1CIYA

Insecticidal toxin: structure and channel formation
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
577
structure length
577
Chain Sequence
YTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPSTIYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus thuringiensis CryIA(a) insecticidal toxin: crystal structure and channel formation.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Toxin
molecule keywords CRYIA(A)
total genus 182
structure length 577
sequence length 577
ec nomenclature
pdb deposition date 1995-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00555 Endotoxin_M delta endotoxin
A PF03944 Endotoxin_C delta endotoxin
A PF03945 Endotoxin_N delta endotoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.190.10 Mainly Alpha Up-down Bundle Delta-Endotoxin; domain 1 Pesticidal crystal protein, N-terminal domain 1ciyA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1ciyA03
2.100.10.10 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Pesticidal crystal protein, central domain 1ciyA02
2V5DA 1JYWA 2W5FA 4QAWA 1IQDC 1OF4A 4P00B 1CX1A 3A21A 3MV01 5EJZB 3WNPA 4QPWA 2RVAA 1L7RA 5JMOA 2Z4FA 1OF3A 3THCA 3VDAA 2VCCA 4CVUA 1CZTA 1H6XA 3WNLA 4W50A 4QX0A 5JXIA 1W8NA 1J84A 4KI5M 5IJRA 1GUIA 1HN1A 1XNTA 4CUAA 4QX3A 2J1RA 1UYZA 2EICA 2KD7A 2W1WA 3I97A 4FI9A 3FHQA 3OBAA 4RYDA 2L9LA 5EJ1B 2QQJA 1UYYA 1CZVA 3SEPA 1W9WA 1DYOA 4ET7A 2WN2A 1YQ2A 2QQOA 2BERA 2W95A 2C9KA 3UESA 3UNPA 2WUHA 1K3IA 2J1AA 3NQHA 1K42A 1OD3A 2XQXA 4GZ9A 4QB6A 3LPFA 5LA0A 1NX9A 3LPGA 1JZ6A 2W87A 2VJXA 1O59A 3GDBA 5B4NA 5IFTA 1UY0A 1PMHX 5J1XA 4P02B 3ZM8A 1W8OA 4BXSV 4QDSA 3I2KA 3VD9A 1UWWA 2VZSA 1F4AA 2WN3A 3LQCA 4JX0A 4ZXEA 2VMDA 1JU3A 1JZ5A 3VDCA 1SHWB 1GU3A 2YG0A 4A44A 1EUTA 3HEIA 5JUVA 3NJXA 2Y6GA 3LEIA 3VD7A 1JHJA 4ARXA 4XZUG 4TTGA 2RV9A 4CU8A 5C70A 4XURA 2J1EA 1US3A 3K4DA 2WO1A 2VO5A 3IIIA 1OH4A 3I2HA 4DXSA 5DN2A 3K4ZA 3C7EA 5LCWL 2WBKA 1DP0A 2Y6HA 2YB7A 3OB8A 4LPLA 2VTFA 1JZ3A 1JU4A 2E31A 1UY2A 3CMGA 2VM9A 2WO2A 3ACIA 4M4RA 3OGRA 3WF4A 2WO3A 3T08A 1MPXA 1JZ2A 3THDA 4DXRA 4QDQA 5JXJA 2VZVA 4HG6B 4BK5A 1ULOA 3SEEA 1K12A 5A1AA 2JKXA 5B4XA 2QQMA 4UI9L 3MO4A 4DUXA 4ZZ5A 1ULPA 5I0DA 4DEVA 1OT5A 4TXWA 4DUVA 4XUPA 1XC6A 1GOGA 2ORXA 1NUKA 2J7MA 5C7GA 4DUWA 3HOBA 3I3BA 4AAXA 5LA2A 2VZPA 3DECA 2VMFA 4A41A 4A3ZA 2J1UA 2ZEZA 2ZEWA 3MV11 2W1QA 4CU9A 2ZXQA 2DCJA 1UZ0A 2WYSA 5FUIA 2WDBA 3OEAA 2QQNA 2Y8KA 4XUNA 3A22A 2B9VA 1W9SA 2VQTA 3UETA 2R7EB 3WF2A 3WF3A 4UOJA 3T0BA 4PT6A 4OMCA 4OUEA 1GOFA 1US2A 1JZ4A 3HNMA 4JHZA 1CZSA 3T2QA 1XNAA 2VC9A 5G04L 4XUQA 1W0NA 2VZQA 4KMQA 3CQOA 4QB1A 4P5YA 3ABZA 3C7OA 1NKGA 5DQ0A 4QDRA 4OMDA 4LQRA 1PX3A 1JYXA 3WQBA 3HJRA 1J83A 2RJ2A 5EIYB 1GOHA 1PX4A 2C26A 3EB7A 3A7QA 2VZOA 2X05A 3WNOA 4QX2A 5JXGA 2EIEA 2W3JA 3JXSA 3W5NA 1UX7A 1F4HA 3BN6A 2W1UA 4OYUA 3FL7A 3VD5A 2X10A 3FHAA 3LEGA 4GWIA 2XOMA 3SKVA 4JKKA 3PUIA 4UAPA 3T0DA 1L7QA 3ETPA 2QQIA 3WSOA 2E26A 2J1TA 2VCAA 3CZUA 3DYPA 4IUGA 3WEZA 4CU7A 1JYVA 3WNMA 2QQLA 3IAPA 2VR4A 2WABA 4DEQA 2BGPA 2DCKA 1CIYA 2QBXA 2J1SA 1DLCA 3OG2A 3HN3A 1W99A 1R64A 4ZY9A 5HPOA 1TVGA 5CZKA 2VZ3A 1KEXA 4CUBA 4DXTA 1BHGA 2VMEA 4A42A 4BDVB 4L0PA 2CDOA 4P08A 2DDUA 4XUTA 2WZEA 3P1IA 4QX1A 2ID4A 1SG3A 1UXZA 4MOAA 3HPNA 1D7PM 3T0AA 3ECQA 2C4XA 1O8SA 5IFPA 2B4KA 3MUZ1 3U37A 2WQ8A 4OZOA 4CU6A 4W4ZA 3HNYM 3GGLA 4GWJA 2ZEYA 2XONA 2WZ8A 5C71A 3DYMA 3NNGA 4A6OA 1UXXX 2W91A 3OEBA 1NAEA 2E33A 2VCBA 4MGSA 3I2JA 2WAAA 3EYPA 4E8CA 2WAOA 3WNKA 3X0UA 2J22A 2VOTA 1JYNA 4ARYA 4RN5A 2VQUA 2V4VA 1UMHA 1GNYA 1UY4A 4CUCA 3OGSA 3C7FA 5CYYA 2LW8A 2VMCA 2VZRA 4D0QA 1I5PA 2HLEA 3NRUA 4LHSA 3CDZB 5LA1A 2W9XA 2QQKA 1P8JA 3LE0A 4LKSA 3FN9A 3SKJE 3C7HA 2JE8A 5IHRA 3K75B 3IAQA 3OGVA 2E32A 2JDAA 3PUHA 4W8JA 4Z2AA 4JKMA 4BK4A 3VDBA 3E1F1 1UMIA 3WNNA 3I2IA 2W92A 3A23A 2VZ1A 4PF1A 3MUY1 3I3DA 1KGYA 1T2XA 1JZ8A 5IYYA 4AG4A 3WF0A 2LS6A 3C8XA 3CKHA 4D8MA 3ACHA 2EIDA 3T2PA 3I2FA 3T2OA 3CZJA 3ACGA 2CDPA 4E8DA 3WF1A 3AC0A 1W9TA 3C7GA 5JXHA 3MBWA 4MO3M 3I2GA 4XVHA 2XHNA 3J7HA 4M4PA 3P6BA 5JR2A 3VD4A 2Y6JA 3HNBM 3K4AA 1XPWA 2OKXA 1WCQA 3K77A 1WKYA 3LEKA 3CIHA 1UY1A 5DMYA 3NJVA 3IB3A 2W94A 2X09A 3D3AA 1UYXA 5F7UA 4MADA 4ZZ8A 3VD3A 1GQPA 1PMJX 3I3EA 2J1VA 4BJ0A 2PQSA 4A4AA 3IDAA 4QB2A 2ORZA 2Y6KA 1O8PA 2ZEXA 1TG7A 3T09A 1K45A 5DPNA 2BZDA 1GMMA 1SDDB 2YC4A 2BBAA 3BGAA 3K46A 5G05L 3GXUA 4A45A 2YFUA 2YFZA 2EIBA 2JD9A 2Y6LA 3ACFA 1EUUA 4KWUA 2VZUA 4JKLA 2VL4A 1RYYA 3GM8A 1UY3A 2W1SA 4PQQA 2W46A 1JZ7A 2V72A 3W5MA 3DYOA 1JI6A 1LNSA 5HXMA 2BGOA 1H6YA 4YPJA 2W47A 4XUOA 2Y64A 4MGQA 2HYXA 2YC2A 2VZTA 3F2ZA
chains in the Genus database with same CATH superfamily
3NAPA 4Y5TA 1UGWA 1U5ZA 1ZRRA 2ZAAA 4IEUA 3BTYA 4RA0A 5FZFA 2VY0A 3MV01 3OGJA 3FUOA 2K2SA 1LOAA 1TMF3 3A0KA 2RVAA 1VBA1 3ETQA 3WLUA 4CDUA 4GIQA 3B3QE 3MZHA 2RJLA 5JMOA 2Z4FA 1DIWA 3FLPA 3ZYHA 2ZKLA 3AFGA 1AXZA 4NROA 4W50A 1GV9A 5I8YA 2RDSA 5JXIA 2Q5TA 4CDXC 2D6OX 4KWJA 1UZZA 4ZKTB 5EXAA 4Q4W1 1CAWA 5IJRA 1XNTA 3ITQA 5K0UC 4QX3A 2J1RA 3BALA 1J1LA 1ENXA 1UYZA 5HI0A 2BU9A 3CL1A 1CAVB 3ZIWA 3OBAA 2Y0IA 4M01A 4RYDA 3ALQA 3AYAA 3ZR6A 1OA4A 4CYDA 4V2VA 2P5BA 1B35A 5H9SA 2QVSB 4HK8A 2GZWA 3AXDA 1SLIA 1WMDA 3L2HA 5IVJA 4HKCA 2WN2A 3M51A 1QXRA 3TEZA 2GSYA 2P2KA 5FZ8A 4D7SA 2W95A 2ZGMA 1ZGRA 1WW5A 2G1MA 2GN3A 1WUVA 1TE1B 2WUHA 1G9DA 2EXKA 1NY72 2WS91 1RUI3 4K6BA 4NWVA 1Z78A 2J1AA 3OJBA 1UU4A 2PHRA 3NQHA 1K42A 2Q8EA 1OD3A 5KC6A 2K9ZA 4NHXA 4QB6A 4CDUC 5LA0A 4XF0A 1AR72 2KA3A 1NX9A 2Q0AA 1Q8VA 3BOPA 3VBOC 2A73B 3ZXAC 4D6SA 4XIOA 2VJXA 1O59A 1DGWX 1HB1A 1I5ZA 1YJLA 2PHTA 5B4NA 3ZFFB 5GLWA 2R6QA 3E6BA 4XF3A 4CDQA 3ZM8A 4Q4Y1 5BNNC 2UU8A 2D43A 3WP4A 2MEV2 3E97A 2XJPA 5H9RA 5A7WB 5ABJA 4PIXA 4XTMA 1KS4A 2WNUA 1X36A 1AYM2 2XH6A 2JDHA 3DPRB 4HBNA 2CV6A 1MS0A 4FPFA 1XE7A 