A;  4LUL A;  2LAL A;  2RS3 1;  3HQX A;  3VZM A;  4F83 A;  1LEM A;  2DUQ A;  2W1U A;  4XVH A;  1PGW 1;  5JOZ A;  5F2S A;  5EXO A;  2RS5 3;  4AF9 A;  5F32 A;  4OI1 A;  1U5Y A;  1K45 A;  3ACI A;  1GP4 A;  1AR6 3;  1BBT 1;  3N9M A;  5LK7 B;  3P1P A;  1M06 G;  5A1L A;  4CE8 A;  5FAX A;  2VH9 A;  1PO2 2;  3PUQ A;  2WLP A;  1FPN 1;  3WIN E;  1GNH A;  5F3I A;  5F3E A;  4HVQ A;  2GZW A;  4AK4 A;  1TEI A;  1FT9 A;  1UKR A;  3ZX7 A;  2MNG A;  3ZXL A;  2VTF A;  3W58 A;  3HWJ A;  2C24 A;  3BPS A;  4M0H A;  4E2G A;  2C6S A;  2VR4 A;  1UYY A;  4KG8 A;  1O9C A;  2CHH A;  3AP9 A;  4RHV 3;  3SPR A;  3V0A A;  1MZ6 A;  3BI3 A;  1NCR C;  3IWZ A;  4LKD A;  3PU3 A;  1JBC A;  4FFI A;  5FZ4 A;  1SDW A;  4QPI B;  4XUN A;  3A21 A;  1ND2 C;  4BYY A;  3DEC A;  1VP6 A;  1XNB A;  5FXV A;  4UWD A;  4XDO A;  3TN9 2;  5IK8 A;  5EP9 A;  4AWD A;  3F95 A;  1J59 A;  3X0U A;  1X82 A;  2WWU A;  4LHK A;  2HEW F;  3ZFF C;  5CA6 A;  2XJQ A;  2FCU A;  1TVG A;  1RB8 G;  1TMF 3;  4P02 B;  4HSL A;  3ACG A;  2HWB 3;  4GKY A;  4XF1 A;  5CBL A;  1RUH 1;  4HLT A;  5FKC A;  2HKX A;  1D7P M;  1WD3 A;  2E33 A;  2CU5 A;  3C7F A;  1OVS A;  1W04 A;  1CX1 A;  5LBC A;  5JSP A;  3BU0 A;  5TSW A;  1K5M A;  1QXP A;  2O8P A;  4PIX A;  3GHM A;  4CCN A;  1AYN 2;  1RED A;  2V09 A;  5FJH A;  5LA9 A;  4CUB A;  2W46 A;  4O65 A;  1J1T A;  1LHU A;  2JE7 A;  4G4F A;  2YBP A;  3RYP A;  2GDF A;  2WII B;  3MHR A;  5D1I A;  1WGP A;  4BK4 A;  4XFH A;  2QCS B;  5F5C A;  2VUC A;  1BMV 1;  5FZ1 A;  5E88 A;  1GMM A;  2PFW A;  4NWW A;  1UOB A;  4K40 A;  4FQ4 A;  5DUU A;  2CYF A;  1CZS A;  1FNZ A;  1H1M A;  1OH4 A;  2EIC A;  3M8L A;  1LEN A;  1Q56 A;  1UCX A;  2ZGK A;  4JVA A;  1NLR A;  3O0W A;  4UAP A;  5FMC A;  4BQ4 A;  5KHG A;  4L97 A;  4LK6 A;  4CEY A;  4A3X A;  1UZ0 A;  2WA4 A;  4FFH A;  4NHY A;  3ZXD A;  4BLJ A;  4IHL A;  5L7O C;  5D3E A;  2VBB A;  3URF A;  5BNP B;  2EAA A;  2FZ1 A;  4DY3 A;  2AEY A;  4QB6 A;  1ACC A;  1R1Z A;  2HWE 3;  1GZW A;  4D69 A;  3ZO0 B;  5C8C B;  3I2G A;  1UXZ A;  1RJ8 A;  1BEV 2;  1YEW A;  2XG3 A;  2IXI A;  2WL1 A;  3H1W A;  3P8S A;  1CN1 A;  3MEP A;  3FUO A;  4M3C A;  2DF7 A;  5HV0 A;  2RVA A;  1OFN A;  5EQU A;  4DNY A;  4EN0 A;  2B4K A;  2RR1 2;  1JZ2 A;  4BU2 A;  2JDM A;  1EV1 2;  1MS1 A;  4H14 A;  4XBL A;  5DG2 A;  2GH2 A;  2WN2 A;  1LHN A;  3ZMO A;  1ZZ9 A;  3VLB B;  1JW6 A;  3D3A A;  4L11 A;  4OUS A;  3RNS A;  3ST7 A;  2JG9 A;  3U10 A;  4YVW B;  1WA4 A;  3ACL A;  3SKJ E;  4QKN A;  5C5U A;  4DUW A;  2ZS6 B;  4P9J A;  1MQT B;  1T6B X;  3I2K A;  1H2N A;  5AC9 3;  4QX5 A;  3R50 A;  1UY4 A;  1IS4 A;  1PMJ X;  4COW A;  2PXJ A;  5HXV A;  4RA0 A;  5LU1 A;  2RS3 2;  2WAO A;  4MO3 M;  4Y26 A;  1J4S A;  3ACF A;  2AH2 A;  3ZKU A;  1PGW 2;  1YFX A;  2A1X A;  2AR6 A;  2AUY A;  4KBB A;  3ZXA C;  4D7Y A;  5IVB A;  2QDR A;  1QU0 A;  4V1P A;  3VD7 A;  2K2S A;  4XTM A;  1W6N A;  5IFP A;  1BBT 2;  4Q1R A;  4GH4 C;  5CB7 A;  5K0U C;  1LB2 A;  1HV1 A;  1FPN 2;  1JU4 A;  2XVK A;  1S4C A;  1W6N B;  3AP7 A;  5GLZ A;  1E5I A;  3H42 B;  4PBP A;  5FZK A;  5FY8 A;  4ES9 A;  1AXZ A;  4Q0V A;  3O1M A;  3I3E A;  4HFS A;  5LA1 A;  2FDH A;  1HB2 A;  3S57 A;  4J1W A;  5KHH A;  2VOV A;  5FY7 A;  1V6N A;  2EIB A;  1UW8 A;  3LW1 A;  1TQ5 A;  2QE3 A;  3D0J A;  4I02 A;  2FD8 A;  2WNU C;  4BWO A;  3AX4 A;  2VM9 A;  2VC9 A;  4IEY A;  2BEO A;  3NRU A;  5C6C A;  1BK0 A;  3B01 A;  1N1V A;  2QJV A;  3ECQ A;  1URJ A;  4UW5 A;  3OUI A;  1AX1 A;  3ETP A;  5JXI A;  1GR3 A;  2FBE A;  4WM8 A;  2QQI A;  2XDV A;  4S2F A;  5LY2 A;  2VZU A;  1DCS A;  1NCR B;  4DNK A;  3GJB A;  4NVP A;  4YZ5 A;  1ZRF A;  2ENR A;  4YVS C;  1QDC A;  1ZGS A;  3VZF A;  4Y5S A;  1ND2 B;  4DB5 A;  1WS5 A;  3OPT A;  5DZG A;  2WS9 1;  3AFK A;  1WUV A;  5FRE A;  1RUI 3;  1UGY C;  1IZ3 A;  2NZ9 A;  1OPM A;  2I45 A;  3ZFF B;  2ZAC A;  4YG6 A;  1EP0 A;  2D6K A;  1PZ8 A;  2D6O X;  2ADE A;  3IBM A;  1V6M A;  1ND3 C;  3WCS A;  3SH4 A;  2F4L A;  2VQ0 A;  2O8O A;  3LL0 A;  2J1T A;  2VZP A;  5FZH A;  4JGZ A;  2OT7 A;  1AR9 1;  2BU9 A;  1HB1 A;  3UNP A;  3TOW A;  4W50 A;  3K77 A;  2W08 A;  1Z78 A;  1W8N A;  1QMJ A;  1QNY A;  2D5F A;  5DDJ 1;  2P3I A;  2XUM A;  4AKC A;  3QBQ A;  3APB A;  4N9I A;  2W9X A;  3M3I A;  4QGL A;  1DGW X;  2VZR A;  2WO2 A;  5FOB B;  1BMV 2;  4XJU A;  3UGG A;  2ZX0 A;  3DL3 A;  3QD6 A;  2X09 A;  4XFG A;  2QVS B;  3GDB A;  4Q0S A;  4UYB A;  3AFG A;  4O9E A;  3POE A;  3FC0 A;  1G9C A;  5A1A A;  5FYI A;  4KU8 A;  1HXS 3;  4U2A A;  2MEV 3;  4M01 A;  5EZW A;  3IDA A;  5FFO C;  3GM8 A;  4EWD A;  3P1N A;  1I9R A;  5FYM A;  1TME 3;  2RE9 A;  3ZKY A;  4LIU A;  3SIS A;  1OA3 A;  1SFP A;  4GIQ A;  1HB4 A;  1X9P A;  4GMP 0;  1UMH A;  4HAN A;  2B39 A;  4RQP C;  2YXS A;  1CAU A;  4RS5 A;  5JI9 A;  4IEA A;  1OLM E;  3LEI A;  3T4H B;  5L7O B;  5LRR A;  4FP2 A;  4CDQ C;  3NW4 A;  3DYP A;  2X05 A;  3D4K A;  3OB8 A;  3RZJ A;  3E6B A;  3B9I A;  3KV9 A;  4S2G A;  4BE3 A;  4RS5 B;  3H8O A;  3SMM A;  4CDU