4ZXEA 2VMDA 1F35A 1AHSA 5HF3A 3BCWA 1SHWB 2YG0A 4UFLA 3TN91 4IEOA 4A44A 1ZZ7A 5FMDA 4HK9A 4DHRA 1AL0G 1COV1 3PVNA 3MF9A 3NJXA 1DBNA 2G9ZA 1Z0HA 2TEPA 4KWKA 5J31A 4LBMA 3RS6A 2P17A 4LR4A 1LTEA 5FY0A 4CEWA 1HV0A 2XKPA 2RV9A 2HWD3 4IEAA 1H2LA 1MS3A 3CO2A 5A3TA 2VXRA 1EAH3 3GZTB 2JIJA 3J7MA 3K4DA 2VO5A 3PVBB 1S0EA 2E6VA 2D3PA 3NL1A 5FR3A 1AR91 3OY8A 5DG1A 5A6YA 1CESA 1A8MA 1REFA 1OH4A 4L9BA 4ATEA 3I2HA 3UKVA 1WLTA 4PHZA 2JG9B 5BN6E 3K4ZA 1U0AA 2HWC1 1XRUA 2YUEA 3BTAA 3SC7X 1PGW1 3AK0A 4YW7A 4DHMA 5FREA 5FQ0A 2G9FA 3S7EA 2VM9A 1VR3A 1RUG3 2OXBA 1WA4A 3DKQA 3PU3A 2IXIA 2WNVA 4M4RA 3WDWA 3WF4A 2YMZA 2WO3A 4QMAA 3AKRA 3W9AA 4AEKA 1JZ2A 2G9GA 4JQRA 2DFCA 4QDQA 1UU5A 4BQ5A 5I0RA 4V2WA 5FQ0B 3AP9A 4HG6B 4AEMA 5HCHA 1ZREA 1KUJA 5FXWA 1K12A 3AJYA 3SEEA 3TN92 1OLME 4B7EA 1AR71 2QQMA 3VBHA 1N1SA 4UI9L 2NQYA 2B46X 1V0AA 3FLRA 3MO4A 1MVEA 2VBBA 4DUXA 5I0DA 4QHBA 1BBT3 1VE0A 4Y3BA 1OT5A 2A6YA 2W08A 4N7UA 4DUVA 4QQLA 3POGA 5FJKA 1XC6A 3IMMA 3QH7A 4N7YA 2ORXA 1KXGA 2J7MA 4Q4Y2 4XW3A 3P1OA 2CTVA 4JDOA 4XYXA 1OKQA 3A4UA 3HOBA 5K0UA 1V70A 1WD4A 1JACA 1N3OA 3JBG3 1NOVA 1VBD3 3K3OA 1W8FA 4CCLA 1DF0A 3GNEA 4FTBA 3ZXDA 2XBO1 1E5RA 1W06A 4GKXA 3CHXA 1CD3G 2CWMA 2WZR1 4CP1A 5KXEA 1QY4A 3KSCA 5D8AC 3SMNA 2WQ4A 3MIUA 1R083 1UZ0A 5AVPA 4CPBA 1UGWC 3KF5A 2WDBA 2VH9A 4J6SA 2JXAA 3HBKA 4X6QB 5J37A 5FY5A 1QH6A 2Y8KA 4YSFA 4H55A 4FQZA 3AM2A 4NUBA 5F6KA 4G3YC 1ZX5A 2YU2A 3FFZA 1BCXA 2K0GA 4N43A 1BJQA 1O4ZA 3R4SA 4WM8B 3W58A 1C5IA 1LECA 4MSVA 4UOJA 1NQDA 1RUC1 4Q8LA 4GWMA 1D0HA 4LULA 4OMCA 2BBVA 2EIGA 4HPKA 1GOFA 2C9AA 3ZYIB 1GWMA 1W28A 4BH9A 3AZWA 1GZ9A 2E51A 2WWUA 3HNMA 2JDPA 1T6GC 3BPSA 4KBBA 4N43B 4Q4W2 3T2QA 3SMHA 1RC6A 2VC9A 3PLQA 2BRTA 3Q8FA 5T50A 4XUQA 2QTWB 2ZX2A 4AVSA 3ZSEA 1S0BA 5EWZA 1MQTA 1WA6X 3MW4A 5JZGA 5KHJA 2AUYA 3J8F2 3C7OA 4XXPA 3WX5A 2FD8A 1EV12 4LQRA 1FX5A 4AGRA 2KXLA 2WZR2 3WQBA 4NAMA 1MQTB 5FY7A 4AI8A 1ND2A 1O4TA 1H0BA 3MF6A 5FO9B 2QFEA 5GLVA 5AC91 5IK7A 2OQ6A 4CZSA 1EYBA 5FWEA 5JXGA 1CAXB 2EIEA 4KBZA 1V00A 2F17A 1BBT2 2ATFA 2WFF1 1FYUA 3VZKA 1ZRFA 1HIXA 1NT0A 2VTXA 2D40A 2FDHA 2XWBB 4OYUA 3B7MA 3VD5A 3QLQA 5FJHA 3PUAA 3ZN6A 1QJFA 4J1WA 1TNRA 4K3UA 1C1LA 5I0TA 1KFXL 1V6IA 4GB31 3AKQA 3AKTA 2LROA 3RFRA 5I8TA 1DGWA 1WD3A 1I3HA 4LIVA 5FK8A 3WSOA 2ARAA 4WZCA 3VZEA 2E26A 4FL5A 2YDEA 2ZGQA 3CZUA 1VJ2A 3O5SA 4P9LA 3UALA 3HQRA 3VY6A 4IUGA 1CAUA 3VKFC 3MI8A 3VZNA 2VW0A 4ISQA 2IXHA 2GDFA 4W6XA 2JWPA 2HJIA 4QX8A 2VR4A 3GZEA 3IAPA 4DEQA 3VUOA 2BGPA 2WLQA 1RMU1 1K5MA 1CIYA 4W6WA 1OOPB 2QBXA 2GNTA 2J1SA 3PTYA 5FYCA 1F31A 3FLTA 5B2GB 1RVF3 3THTA 5FOJB 3POFA 3R52A 1R64A 5HPOA 3LA2A 2XG3A 3PNAA 5AC92 5J7MA 4XHBA 1APNA 2D44A 4NHLA 4CUBA 3KV6A 2RMU1 1VRH3 3KV5A 1ZZ6A 4CCEA 5I0UA 4AK4A 4SLIA 1AJKA 4DINB 5ISLA 2BQPA 4XUTA 3H8OA 3LLZA 2DUPA 4BCUA 4F83A 4TSVA 1W05A 3LEMA 4HVRA 2JG8B 4Q1RA 1EP0A 3S57A 1AYM3 1COV2 1SG3A 1RITA 1UXZA 4ES8A 1LU1A 2C4XA 3KM5A 5FXXA 2ZOEB 3KHBA 3ZFEA 1VIWB 2BWCA 4HN1A 3ES4A 4XZPA 5FYTA 1AYM1 5LK7B 2B4KA 1RUG1 3H8UA 3EQEA 5ACA3 1O3RA 2X5IA 3U37A 4SBVA 4DO0A 1UOFA 4JGYA 5L19A 1J4UA 2TBVA 4LKEA 4XJ9A 3HNYM 1NCRA 1PVC3 1ZBA1 4YVSA 2HWD2 2A71A 1UQXA 1WBLA 2OVUA 2VBDA 4H3WA 1FPN1 1KJLA 3HR9A 1TNFA 3VBRA 2ARXA 1SBFA 2R071 3DYMA 1OI6A 4TWTA 3NV3A 4OUSA 3MICA 4J6GA 2W91A 3KMHA 3O7OA 1NAEA 5EFUA 4ZS3A 1YIPA 2VCBA 5LA9A 4XJZA 4YVSB 3MDPA 4JCKA 4EWDA 1G9AA 4Y20B 1A6CA 3NAPC 1RUE3 2BNMA 2J22A 3JB8A 2I45A 1LOFA 2ZMLA 4ARYA 2BNNA 1YRZA 3AYCA 2R32A 4RN5A 2BV4A 2RS13 1BVP1 2WRAA 2IUWA 2H6CA 3UJQA 2BUKA 1FOD1 1PO22 1UMHA 4CUCA 3C7FA 4UYBA 3JD73 2LW8A 2VMCA 4IEYA 1MZ5A 2JDZA 2KR2A 2ZAHA 4PBPA 2P34A 1HJGA 2YV8A 3B9IA 1XQNA 2JG9C 1IZ3A 1I5PA 1C57A 2RE9A 3TN93 4AEJA 2ZZQA 3J7NA 1AR82 3MLKA 2EAKA 2VUJA 1DZTA 5D3EA 1QJY1 2TUNA 1Z7S2 2RM23 2SBAA 3CDZB 4NE9A 4EZHA 5J48A 5FYMA 2XLGA 5T3NA 2QQKA 5EXOA 2HWF3 1YJKA 1W3VA 3USSA 1HB2A 2JE8A 3PMEA 3RNSA 3LA3A 2OPKA 5IHRA 3UJOA 2QP2A 5LZ6A 3MIVA 3IAQA 2ZS6B 5A3UA 1C3HA 1ZZBA 4D69A 1LOGA 2PTMA 4NPRA 5DUUA 2JDAA 5BNNB 4Z2AA 5L36A 3IPVB 3VL8A 5FXVA 2WNOA 3KWVA 3WNNA 3I2IA 5JPNB 4FFIA 1X9TA 4YLZA 4C90A 4AKBA 2AACA 3AVSA 2YZ4A 3VHPA 4YYOA 3KHCA 4YFZA 4WVVA 1YLLA 1DYKA 1OUXA 3PU8A 4RQPB 3AFKA 1PGSA 1NXD1 4FPCA 3RZZA 1RTVA 2RS31 1HRV1 3O0VA 4LXLA 3WXPA 4IQPA 1KJRA 3C8XA 3LOIA 4HZFA 3ACHA 4YW2A 4QKFA 5FZ4A 1IS5A 4GQ7A 3KF3A 4DDNA 3NMBA 3LSEA 4C1WA 5IVVA 5CFCB 4NR1A 4WM7C 3DN7A 1UD1A 5APAA 4CDUB 1NQJA 5J4TA 2JECA 3ZFGA 2RS32 1W9TA 1G6NA 3L9JT 4GMP3 1QJX2 4S2GA 4WVWA 5BYNA 3R4UA 3UKNA 1CONA 1W8HA 3PURA 5LRRA 3BYWA 3NNJA 4H14A 1UU6A 2BTVC 3CBNA 4PI2A 1F8VA 3WOCA 1PK6C 4XVHA 3ZN5A 4IV3A 2ZGPA 4AL9A 4C8DA 4NAOA 5HCBA 5F5QA 1WW6A 5C3QA 4Y1VA 1DQ0A 1RJ7A 4ORFA 3N7LA 4IESA 2OQ7A 3UV9A 4PCRA 5A1LA 3LOBA 3HNBM 3FX3A 3TB0A 1AL21 1XPWA 3THPA 1F2NA 3G7DA 5A1FA 5IW0A 2PHWA 2WT2A 3LIHA 1SCRA 4R9BA 5FLJA 4D7TA 3HT2A 5BNQA 2WZR3 4Z82A 1OPOA 2NMOA 2VMIA 1RHI1 2W94A 2BMYA 2QQWA 5IWFA 3LDRA 4ZHNA 4F3JA 2D3SA 1GQHA 1OD5A 2IXJA 3MIDA 4O7XA 3VBUC 4DPNA 4PQ9A 4YM2A 5F7UA 5C5TA 3LL0A 2PAMA 1GQPA 3KV9A 4OQ9A 5C8CA 5HBAA 4N7IA 5F2SA 2VULA 1ZBE3 2PYTA 4KGQA 4PIUA 2JIGA 1WCKA 2PQSA 2YGLA 3BVCA 2RDRA 4QHOA 3H8XA 1JOBA 3H3ZA 3M7AA 4QU2A 2BFUS 5C3PA 1QNYA 1PNFA 1TME2 1O5UA 2QDRA 1RJ8A 5C9AA 2BZDA 1GMMA 4IETA 2C5DA 5AVAA 4ZU7A 4Q5OA 1W6OA 5K4LA 1WWYA 2XQRA 2BBAA 1AR93 3CNAA 4PDWA 4I0WB 5FLIA 3VDDA 3ZPOA 3O1RA 1DFQA 2RS12 2WWSA 3VBOA 2P1BA 4AKDA 4C91A 2EIBA 2CGNA 2CGOA 3USUA 5C9AB 1UIJA 3WT3A 5HCAA 2XVGA 2WFPA 3LDKA 4LA3A 4MH0E 3CQGA 2VZUA 3QOPA 2VL4A 2XVLA 4M3CF 4KWUA 4FFGA 3I49A 3NNFA 1S0IA 4BQ1A 4E2GA 3VDDB 3WDYA 2XGXA 2BP6A 4CTEA 1N47A 3BUCA 2W46A 4Q4X3 3VV1A 2V72A 1O3SA 3EXUA 4S2FA 3DYOA 2RM22 5A3LA 2HWB3 3NAPB 2CNAA 4ES9A 4MGYE 2DVAA 5CB7A 5BY9A 2ZHLA 1LENA 2Y64A 3M4FA 2MHFA 2HWB1 1RUJ3 1FPN3 1LOEA 2YC2A 3I54A 4J25A 4KGGA 4PI0A 4Y5Z0 3RQ0A 5JPMB 3SQOA 5FMOS 1S2EA 1ZBA2 4RFRB 3RSJA 3T3YA 4DRVA 3I59A 5SV8A 1IQDC 1R1A1 4QT6A 4E27A 2I74A 2VVDA 3A21A 3Q9OA 4L8QA 1YZ5A 5EJZB 2SLIA 3HIFA 4WM7B 3WR0A 2VW2A 4XXAA 5ANQA 4D94A 4YFWA 4H7LA 1TZOA 1OF3A 2EXJA 2VVEA 3VDAA 4CVUA 1CZTA 1H6XA 4N9IA 5FYIA 2XLFA 3I59B 3WNXA 4CCMA 1FAYA 1GZWB 4RGKA 3VBRC 1CAVA 1PIV1 1V6OA 2Q8CA 1MVQA 1QGLA 5LBFA 1J84A 2DUOA 3JBG2 1WLWA 1GUIA 2ADDA 2P6HA 2HWE1 2WNVC 1H9PA 1LEMA 3HVDA 1MZ6A 1VAKA 3OYWB 1W8WA 3D0JA 4Q4V3 1I9RA 1GZWA 1XBFA 2W1WA 1S0CA 3I97A 4Q1PA 1DGRA 3LW1A 4YWAA 4IL7A 2BPA2 2D5HA 2WQZC 3VKNA 1Q8OA 3ZXFA 4HKLA 1YQ8A 5CU1A 2VUDA 2CWSA 2ZGUA 3AL6A 4Q4V2 1PIV2 5CIRA 3R0RA 1H30A 4RFT0 4ET7A 3CQCA 1SEFA 1ND3B 2UURA 2Z5WA 3AZVA 3VBHC 1W8UA 2EF6A 4YVWC 1FI2A 3J8F3 4AHXA 5FPUA 1PO11 4JTOA 3KB5A 3KLSA 3UNPA 3FC0A 1K3IA 3SNMA 3AYDA 3UBWA 3P5BA 4HKWA 3SPRA 5LHOA 4X8PA 5C3OA 1S2XA 2WFF2 1PO13 1QOTA 1IPJA 4GKYA 4GZ9A 4TLFA 4CA9A 2FDFA 1XEZA 3AB0A 5T5PA 4YVSC 1Y9GA 1PNGA 1JZ6A 5FZOA 3ZDSA 4AI1A 2ZGLA 3VZJA 3GDBA 5JZGB 2WSVA 4DY5A 1PMHX 1HW5A 2JENA 5J1XA 3PMSA 4YARA 1W8OA 3B02A 4BXSV 2VVFA 5JLVA 2A7AA 2YY1A 4YM1A 1AYN3 1HQLA 4BWOA 4Y1ZA 4GH4B 4AI2A 1UWWA 3V0BA 1ENQA 5FDBA 3TOWA 2V09A 2VZSA 4JTNA 3BU0A 3PHMA 4YZ1A 1SBEA 3B94A 2CU5A 5J36A 3WD5A 1LOBA 2IC1A 3JB4C 2ZCWA 5KWRA 1GU3A 1RUD1 1FXZA 1ASJ3 5F5IA 1PHMA 2RJKA 3BOWA 5JUVA 1HV1A 2RS11 4XF1A 5FPLA 2OA2A 2QE3A 3LEIA 3VBUB 3VD7A 4TTGA 2AC1A 4BE3A 5C3SA 2XVKA 4CU8A 3OTFA 2D6MA 1KITA 4FTSA 4XURA 1OFNA 4AF9A 1GYKA 2C1NA 5FYHA 4FPJA 3CU7A 5FKBA 1OA3A 2PHFA 4EYUA 2OYZA 5IVBA 3WDXA 5DN2A 2WWJA 3C7EA 4E2QA 2WBKA 3B00A 3DGTA 2Y6HA 3BPZA 5LCWL 1UL9A 4UFMA 5EXGA 5JSRA 4MXWA 1ODMA 1JZ3A 1JU4A 4XETA 1DZRA 1G86A 3B5LB 4RHV1 4CP0A 5DABA 3LKYA 5FPZA 4EV0A 4DHPA 1H1IA 1CGPA 3HT1A 1VBE3 4XDQA 5CAZA 1OVPA 3ZN6B 4I30A 1YFYA 4AOCA 4F7ZA 3T08A 1W6PB 4RHV3 4DX0A 1HLCA 2AEYA 4Y22A 4HN0A 1C3NA 1WW7A 1PGL2 1QH7A 4R9CA 3ZHEB 4UBHA 5FZBA 2VPVA 1WMXA 3ZFEC 1ULOA 2D98A 3AMHA 2PQQA 1GP5A 1O5LA 5B4XA 5A1AA 1JYIA 1RUI1 1VLNA 1AR83 4HSLA 4FPLA 3OYWA 3WP3A 4L92A 1GFF2 4ZZ5A 3H8RA 2BEOA 4QQOA 2IZWA 3F95A 3FE5A 3R4DB 1KS5A 3BTZA 3B9CA 4DEVA 1BKZA 4OHYA 2WA3A 1QJY2 3MGUA 4YZ3A 2XJVA 5E89A 4AFBA 4AE2A 4CDQC 1WS5A 4HOOA 3SH5A 4LO6B 2NN8A 3LWCA 4DUWA 5K9YA 2WO7A 1ND3A 2O14A 2V73A 2R1DA 3I3BA 5FTTC 1QJX1 4TZDA 4QD2A 3UGGA 3WQ7A 4NVPA 2R30A 1LOFC 3DCQA 4EROA 3N9LA 5IK4A 3CU8A 3IQVA 4A3ZA 3IIAA 2XXZA 2ZX1A 3ES1A 2O98A 3IDBB 2ZEZA 2ZEWA 3IM0A 3MV11 2XJTA 1YQCA 5FZIA 1QIQA 3KCYA 2W1QA 4ITCA 2PFWA 4INDA 5DDJ1 1POV3 5A80A 5T55A 4DQAA 5FLHA 4EN8B 4XQWA 4CU9A 5L9VA 1AR62 4KH9A 3FUQA 4COWA 5EPAA 2CAVA 3MFAA 3WOGA 5FZOB 5FUIA 3OEAA 4AEDC 4FAGA 2QQNA 1LGNA 5E8AA 3ZSJA 4NWWA 5LX2A 2JG8A 1HQNA 1JMUB 3MFCA 1QDCA 3OD4A 2B9VA 3PL0A 5T5LA 1EPZA 5A3OA 1XJAA 4GB32 5JDBA 3V0AA 3UETA 2OUHA 4FOVA 1Y4WA 4BU2A 2LTNA 1YWTA 1C1FA 3RZHA 1EAH2 4XEZA 2TNFA 4IGOA 4QPGA 3AXYC 4PT6A 5FZ6A 3WY6A 3P1NA 2BDRA 1JYTA 3RJ2X 1H1AA 3WDUA 1MEC3 3N35A 4A7KA 4JHZA 2VOWA 5C4WC 3V0AB 3SMLA 1NCRB 4HT1T 1LODA 4ATFA 5G04L 4I2OA 3VKMA 1SLCA 3UYJA 4IEZA 3RJRA 2Y34A 2YBKA 3MW2A 3U78A 5LVZA 2PHUA 1HRI1 2OX0A 1ASJ2 3U11A 1OC1A 1ND2B 3KQ4B 4CUGA 5LB6A 2BMZA 2PAKA 4B29A 1OFSA 4RS5A 1NKGA 3PVOA 4IE5A 4OHXA 5DQ0A 3VDDC 5CADA 2BN0A 1S4CA 4DB5A 1FT9A 1ZYBA 1C5HA 3TNPB 4YGCA 2A6VA 4M3CB 4QX7A 1W2UA 1ZZ8A 1XNCA 5LU2A 1S55A 5EIYB 3VBFC 1GOHA 1PX4A 2C26A 3EB7A 2ZHNA 4WVMB 2R0HA 5GZFA 2XPJA 1LHWA 5FP7A 4XF4A 4NHYA 4MXWB 1N3QA 2XJRA 2W3JA 3PVEA 3W5NA 3JQXA 1UX7A 5FCCA 1QXJA 3RG0A 1HXS3 1FMD1 1QWRA 4CXXA 2W2IA 2Q4SA 3Q8EA 3ZYBA 1PK6A 1F5FA 1UOBA 2BW8A 2RS53 4GWIA 4XBLA 1E5IA 1KFUL 2A6WA 2V5YA 3SKVA 1QJU1 4Y22B 1ZZCA 1OLRA 1NCQB 1STMA 5A6QA 4TLGA 2JB4A 1WMFA 4LE3A 5JIUA 1MS1A 5JI7A 3T0DA 4PITA 3RMYA 5JIAA 1WCUA 2KM2A 2XBO3 3D5OA 1PK6B 2HYQA 1BQPA 4CE8A 3WEZA 2R043 1IS3A 4WBBA 3EO6A 4CCKA 1ZM1A 1MR5A 5CFCA 4CU7A 1JYVA 2PHXA 4AI3A 4CEYC 4XFIA 5KHHA 2QQLA 4QM9A 4N9HA 1SQ4A 2D6LX 2WABA 2ZABA 1S2KA 1VAVA 1H8VA 2B9UA 5GLUA 3FZ3A 1DLCA 1W0OA 3OG2A 1QQP2 1YEWA 1O7FA 4EJRA 4MZUA 4Q8KA 3HN3A 4JZRA 1NE6A 1LCLA 1REEA 2DU1A 4ZY9A 4BIFA 5ERLA 3I7DA 1U12A 3VBUA 5BTVA 2EXIA 2VZ3A 2XWJB 1D4M1 1KEXA 2HWC3 1AL23 1V9U3 1EPWA 3POWA 4CDWC 3QH6A 5T5JA 3O1MA 2OS2A 3LL2A 1BEV3 4HANA 1YC61 5CEHA 1JOJA 1AR63 1CPMA 1MQTC 3ILFA 4EN7B 5JZGC 1RUC2 2CDOA 1ULDA 4P08A 4GD4A 2ZGOA 2ES3A 2ENRA 3U0ZA 3M3IA 1E5HA 1EY2A 1NXMA 4OQ8A 2GP5A 1VBB1 2ID4A 4GNTA 2Q1MA 4LNVA 4MOAA 5F5CA 3N9NA 1IB1A 5A70A 3MEPA 1TP8A 3KVAA 2PLV2 4IE6A 1YQ5A 1O3TA 1AX0A 1SCSA 4QPGB 2HH9A 2HEVF 2P37A 3HWJA 3VBRB 4Z2WA 1ENRA 3WDTA 3O44A 3MUZ1 1GICA 5L7OB 4OZOA 4CU6A 4W4ZA 4HONA 4MGTA 1MZFA 4NIIA 3ZKYA 4QWNA 3EHKA 4MYEA 2ZEYA 2XONA 5BUVA 4DS0A 5C71A 2QQVA 1LU2A 4Z07A 3SCGA 3T0LA 3U4XA 4FFHA 4XOGA 3NNGA 3IT8A 4A6OA 4BLJA 1BEV2 3OEBA 2E33A 1Q5OA 4WVZA 4UXAA 3QCWA 1N1TA 2VCMA 2ZBJA 4QXBA 5LBCA 3ZXEA 1LJ7A 2WAAA 3MIBA 4PLOA 4LBLA 3EYPA 3T30A 2PXJA 2Q1ZB 2WAOA 3VZGA 1W39A 2Y38A 4CCDA 3X0UA 3W20A 3WW4A 1RUG2 1HJFA 4R6PA 1O4YA 1A38A 4OZXA 4BA6A 2VQUA 4BPZA 4BZ4A 4CDXB 4DAUA 4LO8A 1O9CA 1GNYA 1V6JA 1O9DA 2XLAA 2DVDA 5HV0A 4AFAA 3GYDA 3MIGA 3WHTA 5KHKA 4EWEA 5FYYA 2VTXJ 3J26N 3ORJA 2VMHA 2ZMKA 4BQWA 2JX9A 2VZRA 3B01A 3E5UA 3OBTA 1N1VA 1PM7A 5JSOA 2OZ6A 2HLEA 4JHTA 4Q27A 4BHPA 4DIQA 3VZMA 2ZGKA 1NZCA 3LL1A 2HYRA 4FPYA 1UCXA 3E6CC 5LA1A 1RUNA 2EAAA 3R50A 4GJZA 3ZDVA 1CWPA 2W52A 3VY7A 1P8JA 2QUOA 1UPSA 4LUMA 4BQYA 3FN9A 4QQHA 4AVVA 1REDA 2B45X 5AFEA 3USUB 4CEWB 2D6NA 4K8FA 2HWC2 4Q4W3 4YZ2A 2JDYA 4M3CE 4D6QA 2GP3A 4EE2A 1ZZ9A 4MX3A 5TSWA 1D2SA 1IG0A 1MS5A 4AFMA 3PUHA 1OLMA 5GM0A 4JKMA 4BK4A 4LOTA 1H1MA 1UMIA 2NM1A 3POBA 4E4SA 4DOUA 5H9QA 3QACA 2GC2A 1D0GA 3BU7A 4CPBD 1Y3TA 3AMQA 4DHUA 2VNRA 4HMZA 3LZZA 4MGZE 4R6NA 4JRAA 2NUOA 3K2OA 4PF1A 5KXBA 2Q30A 3E6DA 1KGYA 1PGW2 1RXFA 