C;  3TYJ A;  4JHZ A;  1SFN A;  1RUF 1;  2CWS A;  2Y26 A;  3CEW A;  3I7D A;  4LJH A;  2CDP A;  2IXH A;  4JKL A;  3FJS A;  4LNV A;  4XQW A;  3WOB A;  1VBC 1;  1LTE A;  1V6I A;  3IMN A;  3E1F 1;  3R4S A;  4CCL A;  2PQQ A;  4F8A A;  3TEW A;  1JYV A;  3ZYI B;  1QXR A;  4FVV A;  1Z0H A;  3ZR5 A;  1LR5 A;  2PHX A;  2CGN A;  3CF6 E;  4Q4Y 1;  3KGZ A;  4XUR A;  2NQY A;  1W2T A;  3N9N A;  3TOJ A;  4BH9 A;  3NV4 A;  3WOC A;  4PIK A;  3B93 A;  4CCM A;  2RM2 3;  2I74 A;  1QH6 A;  2E6V A;  3L9J T;  3VDD A;  4N8M A;  4BJ0 A;  1QOT A;  2W5F A;  3WNK A;  4GX7 A;  3LIH A;  4QGN A;  1PNF A;  1N1Y A;  4OQ9 A;  1X50 A;  4QKF A;  2AAC A;  2Q8C A;  4Y3O A;  4AVS A;  3J4U H;  1O3T A;  4YW5 A;  2VCC A;  2VQT A;  3BAL A;  4MGY E;  4N53 C;  4GH4 B;  4YW4 A;  2FMY A;  2ARB A;  4XUQ A;  2JDN A;  5K0U B;  1AXY A;  5CFC C;  3ZHE B;  3KGL A;  4IE4 A;  3JB8 A;  5EJZ B;  1C1L A;  4B3N A;  5F7U A;  2ZGO A;  3PLQ A;  2K46 A;  4JDN A;  4KU7 A;  1ZRE A;  4LIV A;  4LOT A;  3VBU A;  1HB3 A;  3T0D A;  5HPO A;  1J3P A;  1W6P B;  5FR3 A;  5FZ6 A;  4K20 A;  4CDX C;  4KI5 M;  1HRI 1;  2WWS A;  2JIC A;  4XBQ A;  2VVD A;  2C5D A;  4FXG B;  5BN6 E;  3DPR A;  3Q8E A;  4XHX A;  1PM7 A;  2WNU B;  2EIE A;  1XE7 A;  3BVC A;  1LJ7 A;  5ISL A;  4DHU A;  1HLC A;  4E4D X;  1AUY A;  3GF6 A;  2XB6 C;  5FP3 A;  2HBT A;  4EZ4 A;  1W8O A;  2WS9 2;  2PLV 1;  3GZU C;  2ES3 A;  5E16 A;  3UZD A;  2HWD 3;  5APA A;  1JS9 A;  2BZD A;  3HQR A;  4YVS B;  2OA2 A;  1KJR A;  4OUM A;  4Y22 A;  1ASJ 3;  1K5J A;  4Q0P A;  1Y4W A;  4I3G A;  1Y43 B;  4NPR A;  1VB2 A;  1G9B A;  4LA2 A;  4AAP A;  1AR9 2;  1DGR N;  1QQP 1;  4X6R B;  3FFQ A;  1LU2 A;  2DVF A;  4E2E A;  4GMP 3;  3VUO A;  5DDJ 2;  3WHT A;  1BLZ A;  1ND3 B;  3Q8F A;  4FP3 A;  4O61 A;  4MGQ A;  3T09 A;  5HBA A;  5DAB A;  4IV3 C;  4B8E A;  4ZS2 A;  4NRQ A;  5FMO S;  4D6S A;  1QJU 1;  1QNW A;  2PHF A;  1J4U A;  3NNJ A;  1XNT A;  2Q0A A;  2G19 A;  2EAK A;  3KVB A;  4YFW A;  2Z69 A;  1LEC A;  1YRZ A;  2VAU A;  3AYD A;  4HN1 A;  3H3Z A;  5FYH A;  5C4W C;  2GMM A;  2P3J A;  3J9S A;  3AVR A;  2P17 A;  3ZN6 A;  3LKJ A;  4Y4R A;  2JEC A;  4FL5 A;  4EN9 B;  4TSV A;  1MZ5 A;  1T6G C;  1Y9G A;  2VJX A;  5FYS A;  3TBD A;  2ZAA A;  2XWJ B;  3AL6 A;  4IES A;  3ZN6 B;  4XYX A;  5LRS A;  4X8P A;  4Y33 A;  5I0T A;  3X29 B;  3ZFE C;  2X53 S;  2CNA A;  5IAX A;  3CQG A;  1ALY A;  1ZBA 1;  1PMH X;  4C8D A;  2A6Z A;  2BNN A;  2GH8 A;  1OUX A;  4BXS V;  2JKB A;  4Q4X 1;  1YQ5 A;  4LPL A;  1FOD 1;  3OGG A;  4LEJ A;  1P8J A;  2UUR A;  4RQP B;  5HCF A;  2Q8O A;  1APN A;  2JB4 A;  3O0X A;  1RUF 2;  4NO4 A;  2B8M A;  2OQ7 A;  4CDQ B;  1YIP A;  3APA A;  3ME2 A;  2QQO A;  1AL2 1;  1E5S A;  3VZJ A;  3HJR A;  3WOG A;  1KQR A;  1POV 0;  1GZT A;  5FTT C;  3WQB A;  4BQ1 A;  5LCW L;  3THT A;  2DU0 A;  4FPH A;  2ZEX A;  2VUD A;  5GLV A;  4M0N A;  3VL9 A;  4CDU B;  1RIT A;  1IS6 A;  5GLU A;  2VCA A;  1CWP A;  1ZNP A;  3MLJ A;  1WS4 A;  2C1N A;  1H6X A;  4HKO A;  1C3M A;  4JCK A;  3FMG A;  1YQ2 A;  4LUM A;  1JU3 A;  1SHW B;  4N90 A;  2X29 A;  5IVY A;  3VHO A;  4CDW C;  4M00 A;  5IVE A;  3PDQ A;  4AHX A;  3LE0 A;  5A3L A;  3WX5 A;  1C28 A;  1YXW A;  3WG4 A;  3I2O A;  2WNE A;  5LY1 A;  4RR3 C;  1TOQ A;  4IEO A;  4KWL A;  4H55 A;  3H8R A;  1PVC 1;  3LDB A;  1MS8 A;  2MPF A;  3LFM A;  3IKW A;  3JCI A;  3WP5 A;  2DDU A;  2Y0I A;  2I07 B;  4BZ4 A;  1C3K A;  4IEP A;  1R09 3;  2UYA A;  3N7L A;  1WMF A;  2GN3 A;  3SLI A;  3WW3 A;  5LEK A;  1O9F A;  2VXJ A;  4MHR A;  1CIY A;  3UKT A;  1OSG A;  2CDO A;  5JOX A;  1WMX A;  4FOY A;  5CKN A;  1PNG A;  1F2N A;  4E8D A;  4GQ7 A;  4QU1 A;  5B4X A;  4OZX A;  2OVU A;  4AGG A;  2YG0 A;  4N53 B;  2YGL A;  5DUW A;  2A3Y A;  4JKK A;  4QPG A;  1OA2 A;  4GJZ A;  1A6C A;  5JI7 A;  1HRI 2;  4CU7 A;  5FZO B;  5CFC B;  5JUV A;  1FYU A;  2VW0 A;  3AZZ A;  2XKO A;  2B05 A;  2JG8 C;  4PF1 A;  4QHO A;  5IW0 A;  3PUR A;  2E32 A;  2VZ1 A;  4F3J A;  3ZYR A;  1RUD 1;  2NMN A;  2PYT A;  1XSQ A;  3NVC A;  1H2K A;  5GLW A;  3O5S A;  4ZKT B;  2YBS A;  3ZSM A;  2JE8 A;  1DHK B;  1RUJ 3;  3JBG 1;  3VBH C;  3WW4 A;  1V70 A;  2YFU A;  2PLV 2;  3H7Y A;  5JZG C;  3TEY A;  1F5J A;  1V0A A;  1SPP A;  1JZ5 A;  2KM2 A;  4XCB A;  1OOP C;  1UY0 A;  2P6H A;  4BPZ A;  1NG0 A;  5JIU A;  1VBO A;  1C5H A;  2JDU A;  4LLF A;  3ZDV A;  1HX6 A;  4E4H A;  1QJY 2;  1SG3 A;  4FTS A;  3NQH A;  5FBJ A;  4E2Q A;  5FQ0 A;  1DP0 A;  5A6Q A;  4QXK A;  2D44 A;  2ZX4 A;  1QY4 A;  4QX7 A;  1S0D A;  5IQP A;  4G3Y C;  2XGX A;  4DFS A;  2VW2 A;  5CAD A;  3U4S A;  3BB6 A;  3Q8A A;  4JHT A;  4YGE A;  3AM2 A;  4AYU A;  2R04 2;  1LHO A;  1IGO A;  1LCL A;  2C9A A;  2WNV C;  2Y6H A;  2JWP A;  1QJX 1;  5JR7 B;  3WQ1 A;  5J09 A;  2DWR A;  4IW3 A;  3RPQ A;  5A7S A;  1YWK A;  3L2H A;  3HOB A;  4IV3 B;  4YGB A;  5EJ3 A;  5I8S A;  5AVP A;  4HSJ A;  2R7E B;  3ZR6 A;  3B69 A;  2HYX A;  5FZL A;  4CPB A;  1XU2 A;  4HKL A;  1OD5 A;  4FPL A;  1DDL A;  3I2I A;  4GZ9 A;  