1LHUA 4B8EA 4N43C 2WNVB 5IYYA 3WF0A 2ZJCA 3ILRA 1RUF1 4YGBA 4GX7A 1K5JA 2BGCA 2C0ZA 4BXFA 2EIDA 3AJZA 4U2AA 5FZ1A 3ZLIA 4AI9A 2H0VA 3LB9A 2HEWF 4K40A 4AXOA 1IPSA 2ZTNA 3DPRC 3JQWA 1X8EA 2DVGA 3AP5A 3NWKA 4YG0A 4Q4X2 4LBKA 3CZJA 1GNZA 4WM7A 2DUQA 2DVBA 3KQRA 5LASA 2CDPA 2B39A 1MS4A 3DL3A 2QCSB 4BQ2A 1BBT1 2Q8OA 4K9SA 4MO3M 1MEC2 3OSDA 4IEWA 3KGZA 4D6RA 3MLJA 2DWRA 4Q4Y3 2OIIA 3NKTA 1BK1A 5T5OA 1GP4A 5A3NA 2XHNA 5EP9A 1VBA2 1PVXA 3TRSB 1POV0 5JR2A 1C8M2 2A75A 3VD4A 1KRIA 4XC9A 5FP4A 1VAMA 2LM3A 4JC1A 2V4AA 5LY1A 2Y6JA 4Q0UA 5AFBA 1B09A 1WKYA 1NY71 3LEKA 4L2NA 2MNGA 4N90A 3JD71 2XUMA 4AZZA 2PLV1 2GUCA 4P9WA 3U75A 3NJVA 2QQPA 3BIEA 4CDQB 1WS4A 3IB3A 2X29A 1R081 4Q0SA 4D7YA 5L9BA 4O9GA 2IFRA 4XDOA 5IVEA 1YNAA 5FYVA 2HWD1 3GJBA 1UZVA 2VMGA 2X8KA 3AL5A 4QGNA 3AZXA 3V64A 2DVFA 4BQ4A 4CP2A 5BNOB 1RINA 1WLCA 1VRH2 4XE9A 3ROUA 2Z42A 2YPDA 5BV6A 3W59A 3H7YA 4RGAA 4YW3A 3LDBA 2J1VA 5CFDA 1W6OB 1RUH2 2WS92 3OPZA 4TYSA 4FOWA 4PDWB 4A4AA 1IKQA 4N84A 3GCXA 4FVVA 4YVWA 4IERA 5FPVA 1A34A 3ZSLA 4KG8A 1MEC1 3T09A 2MPFA 2PMWB 2BVVA 3OOXA 1SDDB 3VBSA 2WR9A 3K48A 1AX2A 1AXKA 1VB4A 4QXHA 3ZYFA 3OUIA 1NA1B 4GULA 2Y26A 3VKLA 2R042 1SFYA 4JDMA 3MITA 4ZQ0A 2YFUA 3ZMNA 4AYUA 1GZCA 3SMOA 3FWEA 3LM1A 1GP6A 1XNDA 2WLPA 3UK9A 1RUD2 4P5HA 3OPWA 5F3IA 5A3WA 1LHOA 5DAPA 2W68A 5EHDA 1UY3A 2PN5A 4NN0A 1RUD3 5D8AB 2C23A 1X7NA 4CDWA 1UKRA 1JI6A 1FATA 1LNSA 1U5YA 4Y33A 2BGOA 3WG1A 5AC93 4R8HA 5A7QA 5HXMA 3AMMA 4EQVA 4CCJA 2FMYA 2I07B 2Y60A 4UFHA 3O8IA 4LLFA 1H6YA 1YWKA 1IGOA 5A3PA 3RYPA 1WCDJ 4R4XA 1HN0A 1TME3 1VBC1 3IDEA 1VBD1 4DHNA 3POJA 4HLTA 2ADEA 4MGQA 3RDIA 3RWKX 3N7KA 1QJZA 4CDWB 3JUUA 5F9TA 3U9XA 2VZTA 3F2ZA 2V5DA 1ND2C 2FZ1A 2W5FA 1AX1A 3I8TA 4QAWA 4Z8BA 4ZXKA 4IGPA 2R0FA 5I93A 1CX1A 2XKOA 5ANNA 4CP9A 1UO9A 2VD7A 1QOSA 1CN1A 2OUJA 4MGIE 2VCCA 1Z7S3 3VZFA 4Y5IA 2F6BA 5C33A 3JU9A 4LBNA 5A6XA 3RZGA 3HMYA 3DF0A 4QX0A 1OLQA 2RG4A 4N53B 4Q0VA 4O9EA 3ZKUA 1CX4A 5KC5A 2ZZJA 2J42A 3M70A 5C4WA 4EN9B 4LTAA 1HN1A 1GKBA 4R4ZA 4A3XA 5FPXA 4JGZB 4K1ZA 1I6XA 2FDIA 1PZ7A 4EWAA 2ILMA 3AX4A 2KD7A 1WZXA 4FI9A 4AWDA 4JV4A 1GANA 5HV4A 2QQJA 3HN1A 1HRV2 5DAWA 1BEV1 4LK6A 1DYOA 3D8CA 2DBNA 3J9SA 1XOYA 1YQ2A 1Y43B 3O0WA 4OI4A 4R9AA 3RYRA 2FBEA 4IGQA 2C9KA 1DGRN 2VQAA 4LIUA 4NHKA 3UESA 2Z69A 1F5JA 3N36A 4QPYA 4NIAA 4UBGA 3RPQA 1VRBA 4FPEA 2G4IA 5GLTA 1R1A2 4M00A 2XQXA 4ASMB 2MEV1 5E1RA 5GZCA 1A8DA 3ZPYA 3LPGA 4LBQD 5IQPA 2HYKA 4FFFA 4UFJA 5FKCA 5KXDA 4YW5A 2QZ2A 1HXS2 2NMNA 3AXEA 4P02B 4D3WA 1C3KA 4X6RB 3ZYJB 2A3XA 4RS5B 4QDSA 3UKTA 4MHUA 1FNZA 3I2KA 3OBRA 1R092 3VD9A 3HBZA 5I8SA 3R6SA 1YHFA 1VBA3 2PAEA 1PO23 2K46A 1QNWA 1D2QA 1F4AA 3H1WA 1GZTA 1RUH3 4BG6A 2DCTA 1EV13 2E9QA 1TME1 1VBC3 3NV1A 1BZWA 4BYYA 4LK7A 5GZEA 3ZXGA 1ULGA 2H0BA 1LULA 2HWE2 3LQCA 4JX0A 1JU3A 4DFSA 5CFCC 1JZ5A 4QKBA 2GMMA 3VLBB 1FMD3 5EV7A 1RUH1 5M0TA 4Q0QA 3HEIA 1UOGA 5D8AA 5I91A 4XDPA 2DCZA 2Y6GA 2C74A 1OSGA 4ARXA 1IPKA 5FO8B 4OLLA 2VNGA 5DAVA 3M50A 3WG2A 4QU1A 5C70A 1NCQC 1PZ9A 2J1EA 2WH0A 2A70A 1US3A 2WO1A 5FZEA 3TWIA 5IVCA 2VW1A 3ST7A 3WHUA 3ZXJA 1GBGA 1ZRCA 2BTPA 4AGGA 3GF6A 2O8QA 3PIJA 2QKDA 4WVMA 1J58A 1R093 3MHRA 1DP0A 2DURA 2YB7A 4XFAA 3LLYA 1SLAA 4QXCA 2E31A 3TOJA 3BTXA 4QXKA 3CMGA 5FY9A 2NPIA 4LOSA 3ACIA 4NIDA 5FMOL 5EZWA 1R091 3OGRA 3N4MA 1OOPC 4P9GA 1UGYC 2P6CA 1UF2C 2HKXA 5BNPC 2BOJA 5GKAC 3THDA 5F39A 2R49A 4UWDA 5JXJA 1OPMA 3WDVA 2VZVA 3IPVA 3N7JA 1SFNA 1WS4C 4AW7A 4YW1A 3ELNA 4BK5A 3ATGA 4LORA 2JKXA 3O0XA 4NMIA 3ZFGB 1UKGA 2RR11 4P14A 3POYA 1AYN1 1TOQA 2FCTA 3AZZA 2DFBA 3POSA 5EJ3A 4DHSA 4TXWA 5FZGA 3WG3A 4CXYA 5LBEA 2XL7A 2DYCA 4AVBA 1GOGA 2JG8C 2JB8A 2R1BA 4P9XA 5K8SA 1NUKA 3LGRA 1ZVFA 5IUQA 4BOWA 2VOKA 4IEXA 1HKDA 1ASJ1 2JICA 1POV1 4HVOA 4LBJA 3RI8A 1LOCA 2WS93 2XMLA 3WP6A 2VMFA 5F2WA 2GNDA 2VUAA 4MG2A 1Q8QA 1DZQA 1JODA 3PUSA 5JM1A 2O0OA 2W0XA 4G9SB 3D82A 3MIFA 2B5HA 5F5AA 2FMDA 3DKWA 1M26A 2JZ4A 1ULCA 4Y26A 2DCJA 5JOYA 4OHZA 5FZ0A 4MGKE 4YZ4A 2JDKA 4V1PA 4IDZA 4A6SA 5BNPA 4PLMA 3RZKA 1JH5A 2GNMA 3E5QA 4N53C 4XQDA 1VBPA 1W9SA 2VQTA 4AQ2A 3P1RA 2VGDA 3AYEA 5JOXA 1OMIA 2VOXA 3WF2A 3WF3A 3VKOA 1GNHA 3T0BA 1BLZA 2RM21 1LHNA 4YG3A 1U5XA 2UY9A 3CJIB 4HKOA 3AKPA 2UWCA 4OUEA 5LEJA 2O02A 3WW1A 3A0NA 2BR9A 5CFDC 1JZ4A 2ET7A 1CZSA 5LEKA 5J09A 1PZ8A 3GBFA 5F32A 1G9BA 3I4IA 1ZBE2 4F8AA 2CL2A 4J1XA 5FBZA 2EA7A 2FCVA 2VZQA 4I3GA 4AVAA 2ZHKA 2VG9A 3ZYGA 3P3NA 1LB2A 3JCIA 2RMU3 4MVTA 4CRQA 1MS9A 3O1UA 3NVCA 4QDRA 3DV8A 1PX3A 2GC3A 4G4FA 4X8NA 4IV1B 2VQ0A 2ZGNA 3PDQA 4BM8A 1J83A 3RGBA 2NPMA 1BYHA 1W2AX 5BNOC 4AR2A 2XB6C 2X05A 3WNOA 4XFHA 1AF9A 1RXGA 2QJVA 1F4HA 2WA4A 5FPAA 2Z79A 3LA7A 1VMFA 4L11A 2W1UA 4UFIA 4QPIA 3RDHA 1DU3D 5ACA1 3IBMA 5KR7A 2Y0OA 4LUKA 3LEGA 2XOMA 2ZX0A 2GU9A 1M06G 4DHOA 2IXKA 4A7YA 4BMEA 1IS4A 4KL1A 4LJHA 4XHXA 3KCXA 3PUIA 4UAPA 5F37A 1AXYA 1QOOA 2FQPA 4FO9A 1XYOA 4UFKA 1CVNA 4YGEA 3LSDA 3ZXLA 5FZDA 3KCCA 4MHRA 3DYPA 2ZA9A 1ZA4A 1VBE2 3AVRA 1ZRDA 2H6BA 5LATA 1DQ2A 3Q8BA 1RVF2 1XXNA 4QKNA 1NG0A 4UW6A 3WNMA 4Q0PA 2BQ0A 5D2DA 3WCSA 3DUIA 2DCKA 4JGZC 1FV2A 4XQ4A 1S0GA 3GBGA 5A32A 4IHLA 3P8SA 3M2MA 4EN6B 4AVTA 1W99A 4FR3A 2ZGSA 4NPLA 1TVGA 3TEYA 3S30A 5A6ZA 2HBUA 1H8TC 5IAVA 2E7QA 3MPPG 5T54A 4DXTA 4RL7A 3H9AA 1J3PA 2VMEA 5FV3A 1DQ6A 5L73A 5GZDA 5DZGA 1IOAA 5FYZA 2Q1FA 1QJAA 2P3KA 2YYOA 3H42B 4L0PA 4A42A 2Y33A 2GNBA 4KU7A 2DDUA 3RMXA 5BNPB 2AZ5A 1A78A 2CSGA 5DAXA 3VZOA 3ZX7A 3CJXA 1C28A 2GAUA 1VBD2 1VMHA 5FZ3A 4ONUA 3RVHA 1GLHA 3KGLA 5K0UB 1UZWA 3S5AA 5J98B 1QXPA 4URTA 1UX6A 4BLIA 1J59A 2YU1A 3KVBA 2IXCA 1D7PM 3CEWA 1U5IA 3T0AA 4R6RA 3JD72 3VBFA 1PVC2 1H9WA 2AH2A 5H9PA 3SH3A 1B35B 1NLRA 3VZLA 1LESA 5C8CB 5IFPA 2Q8DA 3UZDA 2WQ8A 3ZIXA 2GC1A 4Q29A 1QJU3 4Z1VA 5BXXA 4Y32A 5JWPA 3GGLA 4K21A 3AKSA 2YC0A 1XU1A 1YI9A 4GH4A 4GWJA 2HBTA 1DHKB 1PO12 1UW8A 1CJPA 3WOBA 2A6XA 