4AI8 A;  4ES8 A;  5C4W B;  4OHX A;  1QJY 3;  1KEX A;  4K21 A;  1CAW A;  1Q8Q A;  2CAV A;  2WJS A;  2YHJ A;  1JZ4 A;  1MVE A;  4E4S A;  3ZLI A;  1ZBA 2;  5FWJ A;  3MFC A;  4R9D A;  4KBZ A;  2XLG A;  4DXT A;  4EWA A;  3ENR A;  1ZRD A;  3AZW A;  1MEC 1;  3J8F 3;  4NAM A;  3B00 A;  2EXJ A;  4Q4X 2;  2QQM A;  5F39 A;  1FOD 2;  4DUX A;  4BHP A;  5JMO A;  3ZFE B;  2CSG A;  1BK1 A;  1UZV A;  1K12 A;  3GCX A;  1RHI 3;  1WLD A;  2R04 3;  1S0C A;  4LO5 B;  5DQ0 A;  3M4F A;  2W68 A;  3VDA A;  4Z92 B;  2AZ5 A;  3MW3 A;  1AL2 2;  3SCG A;  4A45 A;  2DV9 A;  5FPU A;  2NLR A;  3OYW A;  5B4N A;  3U4X A;  4K1Y A;  2QNK A;  5C9A A;  5FZA A;  1KRI A;  5GZD A;  1XSR A;  2JIG A;  2O14 A;  2WKK A;  3POF A;  1AR8 3;  2WC2 A;  5FP7 A;  3EXU A;  3P5B A;  3VKL A;  3GHN A;  1HKD A;  3T2Q A;  1WW6 A;  2YRO A;  2BBA A;  4HKW A;  5C3O A;  4BDV B;  4AI9 A;  5BXX A;  2WFP A;  1YJL A;  4Y24 A;  5FO7 B;  3I3M A;  2HBU A;  3VBO A;  2UY9 A;  1GAN A;  1CJD A;  1UPS A;  2KD7 A;  1MR5 A;  2OQ6 A;  3DKQ A;  3QLQ A;  3ROU A;  3O1T A;  1MPX A;  3N35 A;  5ANN A;  5EWZ A;  5M0T A;  2GUC A;  3E6Y A;  1UN1 A;  3AC0 A;  4CDW B;  1EAH 1;  1PVC 2;  2C63 A;  3S6P A;  4MXW B;  3I49 A;  2D3P A;  1YNA A;  3T0L A;  1L3J A;  1XNC A;  4E8C A;  2VOW A;  1HIX A;  1ENQ A;  5IT6 A;  4A41 A;  3NNG A;  4N43 C;  2ZEW A;  4RR3 B;  4ZY9 A;  4IE5 A;  3ZYB A;  3VD9 A;  4Q4V 1;  4WVM B;  4B4R A;  3BTY A;  1UOJ A;  1H1I A;  2D6N A;  2F4P A;  2BTP A;  4V2W A;  1ODN A;  3POS A;  2XXZ A;  3HN1 A;  3S5Q A;  2LTN A;  5JCT A;  3VDC A;  3OGR A;  2QQK A;  1XOY A;  1RL3 A;  2MHF A;  3S7I A;  4WM7 A;  5D8A A;  5FP8 A;  3AZY A;  1JMU B;  4Q4W 3;  1KIT A;  1UOF A;  1YFU A;  1RUD 2;  1V6K A;  2W94 A;  1DZT A;  2IXJ A;  2OW4 A;  4IE0 A;  5FZ7 A;  4LBQ D;  2E26 A;  1BVV A;  1D0H A;  3VBF C;  1W6O B;  1LOF C;  2SBA A;  1C8M 1;  2NU5 A;  1ZM1 A;  3JBG 2;  2OUJ A;  5KHI A;  3GAL A;  3SXW A;  4FAH A;  3QH7 A;  4N7G A;  1KDK A;  2LUW A;  1ENS A;  4NPM A;  5JSO A;  2OII A;  3LCP A;  1COV 1;  4FOW A;  4QX8 A;  5ACA 1;  1IS3 A;  3V64 A;  3I54 A;  3RJR A;  3VBH B;  5FZ8 A;  3K4A A;  1IOA A;  1CAX A;  1JUI A;  3ORJ A;  4P00 B;  4LHN A;  4QU2 A;  5EXA A;  1ONA A;  2WYF A;  4UW3 A;  5FYB A;  1HRV 1;  3RYR A;  4DRR A;  5JZG B;  1VIW B;  5C7G A;  3O1V A;  1OOP B;  2KR2 A;  4MOA A;  1J83 A;  3NST A;  3UYJ A;  1O8P A;  1TZO A;  2FMD A;  4PBO A;  1RUN A;  1NCQ A;  4LOR A;  5L9R A;  4XAE A;  3CKH A;  4FFG A;  4AHZ A;  4HK8 A;  3LPG A;  1LES A;  1ZRC A;  1QJX 2;  4IV1 A;  1GKB A;  2WYS A;  1R1A 3;  2WO7 A;  2J7M A;  1VBB 3;  3FLT A;  4BLI A;  3FFZ A;  2VEC A;  2CL2 A;  1RUD 3;  5BYN A;  4Q27 A;  4R9B A;  2D5H A;  2EXI A;  2PHT A;  2QQU A;  2WNV B;  4DPN A;  2FDF A;  1VE0 A;  5HCH A;  4LBQ A;  2QQL A;  3BYW A;  4XXP A;  4KQ7 A;  5T50 A;  1DBN A;  3MIG A;  2WZ8 A;  5F3G A;  2NN8 A;  2G4I A;  2VNR A;  3CO2 A;  4GD4 A;  4ZON A;  1WCS A;  2D98 A;  3VV1 A;  3Q8C A;  5T5P A;  4DHR A;  3BPZ A;  4JTO A;  1WBL A;  1ZZC A;  4LBN A;  4DIQ A;  4OI0 A;  4KNC A;  5IJR A;  3UGF A;  4A2U A;  5JOY A;  3VDB A;  4AOC A;  1XBF A;  2YUE A;  4BQX A;  1RTV A;  2RMU 1;  4AKB A;  1XJA A;  1H9W A;  4DXZ A;  3PVE A;  4PT6 A;  3ALQ A;  1UZY A;  2ZTN A;  1Z7S 3;  1F31 A;  1GV9 A;  1RUE 1;  1JOT A;  3LL1 A;  4MX3 A;  2J1A A;  2W3J A;  1E57 A;  3WF0 A;  3O1U A;  1S0G A;  2C4X A;  1QJX 3;  1PIV 3;  2BVB A;  2WWJ A;  5EIY B;  5KXD A;  2BWA A;  1AR7 1;  3I2D A;  1UX6 A;  4LR4 A;  5K7P A;  1W3X A;  2WSV A;  3KF3 A;  2VCM A;  1JAC A;  1UU5 A;  3ABZ A;  4LIT A;  1XNK A;  2WR9 A;  2HYR A;  2QZ2 A;  1R08 1;  1U5Z A;  3VZE A;  4QPI A;  4JGY C;  2VGD A;  3NJX A;  3MW4 A;  3OEA A;  1YUD A;  4QXH A;  3DYO A;  5EYX A;  1JZ3 A;  1PO1 1;  1ULD A;  2OZJ A;  1HQN A;  1VR3 A;  5KHK A;  1JYN A;  1DYO A;  4LO7 A;  3EQE A;  1M26 A;  2BFU L;  2XL7 A;  4IGQ A;  1J4T A;  1EAH 2;  3UX0 A;  1RUC 1;  1BKZ A;  3GZA A;  1JZ7 A;  4JDM A;  3AP6 A;  2ZHL A;  1NY7 1;  4IET A;  5JLV A;  5BNO C;  2YB7 A;  1D0G A;  2ZAB A;  4QQL A;  5FYT A;  5FZB A;  3WNM A;  2Y6G A;  3OPW A;  1OQ1 A;  3KCY A;  2BQ0 A;  1B35 C;  2DCT A;  3CJI C;  2VZT A;  4DXR A;  3AVS A;  4Q4V 2;  4NII A;  1VBD 1;  3HD8 B;  1PO2 3;  2VE1 A;  5IK7 A;  3ZXJ A;  3MIH A;  2VZV A;  1ULG A;  1OMI A;  4CUA A;  5BNN C;  4LTA A;  3U07 A;  5LBB A;  3AXE A;  4LHS A;  3LF7 A;  3SMN A;  4Y1X A;  2R07 2;  4K7J A;  4AEK A;  4N43 B;  1N3Q A;  4YNI A;  3R52 A;  5HCB A;  5FPX A;  3MIE A;  3FX3 A;  4A44 A;  4Y1Y A;  3Q8B A;  4J25 A;  4YW2 A;  2X5I C;  1I5P A;  1DFQ A;  3O12 A;  5J51 A;  4DY5 A;  5F74 A;  3ZN5 A;  4WBB A;  2QQJ A;  4GNT A;  5A3W A;  1C8M 2;  4DHM A;  3VD4 A;  1W9W A;  3PVO A;  3IQU A;  2GP3 A;  3MPP G;  4IND A;  1ZYB A;  1GZC A;  3AP5 A;  2WZP P;  3NJY A;  3J26 N;  3TN9 3;  1X8M A;  4CZS A;  1O3Q A;  1VMF A;  4YW6 A;  1PGL 1;  5FPB A;  1COV 2;  4R4Z A;  5ACA 2;  3K51 A;  5BNP A;  1D4V B;  3CU8 A;  2FCV A;  3VBF B;  1V6J A;  4WRQ A;  4XMA A;  3ZMN A;  3WD5 A;  1CIW A;  1NA1 C;  2EIG A;  1BZW A;  3KLS A;  4CP9 B;  5C8C A;  1L7Q A;  5JM1 A;  1GFF 2;  4XJW A;  5G04 L;  1NXD 1;  2ZCW A;  1PZ7 A;  2P3Y A;  3W20 A;  3ZFG C;  4DHQ A;  4DXS A;  4YZ2 A;  5KXB A;  2R16 A;  4RL7 A;  2R07 3;  4QX2 A;  1G9D A;  3J7N A;  1S0B A;  3C7E A;  4TN7 A;  4YW1 A;  3GJA A;  3UJQ A;  3T1L A;  4A7Z A;  5FWE A;  4BQY A;  4COV A;  1IB1 A;  3VD3 A;  5LWB A;  4C0H A;  4DHO A;  1F5F A;  2OXB A;  2ZX1 A;  4Y5T A;  1AYN 3;  4QPW A;  3T0A A;  2D7F A;  4YVW A;  4EWE A;  2WFF 1;  2N7G A;  3VKO A;  4LXL A;  1VBA 1;  4XC9 A;  5GM0 A;  4NHK A;  2VMC A;  2R1B A;  3JXS A;  2IWG B;  2ZX3 A;  4MLO A;  1MQT A;  1RVF 1;  4QM8 A;  2C26 A;  1OKQ A;  1XYO A;  1UF2 C;  2JEN A;  1AJK A;  5T52 A;  2E7Q A;  4OCT A;  4YLZ A;  2Z5W A;  1W9F A;  4WV8 A;  5FY5 A;  5FMD A;  1OKO A;  1H8T C;  1AVB A;  4KGQ A;  2XJS A;  3IQJ A;  3NMB A;  1L7L A;  5FPV A;  2NM1 A;  4WZC A;  1RIR A;  2UU8 A;  4P5Y A;  5JPM B;  1S2X A;  4Z82 A;  3UV9 A;  5HV4 A;  4OQ8 A;  2WT2 A;  2TUN A;  5C8W A;  1O6U A;  4PI2 A;  3AKQ A;  4RSU A;  2EF6 A;  3ES1 A;  4NRO A;  4E27 A;  3M3C A;  1REE A;  1RUE 2;  1NQJ A;  3NAP C;  1DQ5 A;  4B4Q A;  2ZML A;  4EN8 B;  3RI8 A;  1BEV 3;  1JYI A;  4FTB A;  4AVC A;  5FZE A;  2GU9 A;  1VMJ A;  3KV6 A;  5A3M A;  3GBW A;  4IQP A;  4X6Q B;  4I09 A;  1AR7 2;  1OXC A;  2W1Q A;  2C1J A;  2RR1 3;  2XJU A;  4MGK E;  2WNO A;  1EV1 3;  2RJL A;  3ZSJ A;  5FZC A;  2BOI A;  4C90 A;  1OVP A;  1QH7 A;  3JQX A;  1YYN A;  3I59 A;  1R08 2;  3MID A;  4IE6 A;  5FYZ A;  3K46 A;  1S2E A;  3UAL A;  1VAV A;  2DVG A;  1EPZ A;  3AYC A;  2IVI B;  2ARA A;  1YZ5 A;  1RC6 A;  3N9Q A;  2PMW B;  2PQS A;  3PTY A;  5EFU A;  4ZS3 A;  5FPL A;  3WY6 A;  1FXZ A;  1FAY A;  1PO1 2;  3RZK A;  4JC3 A;  1HW5 A;  1NCR A;  1W6Q A;  3I59 B;  1OHF A;  1YO8 A;  2ZBJ A;  1G6N A;  2RS3 3;  1GYK A;  5LVZ A;  2G9G A;  3IAQ A;  5ANQ A;  3WG1 A;  3BTZ A;  3P1O A;  1ND2 A;  1RUC 2;  4J1X A;  4XXA A;  1W6Q B;  1F8V A;  3R51 A;  1NY7 2;  3OG2 A;  5F6K A;  4IEX A;  1GLH A;  3MIT A;  5EWS A;  3ZFF A;  2GND A;  1O9E A;  4CU6 A;  2XR4 A;  3NL1 A;  1BBT 3;  1RUE 3;  2DVD A;  2QQW A;  4EJR A;  1UGW C;  1Q3E A;  4XJ8 A;  4Y1V A;  2VCB A;  1VBD 2;  1Q43 A;  1XQN A;  1RUH 2;  2XON A;  4YZ3 A;  1FPN 3;  2HWF 1;  3CJX A;  1ZZ8 A;  4IEV A;  1Y7B A;  5LU2 A;  1F9K A;  5BNO B;  3AXD A;  3TNQ A;  1DQ4 A;  3J7M A;  1SEF A;  4Z2W A;  5BNN A;  1SLT A;  3P1R A;  1N1S A;  3MI8 A;  4GB3 1;  1B35 B;  3CJI B;  4XOG A;  3RZM A;  1LGB A;  1PK6 C;  5AFE A;  4XHB A;  4Y5Z 0;  1QF3 A;  5D2D A;  5L73 A;  1JN2 P;  5BNN B;  1TP8 A;  2EXK A;  3IZO A;  3KS7 A;  3MPB A;  4K9S A;  4NWV A;  2G9Z A;  2VMF A;  3KT4 A;  3WNX A;  4DEV A;  3RWK X;  2G1M A;  4NOT A;  2P34 A;  4QWN A;  2YYO A;  1MVQ A;  2GUX A;  2JB8 A;  4M3C F;  1OF3 A;  3VKN A;  1AX2 A;  4CEW C;  4XAB A;  2UYB A;  2X5I B;  4COU A;  1E5H A;  1XE0 A;  2TBV A;  2PEL A;  4AI0 A;  2XHN A;  3WF3 A;  1PGL 2;  1X33 A;  1SBE A;  4XFI A;  5CZK A;  2PN5 A;  1RUG 1;  3FLP A;  5T54 A;  4AQT A;  2XJP A;  1XRU A;  5IAV A;  1EUU A;  3MGU A;  2VD7 A;  2TEP A;  2E63 A;  2VY0 A;  1VLN A;  4XIO A;  2GNB A;  2OYZ A;  5DMY A;  4AEM A;  4QGM A;  4CA9 A;  4COY A;  3U0Z A;  1RUH 3;  5HI0 A;  5LZ6 A;  5AVA A;  5L7O A;  4AG4 A;  4K3U A;  1UX7 A;  4BM8 A;  1NA1 B;  3UL2 A;  4UXA A;  2LRP A;  4N7Y A;  2WN3 A;  3OY8 A;  4PLM A;  5IVC A;  4YRD A;  1RJ7 A;  3VHP A;  3ZFG B;  3T4V A;  4FPK A;  4GAZ A;  3M51 A;  2WFF 2;  3E5Q A;  1VBA 2;  3H3L A;  3OY8 B;  4YM3 A;  3CZU A;  1RVF 2;  1UY2 A;  3JD7 1;  1G7Y A;  1XU1 A;  3C7H A;  1Q5O A;  1VJ2 A;  1VB4 A;  4OI2 A;  4FJ3 A;  2ZHM A;  3BIW E;  3DXT A;  3TWI A;  5CAZ A;  2VMD A;  4FPJ A;  3H3U A;  1VRH 1;  3R0R A;  5EYY A;  4BME A;  2J42 A;  4I30 A;  5B2G B;  4QQP A;  2J1U A;  2YDE A;  1LOD A;  1OFS A;  1S2B A;  3RS6 A;  1W8F A;  3W21 A;  4AE2 A;  4AQ2 A;  4OI4 A;  1U0A A;  2GC1 A;  4R52 A;  3ZSL A;  4ISR A;  1G8W A;  1GP6 A;  2ZZQ A;  3IQV A;  2FQP A;  4AFM A;  2HYK A;  1GQP A;  1H8T B;  2DTW A;  3AKP A;  3USU B;  3PJQ A;  1UD1 A;  3BU7 A;  1UXX X;  2ZGN A;  3LZZ A;  4PIZ A;  3FBY A;  3O7O A;  2OZ6 A;  3SP5 A;  4GH4 A;  1STM A;  4P9Y A;  4XF0 A;  3WQ7 A;  5K0U A;  2DVB A;  2BVV A;  3UK9 A;  3VBS C;  4P9W A;  5LAS A;  4UOJ A;  4HN0 A;  5EV7 A;  3SCF A;  5E6H A;  4XUO A;  1SFY A;  4ASM B;  3NAP B;  2C23 A;  3AJY A;  3TAY A;  1HDK A;  1LRH A;  1NQD A;  5EHD A;  1OC1 A;  1W6P A;  4LKS A;  4MGS A;  4TYS A;  1JI6 A;  3FHQ A;  4QXC A;  2D97 A;  2P4E A;  2ZGU A;  4KMQ A;  4NRP A;  5KHJ A;  3EYP A;  1O5U A;  3BTX A;  3MLK A;  5I91 A;  2WNU A;  2QKD A;  4N7I A;  4DO0 A;  3AMH A;  4XBN A;  3O1O A;  3KWV A;  4QHZ A;  3I2H A;  4NIG A;  5A80 A;  3HEI A;  4XJ9 A;  3W5N A;  1HN1 A;  3OD0 A;  2V73 A;  2QTW B;  3K75 B;  1C57 A;  3LAG A;  1S2K A;  3WNN A;  4CUC A;  3KD4 A;  2GC3 A;  5ABJ C;  2BW8 A;  4URA A;  2FCT A;  3B94 A;  3WW2 A;  1NUK A;  5FLH A;  5BNQ A;  5CFD C;  1D2Q A;  5KWR A;  2JXA A;  3G7D A;  1U5X A;  4YVS A;  5F2W