2G19A 2RS33 1HXS1 1A37A 2A5ZA 3GHMA 3VBSB 4CDXA 2R041 2WYFA 2WL1A 1UGXA 1JHNA 1W90A 3I2JA 4MGSA 1W04A 4GXLA 3I3QA 4FTEA 3EBRA 3AP4A 1WGPA 4E8CA 4M0NA 2VOTA 4BIOA 4I09A 1RMU3 3O1OA 1AYN2 3VN4A 5F6LB 3PJYA 1YFXA 4IE4A 4B4QA 4UW3A 3LFIA 3M1HA 4XJ8A 5FY1A 1RUF2 5CYYA 3KD4A 2CGPA 1V6MA 1N1YA 1UZYA 2BWAA 2CY6A 2C1FA 3OBZA 3S6PA 3V0BB 1SMVA 1PMIA 5A7WA 1W0PA 4L97A 4R9DA 4ZPIA 4HVQA 2D7FA 2JDUA 4D0QA 4LHSA 1CJDA 2B42B 1NA1A 4AI0A 1OURA 1RUJ1 1YFUA 2D6PA 2XJUA 1Q8SA 3LKJA 4QHZA 3R05A 4ZU4A 2YHJA 3LIGA 1KQRA 3LE0A 3SKJE 4FPHA 3KS7A 4ZU5A 3AP6A 2I2SA 2GALA 2C1JA 3ME2A 3C7HA 1YCIA 5A33A 1FOD2 2BJSA 4LLOA 4AKCA 4QGMA 4QKDA 5JMCA 4FQ4A 3LAGA 1VB2A 1JXNA 2VECA 3POIA 2NP0A 4W8JA 1VP6A 1W8ZA 1AR61 3OY8B 3VDBA 3E1F1 2JJ6A 4QM8A 2W92A 4I0BA 5FPBA 5FZKA 1A3KA 4AQTA 4CCNA 1H2KA 3A23A 3QD6A 1VMOA 4NOTA 5ABJC 1LKNA 1LAJA 3BODA 4KG0A 2OZJA 1VBB3 4E4DX 2YPJA 3LFMA 3MUY1 2RHPA 1T2XA 4XMIA 1JZ8A 5C4WB 3PTRB 3CKHA 2VU9A 4B4PA 3IWZA 1OUSA 5A3MA 4D8MA 5LWBA 1G7YA 1NZIA 1H4GA 1SACA 1ULEA 2DF7A 5FMCA 5FYBA 3P1PA 5LBBA 5JI9A 1UN1A 1J4SA 1RGSA 2A3WA 3T2OA 1IQAA 1X50A 2XR4A 1YQ6A 1AR81 3ACGA 3SLIA 3NO8A 2BNOA 2AENA 4XF9A 3P1QA 3VBHB 2RS52 4H7MA 2BYVE 3WF1A 1NYWA 3MYXA 3MBWA 3T2TA 4Q26A 4QPIC 3I2GA 3N7MA 3OD0A 1XU2A 2AR6A 3CJIC 2B7YA 1V9U2 4C0HA 3UX0A 1FPN2 1ST8A 2R16A 4FAHA 3HQXA 3J7HA 2JE7A 4XFGA 3ENRA 3P6BA 4M4PA 3H1YA 4QLIA 5C3RA 2PLV3 3ZR5A 2C24A 4W65A 4META 4RR3B 5JVVA 1L7LA 3WW2A 4FJ3A 4GAZA 2CAUA 4XIKA 2OKXA 4NIGA 4DHQA 3K77A 3NV2A 1JS9A 3D4KA 3WINE 3CIHA 3N9PA 5BNOA 5DAQA 5DMYA 1TEIA 4AQ6A 1YFWA 1R082 3ZVXA 4KNCA 4ASKA 3O1SA 2E7AA 3WP5A 1W6QA 1IKPA 2VAUA 2VOVA 1R1A3 2FHRA 2VE1A 3AP7A 2WJSA 3VD3A 2HWF2 4HL0A 1PMJX 5DUVA 2HEYF 4GWNA 1C4RA 2VNOA 4HXCA 4WRQA 5EYXA 2E7TA 2E53A 4RQPC 1YXWA 3SCFA 3IDAA 2AEZA 5LY2A 4GA9A 4K20A 5FWJA 4IV1C 2QQUA 3TYJA 1WLDA 1RUF3 1AR92 1O8PA 2ZEXA 3TBDA 1F9KA 2VNVA 3K3NA 3SITA 1L3JA 2D5FA 1ONAA 1RUJ2 1X33A 4IV3C 1Q56A 4LHLA 2YC4A 4LITA 5DPNA 1SBDA 3VHRA 5CKNA 2VBPA 5FP3A 1HQWA 2BOIA 1DYPA 2RDQA 2ZX3A 5F74A 1KDKA 2ETEA 3BGAA 3BIWE 3K46A 1YI7A 5G05L 4OI0A 3ON7A 1OKOA 4A45A 1Q43A 2JEMA 2RMU2 2JD9A 1X8MA 2WFF3 1DDLA 4ISRA 1WCSA 5A33B 5LU1A 4CEWC 5T52A 3ZYPA 5LRSA 3ACFA 1EUUA 5FZHA 4JKLA 4MUVA 5FIXA 5FOBB 2DCYA 3GM8A 4LE4A 4PQQA 4Y3OA 5A7PA 5IVFA 1J1TA 4LEJA 2W39A 3WG4A 3W5MA 1JYCA 4MV2A 4A2UA 4I0AA 1JN2P 2DTYA 2JKBA 3PUQA 5E16A 1W6PA 2CYFA 4DNKA 1CAUB 1UH1A 4YPJA 1HB3A 3BKZA 1OXCA 4KQ7A 5CNAA 4OI1A 4CP9B 4FPKA 4XUOA 4B1LA 3U4SA 1VBB2 3TEWA 1RHI3 1O91A 2GMPA 3VB9A 2XUEA 3N9QA 1JYWA 3OUHA 4CCCA 1WBFA 1COV3 1OF4A 2LRPA 4P00B 3INAA 4BQ3A 1NCQA 1URXA 2XBO2 3WNPA 4QPWA 1SPPA 5D21A 1RB8G 1L7RA 4NJ4A 1H8TB 2XHKA 3THCA 4EZ4A 3MLLA 3WNLA 1W8TA 4HETA 1HB4A 1LHVA 4Y1UA 3MIEA 4XTPA 5CG8A 1DQ4A 1SZBA 1W8NA 3LCPA 4FPGA 4PIZA 5IVYA 3I3MA 4R6QA 3EJKA 1W2OA 4I01A 1H8TA 4KI5M 4UW5A 4CUAA 1O3QA 2R061 5CVRA 4P9JA 4QQPA 1J3QA 2EICA 4B4RA 4FT8A 1ZA7A 2CHHA 3ZOIA 3FHQA 1I1EA 3I4RA 2L9LA 4PBOA 1V9U1 5EJ1B 3VBSC 1Y7BA 3O14A 1UYYA 1QJEA 4XACA 1CZVA 5C8WA 1V6LA 3SEPA 1W9WA 4JGYB 3NW4A 4PIYA 1Y9MA 1S1AA 2IVJA 2QQOA 2BERA 3EMRA 4XJAA 4AVCA 4P9YA 1G9CA 2IFWA 3G6JB 5DZFA 5FXZA 1AR73 3IZOA 3APAA 2D6KA 3WCRA 3ZXKA 3SP5A 1LGCA 1JOTA 3LPFA 1DLLA 1AVBA 1RUI2 1C8M1 2JDMA 1BK0A 3W21A 4Y20A 2W87A 3WZ1A 1GWKA 2GUDA 1PGL1 5IFTA 1UMZA 1UY0A 3IN9A 5J51A 2R072 5L7OA 2FDJA 4LBQA 4I02A 1W6NB 4Y1YA 1BMV1 1DGLA 1J4TA 1WS5C 4YZ5A 3O1TA 2ARBA 4LT5A 4FSJA 4DRRA 4AK3A 1W2TA 4IV1A 4TN7A 1QKQA 4XFCA 3CJIA 4JRLA 4N7GA 5FRAA 3T4HB 3ZFFA 3R51A 1UAIA 3Q8AA 1UNBA 2WN3A 1ENSA 5K7PA 1W6NA 3J7LA 4ZONA 2WZPP 3NNLA 4PJYA 2VXJA 3PIGA 3V65A 3VDCA 3T1LA 1LR5A 2GH2A 5BPXA 3MHZA 1EUTA 1A4OA 5DXDA 4XFFA 4O61A 2WIIB 2QDNA 3NKXA 1QQP1 1DCSA 3AMNA 2XDVA 4XMAA 3O1VA 1JHJA 3IQJA 3DPRA 4XZUG 3RZMA 4B3NA 3E6YA 4WOGA 4ZS2A 2QNKA 3NJZA 2V7DA 5JR7B 4H2AA 5BNNA 3KT4A 5CKMA 3IIIA 2R062 4YRDA 1ND3C 4HFSA 4DXSA 2XJQA 4UF0B 5C9AC 4QPGC 5C5UA 4R52A 3ASIA 3CLPA 3OB8A 2R063 4FOYA 4LPLA 3SXWA 3URFA 3WVJA 2ERFA 2VTFA 5L7OC 4RQPA 1LEDA 2XJSA 5FUNA 1UY2A 5J50A 5FUPA 1C8NA 5L9RA 1J3RA 1RMU2 2WO2A 3B93A 2DV9A 1MPXA 4AEDA 1FMD2 4R6OA 5EYYA 4YM3A 2A6ZA 4DXRA 3H1MA 3V56A 1D4M3 3D0SA 3UGFA 4B7KA 5A7OA 1SLTA 1ZGSA 2P3JA 1IHMA 4MLOA 4E9KA 1ULPA 2DBIA 4YGDA 5IATA 1QJU2 3H50A 4GMP1 5DDJ2 1PVC1 1GSLA 3K51A 1EV11 2WINB 3FFQA 4XUPA 4NRMA 3GZUC 1H4HA 3WQ1A 3J8F1 4FBFA 1V6NA 5C7GA 2R073 2ZACA 3FMGA 4IW3A 4AAXA 3I2DA 5LA2A 1IG3A 5GJ6A 1FNYA 2VZPA 4FPOB 4IEPA 3DECA 5EWSA 1ZRIA 4A41A 1V6KA 1S0DA 2J1UA 5C8CC 1WMEA 1CPNA 5E88A 3M3CA 5KBFA 5CG9A 5J4XA 1CAWB 5JSPA 1OVSA 2PHLA 1XYNA 2ZXQA 4RHV2 1CQ9A 4LKFA 2HWE3 4PF5A 4AHZA 1D4M2 2WYSA 5F3GA 4XCAA 4NRPA 4AAPA 1TMF2 2YBSA 2WNUC 4IV3B 3DXTA 4CCOA 1BMV2 3FHIB 1W9FA 5D2AA 1HRI2 3A22A 3M8LA 4XUNA 1OHFA 1QQP3 1FV3A 4XPVA 1W3XA 3AZYA 2EALA 2QZ3A 2O8PA 4KWLA 5FP9A 2ZHMA 1ODNA 2R7EB 3IQUA 4OFGA 4GJYA 4YVWB 5ACA2 4IEQA 4HSJA 5LK5A 4E4ZA 1VBE1 4OVEA 3BI3A 1VRH1 4OHVA 2HWF1 1D4VB 1US2A 1YYNA 4CEYB 1RUE2 4W6YA 3IMNA 4YM0A 3WQ0A 3WUCA 1QHDA 1OA2A 1RUC3 1XNAA 3MW3A 4GMP0 2LUWA 3IDCB 4YG6A 3VBOB 3ZN4A 1W0NA 4JC3A 1QDOA 2A3YA 3UGHA 1H2MA 2RDNA 1UYPA 3CQOA 2UYAA 4HPKB 4KMQA 1XNBA 4P5YA 4QB1A 4COYA 3ABZA 3OPTA 3VGIA 4CXWA 5JOZA 1YO8A 1R1ZA 5J96B 1Y9QA 4XFBA 5FZCA 4AHYA 4OMDA 2AREA 1ACCA 4RGGA 4YW4A 2WC2A 4GH4C 5GALA 3UL2A 4DY3A 3HJRA 5CA6A 5ABJB 1JYXA 1GWLA 3WUDA 2RJ2A 5A7SA 4JDNA 2JG9A 2Z2SB 3A7QA 4FP3A 2VZOA 4QX2A 2D3RA 3KZ4C 5FY4A 5IT6A 5FZAA 1JBCA 2HWB2 1URJA 3JXSA 2GC0A 3NNMA 3SCHA 3CF6E 5DDJ3 5FZLA 3GCWA 1OBNA 5A7NA 3BN6A 2OT7A 4MXVA 3FL7A 1OUWA 2X10A 2YGMA 3U1XA 2GTYA 3U14A 4DXZA 2IXLA 1JOPA 3C3VA 3FHAA 5DG2A 2WT1A 2E63A 3T4VA 4WV8A 4AEDB 4PIKA 1LGBA 5FYUA 2FCUA 1YIFA 2B05A 2PA7A 2UY8A 3P3PA 3DXUA 4JKKA 1JUHA 1L7QA 4PLNA 3RWNA 3ZO0B 4DZGA 4AGVA 2QQIA 3ETPA 3SMKA 4DATA 