A;  4R6P A;  4W8J A;  2WQ4 A;  2VUJ A;  1AYM 1;  1VBE 1;  5KXC A;  3T30 A;  2HWF 2;  3MLL A;  5LK5 A;  5FV3 A;  1SLB A;  3WW1 A;  1QJZ A;  1JZ8 A;  1UGY A;  1LHW A;  1K42 A;  3OSD A;  2W2I A;  3WP3 A;  1VAM A;  3MIV A;  4GB3 2;  2V5D A;  3DKW A;  4LQR A;  1YQ6 A;  3AMN A;  4QPY A;  1ND3 A;  1Y9Q A;  2QFE A;  3TEZ A;  2WT1 A;  4PIT A;  1GOF A;  1W06 A;  5F5Q A;  4BIO A;  2L9L A;  4NHL A;  1SMV A;  4JAA A;  1WW7 A;  5J4T A;  4HVO A;  2DUO A;  1IKQ A;  3LIG A;  1PK6 B;  3KT7 A;  1OUR A;  5CYY A;  1POV 1;  4PIF A;  4LBM A;  2ZA9 A;  3N36 A;  1H30 A;  4QDR A;  3H7J A;  4JDO A;  2WH0 A;  3N9L A;  3MUY 1;  4Y1Z A;  4CRQ A;  2VOT A;  3U11 A;  3A23 A;  2B46 X;  3VHR A;  1AZD A;  2Q1F A;  1B09 A;  1WLC A;  1RUG 2;  2V72 A;  2P5B A;  4G9S B;  2VMI A;  2P3K A;  3PHM A;  5A7W B;  3THP A;  4BOW A;  4CEW B;  3GXU A;  4DMI A;  3O44 A;  4XF3 A;  1CPN A;  1LOG A;  2WS9 3;  5JOW A;  4MVT A;  4UFJ A;  5D2A A;  1W05 A;  2GN7 A;  4ZPI A;  5HXM A;  3S0M A;  3GYD A;  5CU1 A;  1JYC A;  2YBK A;  4DRV A;  5FUN A;  4M3C E;  1OLQ A;  4PLN A;  5DAQ A;  1UMZ A;  2XJT A;  1N3O A;  5A7P A;  3N7J A;  3VHN A;  1XXQ A;  3ELN A;  4RQP A;  5GZF A;  1KD7 A;  1AR9 3;  3MHZ A;  3KCX A;  3NV3 A;  2DUR A;  4Q8K A;  3IM0 A;  4ATF A;  4OUE A;  2BQP A;  3RYK A;  4CDQ A;  4PDW C;  1W0N A;  1W6M B;  5DDJ 3;  4CP0 A;  3KCC A;  1CAV B;  5T5J A;  4C1X A;  3SIT A;  4UI9 L;  3JD7 2;  2BN0 A;  4CDU A;  3ZYF A;  3MV1 1;  4DUV A;  4XE9 A;  3ZXF A;  4EQV A;  1SBF A;  1VBC 2;  3PME A;  1VRH 2;  3ZPO A;  2VZS A;  3RZL A;  2P2K A;  1O9D A;  3QCW A;  2XVL A;  1PMI A;  5FXX A;  2JDP A;  4Z1V A;  4ISQ A;  3MO4 A;  5A3T A;  1VBP A;  2W1S A;  3RWN A;  2J1E A;  2ERF A;  4DHS A;  4JQR A;  4A3Z A;  1JOB A;  2BRT A;  5I0S A;  4Q4Y 2;  1DYK A;  4YGD A;  2X10 A;  4L9B A;  3D6E A;  5FIX A;  5A33 A;  2WLQ A;  1YLL A;  1ZBE 1;  2JDH A;  4P9G A;  1KS4 A;  5C3P A;  2RJK A;  5H9S A;  4QD2 A;  2DCK A;  4ASK A;  1H2M A;  2CAU A;  3WHU A;  2XBO 1;  3A0K A;  3K48 A;  3M3E A;  4FO9 A;  3KQ4 B;  2VMH A;  2RHP A;  2HWC 1;  2VBP A;  4JC1 A;  3RSJ A;  1WKY A;  3ZYJ B;  5A33 B;  1KU8 A;  3THC A;  2OX0 A;  1XE8 A;  4A6S A;  3O1R A;  2ARX A;  3LPF A;  5CNA A;  5LX2 A;  3DF0 A;  1SCS A;  1UIJ A;  2FDJ A;  3I4I A;  4MET A;  5J37 A;  4AW7 A;  4ONU A;  3OUH A;  1GWL A;  3PU8 A;  4AEJ A;  1V6L A;  5FZD A;  2GP5 A;  2VNO A;  5F9T A;  4N53 A;  4A7K A;  1RUF 3;  3SH3 A;  3GBF A;  2XQR A;  3K4Z A;  3VBS B;  4CTE A;  5CFC A;  5FZO A;  1VBC 3;  4UT5 A;  2ETE A;  5J7M A;  2IVJ A;  2FDI A;  4FPY A;  3IPV B;  1VRB A;  1WCQ A;  2GAL A;  3JB4 C;  4LE3 A;  3E6C C;  1H6Y A;  1HJF A;  2J22 A;  4FAG A;  3KM5 A;  3HVD A;  3CIH A;  1Q8V A;  4YGC A;  4ZXE A;  4Q4Y 3;  4CDX A;  4D0Q A;  4LHL A;  1XYN A;  2GUE A;  5IUQ A;  4NN0 A;  3WR0 A;  5F3C A;  4Z8B A;  3BGA A;  4Y1U A;  4XET A;  4CDX B;  2HYQ A;  3F2Z A;  2A71 A;  1KJL A;  5FPA A;  2V4V A;  4LBO A;  1FX5 A;  3LA3 A;  4AED C;  1IPS A;  1D4M 1;  1VBE 2;  5DUX A;  2GSY A;  2A6X A;  1LOE A;  3AQG A;  1XYP A;  4UFK A;  2UWC A;  4GA9 A;  2WZR 1;  4NRM A;  5ABJ B;  1A4O A;  4JTN A;  1RIN A;  5CFD B;  5J96 B;  4HXC A;  1X1V A;  3RQ0 A;  4Q5O A;  3KSC A;  4C91 A;  3EB7 A;  4CYD A;  1QQP 2;  1IG0 A;  1RMU 1;  4UFM A;  5HF3 A;  4CCD A;  1Q8S A;  1W0P A;  3WDW A;  4IEQ A;  5DZE A;  4AI2 A;  3P1Q A;  3B9C A;  4OMD A;  4QKB A;  2XPJ A;  4EYU A;  2X8K A;  3FBM A;  2BGO A;  2RV9 A;  3VKM A;  3NNL A;  2ARC A;  4YM2 A;  5ERL A;  4ET7 A;  1ULC A;  4IV3 A;  1QJU 2;  1HRI 3;  3B02 A;  3U75 A;  4UF0 B;  5DAP A;  4B1M A;  1MS9 A;  4HK9 A;  1BHG A;  1H8V A;  3ZM8 A;  1S0F A;  1W90 A;  1A37 A;  2C0Z A;  2DFB A;  3KMH A;  5A6Z A;  3NJZ A;  2YC0 A;  4TLF A;  4Q0U A;  3OEB A;  4L8Q A;  1UPI A;  5J98 B;  1S0I A;  1QWR A;  1YFY A;  4UBG A;  5FBZ A;  1S0E A;  4E9K A;  2R06 1;  5C4W A;  5JWP A;  4TTG A;  2O02 A;  3OD4 A;  5DUV A;  2PLV 3;  3SEE A;  1AR6 1;  1QEX A;  1PXD A;  4IE7 A;  2V4A A;  4FXK B;  4YW7 A;  2A3X A;  4D3W A;  3I2J A;  4Y3B A;  1FAT A;  1S0J A;  2WRA A;  2JDA A;  3P6B A;  3V56 A;  3LFI A;  4ZU7 A;  4D94 A;  2B42 B;  1XPW A;  3SML A;  1QQP 3;  2BV4 A;  3PIG A;  3ZFE A;  5A6X A;  2BBV A;  4NPL A;  1LU1 A;  2UWA A;  4R6O A;  5J31 A;  3FZ3 A;  1V00 A;  4XF4 A;  3WUC A;  1JTZ X;  4XDP A;  4YYO A;  2BJS A;  4RHV 1;  3DUI A;  1QJU 3;  2JE9 A;  5I0D A;  3ZOI A;  2GNM A;  3PL0 A;  5FYY A;  2W1W A;  5FY0 A;  3WLU A;  4PDW B;  2ZKN A;  4GWM A;  4UFI A;  1X7N A;  5A3P A;  3IDE A;  2WO3 A;  4FOV A;  5CVR A;  4I0B A;  1TE1 B;  2OS2 A;  2VXR A;  4QQH A;  4E4Z A;  1JYW A;  1OT5 A;  3OTF A;  3O1S A;  1URX A;  2WQZ C;  2BUK A;  2H0B A;  5FP4 A;  3FHA A;  1O7F A;  5F8P A;  1JHJ A;  3SC7 X;  2Q1Z B;  2CV6 A;  1AXK A;  4BA6 A;  4PIU A;  2WUH A;  3E5X A;  3N7M A;  4LBL A;  4M4R A;  5H9Q A;  4S2H A;  4CDW A;  1TMF 1;  5IYY A;  2XBO 2;  1JOP A;  2R30 A;  3KV5 A;  4MXW A;  2HWB 1;  2HEY F;  2XHK A;  1GIC A;  3CHX A;  2H6B A;  2R0F A;  2YY1 A;  3BOP A;  2SLI A;  2Q4S