5D3FA 1OQ1A 1Q3EA 2J1TA 2UWBA 2VCAA 1NLQA 4YNIA 1O9EA 3ZSMA 3HD8B 5A32B 1VPHA 1VALA 1XNKA 3QBQA 1NA1C 2D93A 1JUIA 4QQ2A 4PDWC 2DU0A 3KV4A 1K5MC 1QJY3 4I3PA 4U36A 3ACLA 4JGZA 4XBQA 4IE7A 3UT0A 2C6SA 1SLLA 3IKWA 3S7IA 1T6BX 5LW9A 4Q4V1 4Y24A 2F4LA 1QF3A 4M0HA 4DMIA 1KU8A 2C63A 5CZKA 3M3OA 2FDKA 4KU8A 3Q8CA 5FZMA 4AHWA 1PXDA 4RR3A 1BHGA 2GMEA 5FYSA 4O46A 2ZMNA 1UH0A 4BDVB 1EAH1 4JAAA 3VBFB 1G9FA 1SFPA 2ZGRA 2OW4A 5HCFA 3M3EA 1F15A 2JD4A 2WZEA 3P1IA 4QX1A 1LRHA 4Y5SA 4B1MA 5C6CA 2WNEA 1VBC2 1QEXA 3J4UH 4WM8A 2WSUA 3HPNA 1HRV3 4JDDA 4DHTA 3ECQA 4XBNA 3BB6A 3WV6A 4LKDA 1O8SA 3RYKA 3HAGA 2XL9A 4NRQA 4XJWA 2X5IC 1KDMA 4AQSA 3O1PA 4COUA 2EVXA 2JE9A 2IVIB 5CFDB 4CEYA 5SV5A 3SH4A 5FP8A 3H0OA 1W6MB 2PHDA 5CBLA 5GLZA 1HRI3 2B8MA 4RSUA 3TNQA 2WZ8A 3ZFEB 3H3LA 3NSTA 1DG6A 1UOJA 5CISA 1QJX3 3FBMA 3DEMA 1UXXX 4K8RB 4OULA 3VHOA 4AFDA 3OUJA 4UW4A 1W6QB 4QX5A 4FP2A 4FXKB 4L99A 1QU0A 5HXVA 1ULFA 3WNKA 2N7GA 4JVAA 4E2EA 1W9YA 3MPBA 4JQTA 1JYNA 2OPWA 2GUEA 5AV7A 2ZGTA 2V4VA 4Y4RA 5FY8A 2Y6FA 4Z92B 2WT0A 1UY4A 4JGYC 4XAEA 3OGSA 4YW6A 1CAXA 1PO21 1AZDA 1NCRC 1RUE1 4C1XA 3HQUA 2EXHA 3EFZA 4LO7A 1QJBA 4XCBA 3GHNA 3OGGA 1PM4A 2RS51 4F7RA 2FZ2A 4GB33 1O6UA 1C3MA 2P4EA 3O12A 5D1IA 5FFOC 2ZPXA 3NRUA 3VL9A 5E6HA 1X82A 3NV4A 1MS8A 2P3IA 1DQ1A 2W9XA 1HX6A 3SHRA 4C0BA 4LKSA 4BB3A 3AQGA 1ZBE1 2RR12 2WKKA 4OCTA 5FBJA 1W03A 3JZVA 2NLRA 3K75B 3OGVA 5FK7A 4Q2FA 1H2NA 2E32A 5J3UA 1POQA 1W2NA 1HDKA 2ARCA 3N9OA 4LA2A 1SPPB 5F1RA 2NU5A 3PJQA 4K1YA 2YXSA 1Z7S1 1O9FA 3S5QA 1GQGA 1RVF1 2BVBA 5DUXA 1K5MB 3T1MA 1C8M3 1E5SA 2VZ1A 1VBOA 5FAXA 5BY5A 4NO4A 5IK5A 1RHI2 1NE4A 1DQ5A 1XSRA 3ZMOA 3RI9A 4RD7A 3RRDA 2ET1A 3I3DA 4N53A 5F8PA 1XSQA 2ZKNA 3GALA 4URAA 1GR3A 4AG4A 1XE0A 2LS6A 4XILA 3T2PA 2VUCA 3ZSKA 1VMJA 3I2FA 2UWAA 4XJUA 5FZ9A 2F4PA 1XXQA 4ZDRA 5IAXA 1UPIA 1YUDA 2NZ9A 1JW6A 5KHIA 3B69A 3LD8A 2X53S 3GJAA 3T0MA 4LO4B 4COZA 4Y4YA 4E8DA 3AC0A 3C7GA 3P1SA 1OOPA 1OQEA 5JCTA 3VHNA 5JXHA 1UGYA 1XB9A 1E57A 3ZFFC 5JAXA 3M3QA 1BVVA 1CIWA 3L2YA 3OCPA 4XAAA 3NJYA 1NLSA 4Q4X1 2X5IB 1CR7A 3U10A 4LBOA 3K4AA 3GZAA 3N9MA 1W6MA 5FO7B 2A1XA 3POEA 4LHKA 1WCQA 4LO5B 1QMJA 4LMFA 4LHNA 4QGLA 5FZ7A 4AFCA 5KXCA 4K7JA 2FDGA 1ALYA 1UY1A 1WW4A 1OQDA 1X9PA 4FXGB 4IXLA 4ASLA 4A7ZA 4BISA 3OF1A 5CKQA 5DZEA 3RZLA 1XXRA 1N3PA 4RS5C 4OI2A 2X09A 3ZFGC 4COVA 3C2UA 3GBWA 3D3AA 3E5XA 1UYXA 3H3UA 2UYBA 3KT1A 3X29B 1BXHA 4MADA 4ZZ8A 4OUMA 1AL22 1RUOA 4BQXA 2D97A 4UT5A 2BFUL 3I3EA 3H7JA 1X1VA 3LF7A 1G8WA 2GN7A 2O1QA 3SISA 4P9IA 1AJOA 5EQUA 4BJ0A 2NYYA 1SLBA 4GALA 1IS6A 4IEVA 4WZFA 4BMBA 2AYHA 4CSWA 5KHGA 4NIHA 4QB2A 2JDNA 1S2BA 4N8MA 4DNYA 2ORZA 3MIHA 1PIV3 1JTZX 2Y6KA 2YROA 4M3CA 4S2DA 5F3CA 4OHWA 1TG7A 5FMBA 1K45A 1OH3A 2IWGB 4EN0A 4LBQB 2AGSA 3NKGA 4E4HA 3WW3A 1Q8PA 3APBA 2DTWA 1ZNPA 1TQ5A 5F3EA 1KD7A 3ILNA 3GXUA 4WM8C 5IK8A 1UIKA 2YFZA 3U07A 3RZJA 2WNUB 1S0JA 2Y6LA 2O8OA 4QPIB 4S2HA 2PELA 4MQ0A 4Y1XA 3FJSA 4PIFA 1XYPA 2ZX4A 3JBG1 2P3YA 1AUYA 4IE0A 3D6EA 4FOQA 2RR13 3AMPA 2YBPA 1RYYA 1FOD3 3I2OA 1RIRA 2W1SA 1M4WA 4RR3C 1MACA 1JZ7A 1S0FA 1MZEA 4FCAA 2GUXA 4O65A 5JOWA 3KT7A 2LALA 3N3HA 5GZGA 4E2SA 1B35C 2MEV3 4XABA 3SMMA 3TEXA 3ZYRA 5I0SA 4NPMA 1XE8A 1ZBA3 3TAYA 2W47A 3S0MA 1RL3A 2GH8A 2HYXA 1SDWA 4NHMA 5DUWA 3FBYA 1TMF1 4UF0A
chains in the Genus database with same CATH topology
2V5DA 1JYWA 2W5FA 4QAWA 1IQDC 1OF4A 4P00B 1CX1A 3A21A 3MV01 5EJZB 3WNPA 4QPWA 2RVAA 1L7RA 5JMOA 2Z4FA 1OF3A 3THCA 3VDAA 2VCCA 4CVUA 1CZTA 1H6XA 3WNLA 4W50A 4QX0A 5JXIA 1W8NA 1J84A 4KI5M 5IJRA 1GUIA 1HN1A 1XNTA 4CUAA 4QX3A 2J1RA 1UYZA 2EICA 2KD7A 2W1WA 3I97A 4FI9A 3FHQA 3OBAA 4RYDA 2L9LA 5EJ1B 2QQJA 1UYYA 1CZVA 3SEPA 1W9WA 1DYOA 4ET7A 2WN2A 1YQ2A 2QQOA 2BERA 2W95A 2C9KA 3UESA 3UNPA 2WUHA 1K3IA 2J1AA 3NQHA 1K42A 1OD3A 2XQXA 4GZ9A 4QB6A 3LPFA 5LA0A 1NX9A 3LPGA 1JZ6A 2W87A 2VJXA 1O59A 3GDBA 5B4NA 5IFTA 1UY0A 1PMHX 5J1XA 4P02B 3ZM8A 1W8OA 4BXSV 4QDSA 3I2KA 3VD9A 1UWWA 2VZSA 1F4AA 2WN3A 3LQCA 4JX0A 4ZXEA 2VMDA 1JU3A 1JZ5A 3VDCA 1SHWB 1GU3A 2YG0A 4A44A 1EUTA 3HEIA 5JUVA 3NJXA 2Y6GA 3LEIA 3VD7A 1JHJA 4ARXA 4XZUG 4TTGA 2RV9A 4CU8A 5C70A 4XURA 2J1EA 1US3A 3K4DA 2WO1A 2VO5A 3IIIA 1OH4A 3I2HA 4DXSA 5DN2A 3K4ZA 3C7EA 5LCWL 2WBKA 1DP0A 2Y6HA 2YB7A 3OB8A 4LPLA 2VTFA 1JZ3A 1JU4A 2E31A 1UY2A 3CMGA 2VM9A 2WO2A 3ACIA 4M4RA 3OGRA 3WF4A 2WO3A 3T08A 1MPXA 1JZ2A 3THDA 4DXRA 4QDQA 5JXJA 2VZVA 4HG6B 4BK5A 1ULOA 3SEEA 1K12A 5A1AA 2JKXA 5B4XA 2QQMA 4UI9L 3MO4A 4DUXA 4ZZ5A 1ULPA 5I0DA 4DEVA 1OT5A 4TXWA 4DUVA 4XUPA 1XC6A 1GOGA 2ORXA 1NUKA 2J7MA 5C7GA 4DUWA 3HOBA 3I3BA 4AAXA 5LA2A 2VZPA 3DECA 2VMFA 4A41A 4A3ZA 2J1UA 2ZEZA 2ZEWA 3MV11 2W1QA 4CU9A 2ZXQA 2DCJA 1UZ0A 2WYSA 5FUIA 2WDBA 3OEAA 2QQNA 2Y8KA 4XUNA 3A22A 2B9VA 1W9SA 2VQTA 3UETA 2R7EB 3WF2A 3WF3A 4UOJA 3T0BA 4PT6A 4OMCA 4OUEA 1GOFA 1US2A 1JZ4A 3HNMA 4JHZA 1CZSA 3T2QA 1XNAA 2VC9A 5G04L 4XUQA 1W0NA 2VZQA 4KMQA 3CQOA 4QB1A 4P5YA 3ABZA 3C7OA 1NKGA 5DQ0A 4QDRA 4OMDA 4LQRA 1PX3A 1JYXA 3WQBA 3HJRA 1J83A 2RJ2A 5EIYB 1GOHA 1PX4A 2C26A 3EB7A 3A7QA 2VZOA 2X05A 3WNOA 4QX2A 5JXGA 2EIEA 2W3JA 3JXSA 3W5NA 1UX7A 1F4HA 3BN6A 2W1UA 4OYUA 3FL7A 3VD5A 2X10A 3FHAA 3LEGA 4GWIA 2XOMA 3SKVA 4JKKA 3PUIA 4UAPA 3T0DA 1L7QA 3ETPA 2QQIA 3WSOA 2E26A 2J1TA 2VCAA 3CZUA 3DYPA 4IUGA 3WEZA 4CU7A 1JYVA 3WNMA 2QQLA 3IAPA 2VR4A 2WABA 4DEQA 2BGPA 2DCKA 1CIYA 2QBXA 2J1SA 1DLCA 3OG2A 3HN3A 1W99A 1R64A 4ZY9A 5HPOA 1TVGA 5CZKA 2VZ3A 1KEXA 4CUBA 4DXTA 1BHGA 2VMEA 4A42A 4BDVB 4L0PA 2CDOA 4P08A 2DDUA 4XUTA 2WZEA 3P1IA 4QX1A 2ID4A 1SG3A 1UXZA 4MOAA 3HPNA 1D7PM 3T0AA 3ECQA 2C4XA 1O8SA 5IFPA 2B4KA 3MUZ1 3U37A 2WQ8A 4OZOA 4CU6A 4W4ZA 3HNYM 3GGLA 4GWJA 2ZEYA 2XONA 2WZ8A 5C71A 3DYMA 3NNGA 4A6OA 1UXXX 2W91A 3OEBA 1NAEA 2E33A 2VCBA 4MGSA 3I2JA 2WAAA 3EYPA 4E8CA 2WAOA 3WNKA 3X0UA 2J22A 2VOTA 1JYNA 4ARYA 4RN5A 2VQUA 2V4VA 1UMHA 