A;  4RR3 A;  4WVM A;  1ZBA 3;  1TNR A;  2WQ8 A;  1YI9 A;  2IXC A;  1DGR A;  3MBW A;  5F5I A;  3POI A;  4OHW A;  4R6R A;  3RRD A;  1GUI A;  4BIS A;  2W87 A;  1S1A A;  2Y60 A;  4Q4X 3;  3GZE A;  1J3Q A;  1FOD 3;  3A4U A;  3GGL A;  3MW2 A;  3OBT A;  3OOX A;  4HG6 B;  3S30 A;  3OBA A;  3WVJ A;  2XH6 A;  1J84 A;  2ZXQ A;  1DQ1 A;  2JX9 A;  1N47 A;  4PQQ A;  2C9K A;  1IPK A;  4RN5 A;  5LBF A;  3N4M A;  3SHR A;  1AL2 3;  1PX4 A;  2VG9 A;  4N9H A;  1LOC A;  2PAE A;  4FPG A;  4CU9 A;  4B7E A;  3NKX A;  2IC1 A;  4JRA A;  3IAP A;  4L92 A;  4UW4 A;  4OHY A;  1LHV A;  4QB2 A;  4BQ5 A;  1N1T A;  3POY A;  1TG7 A;  1QDO A;  1W6O A;  1ZVF A;  5CG8 A;  4FTE A;  5GZE A;  4OHV A;  1W39 A;  3W5M A;  2JG8 A;  3CQC A;  2QDN A;  3AMM A;  2XQX A;  3LLY A;  2WAB A;  2C74 A;  1HQL A;  4Q1P A;  4DAT A;  1DZR A;  1FI2 A;  3C8X A;  5GLT A;  1IPJ A;  5FZI A;  1H9P A;  1WD4 A;  2R49 A;  4FFF A;  3N7K A;  4MXV A;  2B9U A;  3OCP A;  2JG8 B;  2ZGR A;  4AVV A;  4IEU A;  3VBH A;  1D4M 2;  2Y38 A;  2XWB B;  4Y4Y A;  4AGV A;  4R6Q A;  2EXH A;  1PVC 3;  5JZG A;  2HWE 1;  5JVV A;  3ZYP A;  1OQE A;  3WDT A;  4AVA A;  4ZZ8 A;  2WZR 2;  1K5M C;  3ON7 A;  3EFZ A;  3PUA A;  1I1E A;  1OOP A;  2W91 A;  3D82 A;  4F7R A;  4DOU A;  4MHU A;  3BCW A;  5JIA A;  3RVH A;  4AED B;  4AXO A;  5FZ0 A;  1RMU 2;  3K3O A;  3LD8 A;  4XUT A;  5C3S A;  4EE2 A;  5C33 A;  4C1W A;  2Q8D A;  3C3V A;  2OKX A;  2HJI A;  4IDZ A;  2WT0 A;  4XFA A;  1UWW A;  1EYB A;  4E2S A;  5K9Y A;  4NE9 A;  4B29 A;  2XJR A;  4BQ2 A;  3ZXK A;  2D6M A;  1UKG A;  1QKQ A;  2OPK A;  2WNV A;  1ST8 A;  4N84 A;  4Y20 B;  5AC9 1;  3NWK A;  4QX3 A;  4XDQ A;  3AYA A;  4CEY C;  1KUJ A;  2JDK A;  3TRS B;  3AKS A;  5FK7 A;  3P1I A;  1SCR A;  2F6B A;  1C8N A;  1ENR A;  1UU6 A;  1WCU A;  2ZHK A;  3FUQ A;  4QDS A;  1N3P A;  2XKP A;  2R06 2;  3JBG 3;  4HVR A;  4NIH A;  5FZG A;  3KVA A;  4I2O A;  5F5A A;  1HJG A;  3WP4 A;  4XQ4 A;  2EID A;  2Z4F A;  3AB0 A;  2Q5T A;  1AR6 2;  3ZIX A;  2Z79 A;  3AK0 A;  4FPE A;  3JUU A;  5CIR A;  4CCE A;  4AQS A;  1XXR A;  4UW6 A;  5FY4 A;  3V65 A;  5K4L A;  3WZ1 A;  3ILN A;  2A6Y A;  5KC5 A;  4K6B A;  3OGS A;  4DHP A;  1JXN A;  4FI9 A;  4YWA A;  3MF9 A;  2ZHN A;  2BMY A;  3MIC A;  4LKF A;  1VMH A;  1MEC 2;  3MIF A;  3HNM A;  1OLM A;  5DAW A;  2JG9 C;  4D7S A;  2YC2 A;  3E6D A;  1OA4 A;  3FHI B;  3KV4 A;  3WCR A;  2K0G A;  4ZXK A;  2HEV F;  3HN3 A;  4RHV 2;  3Q9O A;  2GAU A;  5A3U A;  3MZH A;  1DZQ A;  4RGG A;  1J3R A;  3S7E A;  3B5L B;  1JUH A;  4AFC A;  5JMC A;  1OQD A;  2A75 A;  1NZI A;  2PAM A;  3IDB B;  4SBV A;  4BXF A;  3BKZ A;  2W47 A;  1H1A A;  3PUI A;  2KA3 A;  3WQ0 A;  4BB3 A;  2R06 3;  1GU3 A;  2Q30 A;  2W92 A;  4RD7 A;  1UO9 A;  3BOD A;  2A73 B;  1OI6 A;  2YPD A;  5I0R A;  4BQ3 A;  2AYH A;  2ZGM A;  4D8M A;  3HBZ A;  3WNP A;  2C1F A;  1SAC A;  1TMF 2;  3FN9 A;  5CIS A;  1YJK A;  2HWB 2;  4TZD A;  2IUW A;  3I4R A;  1RUI 1;  1GNZ A;  1GWM A;  3UGH A;  1NT0 A;  2A3W A;  2CY6 A;  2BR9 A;  3ETQ A;  3I3Q A;  3T2O A;  1VAK A;  1I3H A;  3E97 A;  2ZKL A;  5JDB A;  4GWI A;  4HMZ A;  1NOV A;  1MEC 3;  3UBW A;  5FZM A;  5JR2 A;  4YM0 A;  3H50 A;  2VU9 A;  3UES A;  1ULP A;  2AEN A;  5DN2 A;  4DEQ A;  3TB0 A;  4P14 A;  1QOO A;  3D8C A;  4N43 A;  3LDK A;  1O5L A;  4DZG A;  3LM1 A;  1C1F A;  2EA7 A;  3ZSK A;  4AI1 A;  2PAK A;  3H1Y A;  3RZH A;  4CSW A;  1YQ8 A;  1ZZB A;  4RFR B;  3U14 A;  3QAC A;  2VW1 A;  3E5U A;  5J50 A;  3V0A B;  4ARY A;  4WM8 C;  5BY5 A;  3RMX A;  1KS5 A;  1YHF A;  2LM3 A;  5K8S A;  4DAU A;  3M70 A;  1UQX A;  3RG0 A;  4LMF A;  3MV0 1;  4MZU A;  1WMD A;  4C0B A;  2FDG A;  3KHC A;  2CGP A;  2BWC A;  3QOP A;  2JEM A;  1HXS 1;  4XJZ A;  2MEV 1;  4B4P A;  5LEJ A;  4MGT A;  1WS5 C;  4SLI A;  4B7K A;  1UMI A;  4GUL A;  4JQT A;  4BQW A;  2Y6K A;  3N9P A;  2ZOE B;  3J7L A;  3OBZ A;  3VBF A;  3DXU A;  1LOF A;  1TME 1;  3PNA A;  1W03 A;  1HV0 A;  2IXK A;  1EAH 3;  4MGI E;  1CR7 A;  2DCJ A;  4CP9 A;  3W9A A;  1W9S A;  2HWE 2;  4O46 A;  1UGX A;  4OYU A;  5GKA C;  4BCU A;  4JGZ C;  5IWF A;  5IVJ A;  5FXW A;  5L36 A;  3FWE A;  3SMK A;  4XAA A;  2XLA A;  1F15 A;  1NAE A;  3EO6 A;  4HPK A;  3V0B A;  3OBR A;  5FYC A;  2VBD A;  4Q4V 3;  1FNY A;  5I8T A;  1HRV 2;  3WF2 A;  3RZZ A;  2ET1 A;  4CU8 A;  3POW A;  2Y8K A;  1EUT A;  1DGL A;  1K5M B;  1IS5 A;  4HPK B;  3V0B B;  3U78 A;  3W59 A;  4YFZ A;  2ZEZ A;  2VOK A;  4IGP A;  3GBG A;  1GOH A;  3VZK A;  3IT8 A;  3UET A;  1OUS A;  1RXF A;  2O98 A;  1GWK A;  2KXL A;  3CBN A;  4YPJ A;  1FMD 1;  4QLI A;  1YCI A;  1CJP A;  5FYU A;  3ZXG A;  4ERO A;  3KT1 A;  4R4X A;  5AC9 2;  3CMG A;  4EN6 B;  3RJ2 X;  4XZU G;  4CVU A;  3M50 A;  4AR2 A;  2PHL A;  4I01 A;  1C8M 3;  1GQH A;  2CGO A;  4PJY A;  5IK4 A;  1A38 A;  1POQ A;  2RM2 1;  2VVF A;  3ZN4 A;  1GSL A;  4CEY B;  1WME A;  4DS0 A;  5FDB A;  4DX0 A;  1W8W A;  2WBK A;  1COV 3;  2VQA A;  1D2S A;  4XIK A;  2ADD A;  1E5R A;  2AGS A;  5ACA 3;  2WZE A;  4RS5 C;  2Q1M A;  1YI7 A;  4O7X A;  2R0H A;  4CXW A;  1CGP A;  3SH5 A;  5FRA A;  1O3R A;  3CZJ A;  1GZW B;  1HRV 3;  1OF4 A;  4HT1 T;  4DQA A;  2RMU 2;  2W52 A;  4OHZ A;  1A8M A;  4I0W B;  2ZMK A;  3L2Y A;  1WCK A;  5GZG A;  3O8I A;  1H4H A;  4M3C B;  3PMS A;  4NAO A;  3WV6 A;  2ZGT A;  3OGV A;  5LBE A;  4LK7 A;  5CKM A;  1US3 A;  1H0B A;  1XEZ A;  3LB9 A;  4JV4 A;  4O9G A;  2ET7 A;  4W6Y A;  2DU1 A;  1LED A;  3GCW A;  3LA2 A;  3VKF C;  4AZZ A;  2JG9 B;  4EV0 A;  2ORZ A;  4QHB A;  3M1H A;  3ZYG A;  1XNA A;  1CQ9 A;  1UYZ A;  4KG0 A;  4HON A;  2HH9 A;  2E7T A;  3KZ4 C;  5L19 A;  5FY9 A;  1ULE A;  1PZ9 A;  3VDD C;  3H8X A;  1NXM A;  3IN9 A;  3NKG A;  4KWJ A;  1PHM A;  4JGY A;  4J6G A;  4L0P A;  4LA3 A;  5A1F A;  3THD A;  4L2N A;  1RUI 2;  2PTM A;  3POG A;  5FXZ A;  1DQ2 A;  2PHD A;  2YMZ A;  2HWD 1;  3CNA A;  3IDC B;  4JGY B;  5T5O A;  3A22 A;  2XJV A;  5T55 A;  4COZ A;  3AZV A;  4P5H A;  2RMU 3;  1ASJ 1;  3M2M A;  2BNO A;  1UYP A;  2RDN A;  2DBI A;  1GBG A;  2VZO A;  5BNO A;  2NP0 A;  5FYV A;  3WUD A;  1QGL A;  1CES A;  1US2 A;  5HCA A;  5C70 A;  3ZDS A;  1B35 A;  3CJI A;  3VBU C;  4J6S A;  3INA A;  2ARE A;  4GMP 1;  2P37 A;  5BPX A;  3AL5 A;  4EZH A;  5C71 A;  1RGS A;  2A6W A;  3EBR A;  1WW5 A;  4HZF A;  2VMG A;  3VZG A;  1C3H A;  2ZX2 A;  1AR7 3;  1PX3 A;  5I0U A;  3MUZ 1;  1F35 A;  2ID4 A;  3DPR C;  4KGG A;  3ZYH A;  4LT5 A;  4OLL A;  2BPA 2;  1S55 A;  1UIK A;  3HNY M;  3MDP A;  2YC4 A;  3UT0 A;  4XCA A;  3NKT A;  3UKV A;  1R08 3;  4R9C A;  4OMC A;  3PUH A;  4PQ9 A;  5FUI A;  2X5I A;  4QQ2 A;  3R6S A;  3KF5 A;  1HXS 2;  2D3S A;  2MEV 2;  1G9F A;  4WM8 B;  1PO1 3;  1WW4 A;  3PIJ A;  4CCK A;  1ZRR A;  4UFH A;  3SKV A;  2B5H A;  1TME 2;  1OD3 A;  5E8A A;  1XC6 A;  4R8H A;  1DYP A;  1RUC 3;  1QOS A;  3I8T A;  4IGO A;  2IXL A;  3POB A;  1NE4 A;  1OH3 A;  5A3N A;  3BIE A;  4XJA A;  4W4Z A;  2Q8E A;  2VTX A;  5EJ1 B;  4FT8 A;  1ULF A;  4A6O A;  4AFA A;  3VL8 A;  4H3W A;  4BMB A;  2AEZ A;  1Q8P A;  3K4D A;  5IVV A;  5CG9 A;  1NA1 A;  2XL9 A;  1VBD 3;  1Q8O A;  1LGC A;  2XVG A;  3DYM A;  1W2U A;  4JGZ B;  5H9P A;  1ZZ7 A;  4IEZ A;  1A34 A;  3ZFG A;  1MS0 A;  4QM9 A;  1J1L A;  5IVF A;  2J1S A;  2VTX J;  2Y6L A;  4TXW A;  2D3R A;  3NJV A;  1RXG A;  1X36 A;  4YG0 A;  5E89 A;  4ZHN A;  3HT2 A;  2Y64 A;  4K1Z A;  1WWY A;  1W8U A;  4MYE A;  4XW3 A;  2EVX A;  1FMD 2;  5A7Q A;  5T3N A;  4RYD A;  2D6L X;  1ZZ6 A;  1YFW A;  3LDR A;  2XUE A;  2NYY A;  1KDM A;  3ILF A;  3WG2 A;  4Y5I A;  2HLE A;  4BG6 A;  2VO5 A;  3UKN A;  1CPM A;  4OFG A;  2XLF A;  5DZF A;  1W8T A;  5G05 L;  2DFC A;  2NPM A;  2WAA A;  3PVB B;  1YIF A;  2RM2 2;  4LBJ A;  2BER A;  1GZ9 A;  1AJO A;  4GWJ A;  1NX9 A;  1IQD C;  1MZE A;  2ZGL A;  1GNY A;  1F4H A;  1O59 A;  4OUL A;  5LW9 A;  2QP2 A;  4D6Q A;  5FCC A;  2Z2S B;  4AL9 A;  1H8T A;  3IMM A;  3WG3 A;  1XND A;  3EJK A;  3USU A;  1ULO A;  3MFA A;  1V9U 1;  4AHW A;  1HQW A;  1KFX L;  3ZSE A;  2CTV A;  2E9Q A;  3CLP A;  1NZC A;  4I0A A;  4AGR A;  1R09 1;  1JZ6 A;  4LBK A;  3ITQ A;  4WVW A;  2A6V A;  3HPN A;  1CAU B;  3HQU A;  2QQP A;  1QHD A;  2B7Y A;  2VNG A;  1C5I A;  4QX1 A;  1O4Z A;  1PVX A;  3G6J B;  4LO4 B;  1FV2 A;  4XAC A;  1LUL A;  3NAP A;  5EXG A;  4IER A;  4WVZ A;  4XFC A;  1FMD 3;  4YG3 A;  1W28 A;  1JYT A;  2O8Q A;  1SLC A;  2WFF 3;  4H2A A;  1WS4 C;  4OZO A;  4LOS A;  1LNS A;  1VBA 3;  5FO9 B;  3RZG A;  2Y34 A;  3OUJ A;  4HBN A;  4QB1 A;  1C3N A;  1X9T A;  4NIA A;  4MUV A;  1RVF 3;  1SDD B;  4CP1 A;  2PHU A;  4GKX A;  3C2U A;  1SLL A;  2RJ2 A;  3AZX A;  4YM1 A;  1Y9M A;  3HT1 A;  1CON A;  1WZX A;  1R64 A;  3CL1 A;  5EPA A;  3WF1 A;  4CCC A;  1GQG A;  1O4Y A;  4IEW A;  5A70 A;  2VZ3 A;  1PM4 A;  4Q8L A;  1RUJ 1;  4OVE A;  2J1R A;  2RDR A;  1ZX5 A;  3WP6 A;  4AI3 A;  5FZ3 A;  2IFR A;  3VZL A;  3OJB A;  3VZO A;  1WLW A;  2HWD 2;  1Y3T A;  3I2F A;  3VDD B;  2E53 A;  2JKX A;  3MF6 A;  4AFB A;  3LL2 A;  1LGN A;  5C3Q A;  5IK5 A;  2RS1 1;  3ZPY A;  3M7A A;  1ASJ 2;  2JD4 A;  1U5I A;  2XOM A;  4UFL A;  3B7M A;  3ASI A;  5I93 A;  4Q2F A;  3WDV A;  5FUP A;  3NO8 A;  2VL4 A;  4MV2 A;  1W9T A;  4Q0Q A;  3LLZ A;  4AFD A;  1UGW A;  2Y6F A;  4ZDR A;  1PGS A;  2E31 A;  1AL0 G;  1K3I A;  4GXL A;  3UJO A;  4LUK A;  1W8Z A;  4QPG C;  2PHR A;  5DG1 A;  4AK3 A;  5FKB A;  4H7L A;  1IKP A;  5DPN A;  2GTY A;  4Q26 A;  1UZW A;  3HR9 A;  5BUV A;  3VBU B;  2ZGQ A;  1PK6 A;  2PA7 A;  1UH0 A;  3I3D A;  1H4G A;  2BMZ A;  5A32 A;  2ZGP A;  4MGZ E;  2R32 A;  1UAI A;  2QZ3 A;  1H2L A;  4JKM A;  3C7G A;  1UY3 A;  3KHB A;  2E51 A;  4A42 A;  2BGP A;  3AXY C;  4XFF A; 
#chains in the Genus database with same CATH homology