1GNYA 1UY4A 4CUCA 3OGSA 3C7FA 5CYYA 2LW8A 2VMCA 2VZRA 4D0QA 1I5PA 2HLEA 3NRUA 4LHSA 3CDZB 5LA1A 2W9XA 2QQKA 1P8JA 3LE0A 4LKSA 3FN9A 3SKJE 3C7HA 2JE8A 5IHRA 3K75B 3IAQA 3OGVA 2E32A 2JDAA 3PUHA 4W8JA 4Z2AA 4JKMA 4BK4A 3VDBA 3E1F1 1UMIA 3WNNA 3I2IA 2W92A 3A23A 2VZ1A 4PF1A 3MUY1 3I3DA 1KGYA 1T2XA 1JZ8A 5IYYA 4AG4A 3WF0A 2LS6A 3C8XA 3CKHA 4D8MA 3ACHA 2EIDA 3T2PA 3I2FA 3T2OA 3CZJA 3ACGA 2CDPA 4E8DA 3WF1A 3AC0A 1W9TA 3C7GA 5JXHA 3MBWA 4MO3M 3I2GA 4XVHA 2XHNA 3J7HA 4M4PA 3P6BA 5JR2A 3VD4A 2Y6JA 3HNBM 3K4AA 1XPWA 2OKXA 1WCQA 3K77A 1WKYA 3LEKA 3CIHA 1UY1A 5DMYA 3NJVA 3IB3A 2W94A 2X09A 3D3AA 1UYXA 5F7UA 4MADA 4ZZ8A 3VD3A 1GQPA 1PMJX 3I3EA 2J1VA 4BJ0A 2PQSA 4A4AA 3IDAA 4QB2A 2ORZA 2Y6KA 1O8PA 2ZEXA 1TG7A 3T09A 1K45A 5DPNA 2BZDA 1GMMA 1SDDB 2YC4A 2BBAA 3BGAA 3K46A 5G05L 3GXUA 4A45A 2YFUA 2YFZA 2EIBA 2JD9A 2Y6LA 3ACFA 1EUUA 4KWUA 2VZUA 4JKLA 2VL4A 1RYYA 3GM8A 1UY3A 2W1SA 4PQQA 2W46A 1JZ7A 2V72A 3W5MA 3DYOA 1JI6A 1LNSA 5HXMA 2BGOA 1H6YA 4YPJA 2W47A 4XUOA 2Y64A 4MGQA 2HYXA 2YC2A 2VZTA 3F2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5D A;  1JYW A;  2W5F A;  4QAW A;  1IQD C;  1OF4 A;  4P00 B;  1CX1 A;  3A21 A;  3MV0 1;  5EJZ B;  3WNP A;  4QPW A;  2RVA A;  1L7R A;  5JMO A;  2Z4F A;  1OF3 A;  3THC A;  3VDA A;  2VCC A;  4CVU A;  1CZT A;  1H6X A;  3WNL A;  4W50 A;  4QX0 A;  5JXI A;  1W8N A;  1J84 A;  4KI5 M;  5IJR A;  1GUI A;  1HN1 A;  1XNT A;  4CUA A;  4QX3 A;  2J1R A;  1UYZ A;  2EIC A;  2KD7 A;  2W1W A;  3I97 A;  4FI9 A;  3FHQ A;  3OBA A;  4RYD A;  2L9L A;  5EJ1 B;  2QQJ A;  1UYY A;  1CZV A;  3SEP A;  1W9W A;  1DYO A;  4ET7 A;  2WN2 A;  1YQ2 A;  2QQO A;  2BER A;  2W95 A;  2C9K A;  3UES A;  3UNP A;  2WUH A;  1K3I A;  2J1A A;  3NQH A;  1K42 A;  1OD3 A;  2XQX A;  4GZ9 A;  4QB6 A;  3LPF A;  5LA0 A;  1NX9 A;  3LPG A;  1JZ6 A;  2W87 A;  2VJX A;  1O59 A;  3GDB A;  5B4N A;  5IFT A;  1UY0 A;  1PMH X;  5J1X A;  4P02 B;  3ZM8 A;  1W8O A;  4BXS V;  4QDS A;  3I2K A;  3VD9 A;  1UWW A;  2VZS A;  1F4A A;  2WN3 A;  3LQC A;  4JX0 A;  4ZXE A;  2VMD A;  1JU3 A;  1JZ5 A;  3VDC A;  1SHW B;  1GU3 A;  2YG0 A;  4A44 A;  1EUT A;  3HEI A;  5JUV A;  3NJX A;  2Y6G A;  3LEI A;  3VD7 A;  1JHJ A;  4ARX A;  4XZU G;  4TTG A;  2RV9 A;  4CU8 A;  5C70 A;  4XUR A;  2J1E A;  1US3 A;  3K4D A;  2WO1 A;  2VO5 A;  3III A;  1OH4 A;  3I2H A;  4DXS A;  5DN2 A;  3K4Z A;  3C7E A;  5LCW L;  2WBK A;  1DP0 A;  2Y6H A;  2YB7 A;  3OB8 A;  4LPL A;  2VTF A;  1JZ3 A;  1JU4 A;  2E31 A;  1UY2 A;  3CMG A;  2VM9 A;  2WO2 A;  3ACI A;  4M4R A;  3OGR A;  3WF4 A;  2WO3 A;  3T08 A;  1MPX A;  1JZ2 A;  3THD A;  4DXR A;  4QDQ A;  5JXJ A;  2VZV A;  4HG6 B;  4BK5 A;  1ULO A;  3SEE A;  1K12 A;  5A1A A;  2JKX A;  5B4X A;  2QQM A;  4UI9 L;  3MO4 A;  4DUX A;  4ZZ5 A;  1ULP A;  5I0D A;  4DEV A;  1OT5 A;  4TXW A;  4DUV A;  4XUP A;  1XC6 A;  1GOG A;  2ORX A;  1NUK A;  2J7M A;  5C7G A;  4DUW A;  3HOB A;  3I3B A;  4AAX A;  5LA2 A;  2VZP A;  3DEC A;  2VMF A;  4A41 A;  4A3Z A;  2J1U A;  2ZEZ A;  2ZEW A;  3MV1 1;  2W1Q A;  4CU9 A;  2ZXQ A;  2DCJ A;  1UZ0 A;  2WYS A;  5FUI A;  2WDB A;  3OEA A;  2QQN A;  2Y8K A;  4XUN A;  3A22 A;  2B9V A;  1W9S A;  2VQT A;  3UET A;  2R7E B;  3WF2 A;  3WF3 A;  4UOJ A;  3T0B A;  4PT6 A;  4OMC A;  4OUE A;  1GOF A;  1US2 A;  1JZ4 A;  3HNM A;  4JHZ A;  1CZS A;  3T2Q A;  1XNA A;  2VC9 A;  5G04 L;  4XUQ A;  1W0N A;  2VZQ A;  4KMQ A;  3CQO A;  4QB1 A;  4P5Y A;  3ABZ A;  3C7O A;  1NKG A;  5DQ0 A;  4QDR A;  4OMD A;  4LQR A;  1PX3 A;  1JYX A;  3WQB A;  3HJR A;  1J83 A;  2RJ2 A;  5EIY B;  1GOH A;  1PX4 A;  2C26 A;  3EB7 A;  3A7Q A;  2VZO A;  2X05 A;  3WNO A;  4QX2 A;  5JXG A;  2EIE A;  2W3J A;  3JXS A;  3W5N A;  1UX7 A;  1F4H A;  3BN6 A;  2W1U A;  4OYU A;  3FL7 A;  3VD5 A;  2X10 A;  3FHA A;  3LEG A;  4GWI A;  2XOM A;  3SKV A;  4JKK A;  3PUI A;  4UAP A;  3T0D A;  1L7Q A;  3ETP A;  2QQI A;  3WSO A;  2E26 A;  2J1T A;  2VCA A;  3CZU A;  3DYP A;  4IUG A;  3WEZ A;  4CU7 A;  1JYV A;  3WNM A;  2QQL A;  3IAP A;  2VR4 A;  2WAB A;  4DEQ A;  2BGP A;  2DCK A;  1CIY A;  2QBX A;  2J1S A;  1DLC A;  3OG2 A;  3HN3 A;  1W99 A;  1R64 A;  4ZY9 A;  5HPO A;  1TVG A;  5CZK A;  2VZ3 A;  1KEX A;  4CUB A;  4DXT A;  1BHG A;  2VME A;  4A42 A;  4BDV B;  4L0P A;  2CDO A;  4P08 A;  2DDU A;  4XUT A;  2WZE A;  3P1I A;  4QX1 A;  2ID4 A;  1SG3 A;  1UXZ A;  4MOA A;  3HPN A;  1D7P M;  3T0A A;  3ECQ A;  2C4X A;  1O8S A;  5IFP A;  2B4K A;  3MUZ 1;  3U37 A;  2WQ8 A;  4OZO A;  4CU6 A;  4W4Z A;  3HNY M;  3GGL A;  4GWJ A;  2ZEY A;  2XON A;  2WZ8 A;  5C71 A;  3DYM A;  3NNG A;  4A6O A;  1UXX X;  2W91 A;  3OEB A;  1NAE A;  2E33 A;  2VCB A;  4MGS A;  3I2J A;  2WAA A;  3EYP A;  4E8C A;  2WAO A;  3WNK A;  3X0U A;  2J22 A;  2VOT A;  1JYN A;  4ARY A;  4RN5 A;  2VQU A;  2V4V A;  1UMH A;  1GNY A;  1UY4 A;  4CUC A;  3OGS A;  3C7F A;  5CYY A;  2LW8 A;  2VMC A;  2VZR A;  4D0Q A;  1I5P A;  2HLE A;  3NRU A;  4LHS A;  3CDZ B;  5LA1 A;  2W9X A;  2QQK A;  1P8J A;  3LE0 A;  4LKS A;  3FN9 A;  3SKJ E;  3C7H A;  2JE8 A;  5IHR A;  3K75 B;  3IAQ A;  3OGV A;  2E32 A;  2JDA A;  3PUH A;  4W8J A;  4Z2A A;  4JKM A;  4BK4 A;  3VDB A;  3E1F 1;  1UMI A;  3WNN A;  3I2I A;  2W92 A;  3A23 A;  2VZ1 A;  4PF1 A;  3MUY 1;  3I3D A;  1KGY A;  1T2X A;  1JZ8 A;  5IYY A;  4AG4 A;  3WF0 A;  2LS6 A;  3C8X A;  3CKH A;  4D8M A;  3ACH A;  2EID A;  3T2P A;  3I2F A;  3T2O A;  3CZJ A;  3ACG A;  2CDP A;  4E8D A;  3WF1 A;  3AC0 A;  1W9T A;  3C7G A;  5JXH A;  3MBW A;  4MO3 M;  3I2G A;  4XVH A;  2XHN A;  3J7H A;  4M4P A;  3P6B A;  5JR2 A;  3VD4 A;  2Y6J A;  3HNB M;  3K4A A;  1XPW A;  2OKX A;  1WCQ A;  3K77 A;  1WKY A;  3LEK A;  3CIH A;  1UY1 A;  5DMY A;  3NJV A;  3IB3 A;  2W94 A;  2X09 A;  3D3A A;  1UYX A;  5F7U A;  4MAD A;  4ZZ8 A;  3VD3 A;  1GQP A;  1PMJ X;  3I3E A;  2J1V A;  4BJ0 A;  2PQS A;  4A4A A;  3IDA A;  4QB2 A;  2ORZ A;  2Y6K A;  1O8P A;  2ZEX A;  1TG7 A;  3T09 A;  1K45 A;  5DPN A;  2BZD A;  1GMM A;  1SDD B;  2YC4 A;  2BBA A;  3BGA A;  3K46 A;  5G05 L;  3GXU A;  4A45 A;  2YFU A;  2YFZ A;  2EIB A;  2JD9 A;  2Y6L A;  3ACF A;  1EUU A;  4KWU A;  2VZU A;  4JKL A;  2VL4 A;  1RYY A;  3GM8 A;  1UY3 A;  2W1S A;  4PQQ A;  2W46 A;  1JZ7 A;  2V72 A;  3W5M A;  3DYO A;  1JI6 A;  1LNS A;  5HXM A;  2BGO A;  1H6Y A;  4YPJ A;  2W47 A;  4XUO A;  2Y64 A;  4MGQ A;  2HYX A;  2YC2 A;  2VZT A;  3F2Z A; 