 3SEE A;  2J1A A;  1UYX A;  2W3J A;  5LA0 A;  3WF0 A;  2VM9 A;  2VC9 A;  2C4X A;  4ARX A;  3I2J A;  3NRU A;  2JDA A;  5EIY B;  1JYX A;  3ECQ A;  3P6B A;  3ETP A;  5JXH A;  5JXI A;  1XPW A;  2QQI A;  2VZU A;  4ZZ5 A;  3ABZ A;  4Z2A A;  3VD5 A;  3NJX A;  3OEA A;  3WNL A;  3DYO A;  3III A;  5I0D A;  1JZ3 A;  2W1W A;  1JYN A;  1DYO A;  2WO3 A;  2QQN A;  1JZ7 A;  2J1T A;  1OT5 A;  2VZP A;  1JYW A;  2WO1 A;  2YB7 A;  3WNM A;  4W50 A;  2WDB A;  2Y6G A;  3FHA A;  3K77 A;  1JHJ A;  3WSO A;  1W8N A;  4DXR A;  2WUH A;  2VZT A;  4M4R A;  5IHR A;  5IYY A;  2W9X A;  2VZV A;  1O8S A;  2VZR A;  2WO2 A;  4CUA A;  4LHS A;  3U37 A;  2X09 A;  3GDB A;  4A44 A;  2WQ8 A;  3MBW A;  3T08 A;  1GUI A;  5A1A A;  2W87 A;  4JX0 A;  2YFZ A;  3T2P A;  1I5P A;  4HG6 B;  3GGL A;  3IDA A;  3OBA A;  3GM8 A;  1CZV A;  1J84 A;  2ZXQ A;  1W99 A;  2QQJ A;  4PQQ A;  2C9K A;  4RN5 A;  2VZQ A;  1PX4 A;  3VD4 A;  1W9W A;  4CU9 A;  1UMH A;  3IAP A;  4QB2 A;  2LS6 A;  1TG7 A;  3CDZ B;  3LEI A;  3DYP A;  2X05 A;  3LEK A;  3OB8 A;  3W5M A;  2XQX A;  2WAB A;  1L7Q A;  3C8X A;  5G04 L;  4JHZ A;  1NKG A;  4DXS A;  2CDP A;  4JKL A;  4QX2 A;  3C7E A;  3E1F 1;  4ZZ8 A;  1JYV A;  3VD3 A;  2W91 A;  3T0A A;  3J7H A;  4QPW A;  4KWU A;  4XUR A;  2VMC A;  3JXS A;  4XUT A;  2C26 A;  2OKX A;  1UWW A;  4BJ0 A;  2W5F A;  3WNK A;  4QX3 A;  1UY1 A;  2JD9 A;  2VCC A;  2VQT A;  4P5Y A;  3P1I A;  2VQU A;  3C7O A;  4XUQ A;  4QDS A;  5F7U A;  5EJZ B;  1L7R A;  2EID A;  2Z4F A;  3T0D A;  5HPO A;  4KI5 M;  2VME A;  2B9V A;  2W1Q A;  3OGS A;  3WNO A;  4FI9 A;  2EIE A;  5IFT A;  3HNM A;  2YC2 A;  3K46 A;  1W8O A;  2PQS A;  3HN3 A;  3WEZ A;  3IAQ A;  2BZD A;  2W47 A;  3PUI A;  3OG2 A;  2W92 A;  1GU3 A;  4CU6 A;  3SEP A;  5LA2 A;  2VCB A;  4D8M A;  2XON A;  3T09 A;  3WNP A;  3FN9 A;  4MGQ A;  3BN6 A;  3LQC A;  1XNT A;  3T2O A;  5JXJ A;  2ORX A;  4GWI A;  2J1V A;  5JR2 A;  5JXG A;  2ZEY A;  2VMF A;  3UES A;  4DEV A;  1ULP A;  3ACH A;  5DN2 A;  4DEQ A;  2LW8 A;  2VJX A;  1OF3 A;  3HNB M;  2XHN A;  3WF3 A;  4ARY A;  5CZK A;  1PMH X;  1EUU A;  3MV0 1;  4BXS V;  5DMY A;  4LPL A;  1P8J A;  1T2X A;  3WF4 A;  1UMI A;  2Y6K A;  4XUP A;  4AG4 A;  1F4A A;  1UX7 A;  4IUG A;  2QQO A;  4QAW A;  3HJR A;  2DCJ A;  3WQB A;  1W9S A;  5LCW L;  2WN3 A;  4P08 A;  3T0B A;  2ZEX A;  4OYU A;  1CZT A;  4A4A A;  2VCA A;  1NAE A;  1H6X A;  4QX0 A;  1YQ2 A;  3WF2 A;  1JU3 A;  1SHW B;  3CZU A;  4CU8 A;  1UY2 A;  2Y8K A;  3C7H A;  1EUT A;  1KGY A;  3LE0 A;  2VMD A;  2ZEZ A;  1GOH A;  3LEG A;  3UET A;  2J1U A;  4YPJ A;  2DDU A;  5J1X A;  3CMG A;  3I97 A;  4XZU G;  4CVU A;  1GQP A;  4MAD A;  3IB3 A;  1CIY A;  2CDO A;  1UXX X;  2W95 A;  4E8D A;  5B4X A;  3CQO A;  2WBK A;  2YG0 A;  4JKK A;  2WZE A;  3A7Q A;  5JUV A;  4CU7 A;  4UOJ A;  4XUO A;  1RYY A;  4PF1 A;  3CZJ A;  1OF4 A;  2E32 A;  2VZ1 A;  4LKS A;  4MGS A;  1JI6 A;  3FHQ A;  4BK5 A;  2JE8 A;  4KMQ A;  3OGV A;  2YFU A;  3EYP A;  1US3 A;  3FL7 A;  1JZ5 A;  3I3B A;  1GOG A;  1UY0 A;  3I2H A;  4M4P A;  3HEI A;  3W5N A;  2QBX A;  1HN1 A;  2ORZ A;  1SG3 A;  1XNA A;  3K75 B;  1UYZ A;  3NQH A;  4QDQ A;  1DP0 A;  1DLC A;  3WNN A;  4CUC A;  4AAX A;  1NUK A;  2Y6J A;  4W8J A;  4L0P A;  3THD A;  1JZ8 A;  2Y6H A;  1K42 A;  2V5D A;  4LQR A;  3A22 A;  2W1U A;  4XVH A;  3HOB A;  2VZO A;  1GOF A;  2L9L A;  1K45 A;  1US2 A;  3ACI A;  5C70 A;  2R7E B;  2HYX A;  5C71 A;  5CYY A;  4QDR A;  3I2I A;  4GZ9 A;  1PX3 A;  3MUY 1;  2VOT A;  1KEX A;  3MUZ 1;  2ID4 A;  3A23 A;  1JZ4 A;  3HNY M;  2YC4 A;  2V72 A;  2VTF A;  4DXT A;  4OMC A;  3PUH A;  3GXU A;  5FUI A;  2VR4 A;  1UYY A;  2QQM A;  4DUX A;  5JMO A;  5HXM A;  3UNP A;  5DQ0 A;  1K12 A;  3VDA A;  3SKV A;  1OD3 A;  1XC6 A;  4A45 A;  4XUN A;  3A21 A;  3DEC A;  5B4N A;  4W4Z A;  3X0U A;  4OUE A;  5EJ1 B;  4A6O A;  3K4D A;  1W0N A;  1TVG A;  3T2Q A;  2BBA A;  4P02 B;  4BDV B;  4UI9 L;  3DYM A;  3ACG A;  3MV1 1;  4DUV A;  1D7P M;  2KD7 A;  2VZS A;  2J1S A;  2Y6L A;  2E33 A;  1MPX A;  3C7F A;  4TXW A;  3NJV A;  1CX1 A;  3AC0 A;  3MO4 A;  2Y64 A;  2W1S A;  2J1E A;  4RYD A;  4A3Z A;  2X10 A;  4E8C A;  4CUB A;  4A41 A;  2HLE A;  2W46 A;  2VO5 A;  2ZEW A;  3NNG A;  4ZY9 A;  3VD9 A;  2DCK A;  4BK4 A;  5G05 L;  2WAA A;  2BER A;  1GMM A;  1WKY A;  4GWJ A;  1NX9 A;  3VDC A;  1IQD C;  3THC A;  3OGR A;  1GNY A;  1F4H A;  1O59 A;  2QQK A;  3LPF A;  1CZS A;  1OH4 A;  2EIC A;  4UAP A;  1ULO A;  1UZ0 A;  1JZ6 A;  2W94 A;  3HPN A;  2E26 A;  3K4Z A;  4QX1 A;  4QB6 A;  3I2G A;  1UXZ A;  1WCQ A;  1H6Y A;  2J22 A;  4ZXE A;  3CIH A;  4D0Q A;  4OZO A;  1LNS A;  2RVA A;  4QB1 A;  3K4A A;  4P00 B;  1SDD B;  2B4K A;  1JZ2 A;  2RJ2 A;  3BGA A;  2WN2 A;  5C7G A;  1R64 A;  3WF1 A;  3F2Z A;  3D3A A;  4MOA A;  1J83 A;  2V4V A;  1O8P A;  3SKJ E;  2VZ3 A;  3CKH A;  2J1R A;  4DUW A;  3I2K A;  3LPG A;  1UY4 A;  1PMJ X;  3I2F A;  2JKX A;  2WYS A;  2WAO A;  4MO3 M;  2J7M A;  3EB7 A;  3ACF A;  2XOM A;  3VD7 A;  2VL4 A;  4OMD A;  2QQL A;  1W9T A;  5IFP A;  2BGO A;  2E31 A;  2RV9 A;  1K3I A;  2WZ8 A;  4ET7 A;  1JU4 A;  5DPN A;  1BHG A;  3ZM8 A;  5IJR A;  3VDB A;  3I3D A;  3I3E A;  5LA1 A;  3OEB A;  4JKM A;  3C7G A;  1UY3 A;  2EIB A;  4TTG A;  4PT6 A;  4A42 A;  2BGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...