#chains in the Genus database with same CATH topology
 3NAP A;  4Y5T A;  1UGW A;  1U5Z A;  1ZRR A;  2ZAA A;  4IEU A;  3BTY A;  4RA0 A;  5FZF A;  2VY0 A;  3MV0 1;  3OGJ A;  3FUO A;  2K2S A;  1LOA A;  1TMF 3;  3A0K A;  2RVA A;  1VBA 1;  3ETQ A;  3WLU A;  4CDU A;  4GIQ A;  3B3Q E;  3MZH A;  2RJL A;  5JMO A;  2Z4F A;  1DIW A;  3FLP A;  3ZYH A;  2ZKL A;  3AFG A;  1AXZ A;  4NRO A;  4W50 A;  1GV9 A;  5I8Y A;  2RDS A;  5JXI A;  2Q5T A;  4CDX C;  2D6O X;  4KWJ A;  1UZZ A;  4ZKT B;  5EXA A;  4Q4W 1;  1CAW A;  5IJR A;  1XNT A;  3ITQ A;  5K0U C;  4QX3 A;  2J1R A;  3BAL A;  1J1L A;  1ENX A;  1UYZ A;  5HI0 A;  2BU9 A;  3CL1 A;  1CAV B;  3ZIW A;  3OBA A;  2Y0I A;  4M01 A;  4RYD A;  3ALQ A;  3AYA A;  3ZR6 A;  1OA4 A;  4CYD A;  4V2V A;  2P5B A;  1B35 A;  5H9S A;  2QVS B;  4HK8 A;  2GZW A;  3AXD A;  1SLI A;  1WMD A;  3L2H A;  5IVJ A;  4HKC A;  2WN2 A;  3M51 A;  1QXR A;  3TEZ A;  2GSY A;  2P2K A;  5FZ8 A;  4D7S A;  2W95 A;  2ZGM A;  1ZGR A;  1WW5 A;  2G1M A;  2GN3 A;  1WUV A;  1TE1 B;  2WUH A;  1G9D A;  2EXK A;  1NY7 2;  2WS9 1;  1RUI 3;  4K6B A;  4NWV A;  1Z78 A;  2J1A A;  3OJB A;  1UU4 A;  2PHR A;  3NQH A;  1K42 A;  2Q8E A;  1OD3 A;  5KC6 A;  2K9Z A;  4NHX A;  4QB6 A;  4CDU C;  5LA0 A;  4XF0 A;  1AR7 2;  2KA3 A;  1NX9 A;  2Q0A A;  1Q8V A;  3BOP A;  3VBO C;  2A73 B;  3ZXA C;  4D6S A;  4XIO A;  2VJX A;  1O59 A;  1DGW X;  1HB1 A;  1I5Z A;  1YJL A;  2PHT A;  5B4N A;  3ZFF B;  5GLW A;  2R6Q A;  3E6B A;  4XF3 A;  4CDQ A;  3ZM8 A;  4Q4Y 1;  5BNN C;  2UU8 A;  2D43 A;  3WP4 A;  2MEV 2;  3E97 A;  2XJP A;  5H9R A;  5A7W B;  5ABJ A;  4PIX A;  4XTM A;  1KS4 A;  2WNU A;  1X36 A;  1AYM 2;  2XH6 A;  2JDH A;  3DPR B;  4HBN A;  2CV6 A;  1MS0 A;  4FPF A;  1XE7 A;  4ZXE A;  2VMD A;  1F35 A;  1AHS A;  5HF3 A;  3BCW A;  1SHW B;  2YG0 A;  4UFL A;  3TN9 1;  4IEO A;  4A44 A;  1ZZ7 A;  5FMD A;  4HK9 A;  4DHR A;  1AL0 G;  1COV 1;  3PVN A;  3MF9 A;  3NJX A;  1DBN A;  2G9Z A;  1Z0H A;  2TEP A;  4KWK A;  5J31 A;  4LBM A;  3RS6 A;  2P17 A;  4LR4 A;  1LTE A;  5FY0 A;  4CEW A;  1HV0 A;  2XKP A;  2RV9 A;  2HWD 3;  4IEA A;  1H2L A;  1MS3 A;  3CO2 A;  5A3T A;  2VXR A;  1EAH 3;  3GZT B;  2JIJ A;  3J7M A;  3K4D A;  2VO5 A;  3PVB B;  1S0E A;  2E6V A;  2D3P A;  3NL1 A;  5FR3 A;  1AR9 1;  3OY8 A;  5DG1 A;  5A6Y A;  1CES A;  1A8M A;  1REF A;  1OH4 A;  4L9B A;  4ATE A;  3I2H A;  3UKV A;  1WLT A;  4PHZ A;  2JG9 B;  5BN6 E;  3K4Z A;  1U0A A;  2HWC 1;  1XRU A;  2YUE A;  3BTA A;  3SC7 X;  1PGW 1;  3AK0 A;  4YW7 A;  4DHM A;  5FRE A;  5FQ0 A;  2G9F A;  3S7E A;  2VM9 A;  1VR3 A;  1RUG 3;  2OXB A;  1WA4 A;  3DKQ A;  3PU3 A;  2IXI A;  2WNV A;  4M4R A;  3WDW A;  3WF4 A;  2YMZ A;  2WO3 A;  4QMA A;  3AKR A;  3W9A A;  4AEK A;  1JZ2 A;  2G9G A;  4JQR A;  2DFC A;  4QDQ A;  1UU5 A;  4BQ5 A;  5I0R A;  4V2W A;  5FQ0 B;  3AP9 A;  4HG6 B;  4AEM A;  5HCH A;  1ZRE A;  1KUJ A;  5FXW A;  1K12 A;  3AJY A;  3SEE A;  3TN9 2;  1OLM E;  4B7E A;  1AR7 1;  2QQM A;  3VBH A;  1N1S A;  4UI9 L;  2NQY A;  2B46 X;  1V0A A;  3FLR A;  3MO4 A;  1MVE A;  2VBB A;  4DUX A;  5I0D A;  4QHB A;  1BBT 3;  1VE0 A;  4Y3B A;  1OT5 A;  2A6Y A;  2W08 A;  4N7U A;  4DUV A;  4QQL A;  3POG A;  5FJK A;  1XC6 A;  3IMM A;  3QH7 A;  4N7Y A;  2ORX A;  1KXG A;  2J7M A;  4Q4Y 2;  4XW3 A;  3P1O A;  2CTV A;  4JDO A;  4XYX A;  1OKQ A;  3A4U A;  3HOB A;  5K0U A;  1V70 A;  1WD4 A;  1JAC A;  1N3O A;  3JBG 3;  1NOV A;  1VBD 3;  3K3O A;  1W8F A;  4CCL A;  1DF0 A;  3GNE A;  4FTB A;  3ZXD A;  2XBO 1;  1E5R A;  1W06 A;  4GKX A;  3CHX A;  1CD3 G;  2CWM A;  2WZR 1;  4CP1 A;  5KXE A;  1QY4 A;  3KSC A;  5D8A C;  3SMN A;  2WQ4 A;  3MIU A;  1R08 3;  1UZ0 A;  5AVP A;  4CPB A;  1UGW C;  3KF5 A;  2WDB A;  2VH9 A;  4J6S A;  2JXA A;  3HBK A;  4X6Q B;  5J37 A;  5FY5 A;  1QH6 A;  2Y8K A;  4YSF A;  4H55 A;  4FQZ A;  3AM2 A;  4NUB A;  5F6K A;  4G3Y C;  1ZX5 A;  2YU2 A;  3FFZ A;  1BCX A;  2K0G A;  4N43 A;  1BJQ A;  1O4Z A;  3R4S A;  4WM8 B;  3W58 A;  1C5I A;  1LEC A;  4MSV A;  4UOJ A;  1NQD A;  1RUC 1;  4Q8L A;  4GWM A;  1D0H A;  4LUL A;  4OMC A;  2BBV A;  2EIG A;  4HPK A;  1GOF A;  2C9A A;  3ZYI B;  1GWM A;  1W28 A;  4BH9 A;  3AZW A;  1GZ9 A;  2E51 A;  2WWU A;  3HNM A;  2JDP A;  1T6G C;  3BPS A;  4KBB A;  4N43 B;  4Q4W 2;  3T2Q A;  3SMH A;  1RC6 A;  2VC9 A;  3PLQ A;  2BRT A;  3Q8F A;  5T50 A;  4XUQ A;  2QTW B;  2ZX2 A;  4AVS A;  3ZSE A;  1S0B A;  5EWZ A;  1MQT A;  1WA6 X;  3MW4 A;  5JZG A;  5KHJ A;  2AUY A;  3J8F 2;  3C7O A;  4XXP A;  3WX5 A;  2FD8 A;  1EV1 2;  4LQR A;  1FX5 A;  4AGR A;  2KXL A;  2WZR 2;  3WQB A;  4NAM A;  1MQT B;  5FY7 A;  4AI8 A;  1ND2 A;  1O4T A;  1H0B A;  3MF6 A;  5FO9 B;  2QFE A;  5GLV A;  5AC9 1;  5IK7 A;  2OQ6 A;  4CZS A;  1EYB A;  5FWE A;  5JXG A;  1CAX B;  2EIE A;  4KBZ A;  1V00 A;  2F17 A;  1BBT 2;  2ATF A;  2WFF 1;  1FYU A;  3VZK A;  1ZRF A;  1HIX A;  1NT0 A;  2VTX A;  2D40 A;  2FDH A;  2XWB B;  4OYU A;  3B7M A;  3VD5 A;  3QLQ A;  5FJH A;  3PUA A;  3ZN6 A;  1QJF A;  4J1W A;  1TNR A;  4K3U A;  1C1L A;  5I0T A;  1KFX L;  1V6I A;  4GB3 1;  3AKQ A;  3AKT A;  2LRO A;  3RFR A;  5I8T A;  1DGW A;  1WD3 A;  1I3H A;  4LIV A;  5FK8 A;  3WSO A;  2ARA A;  4WZC A;  3VZE A;  2E26 A;  4FL5 A;  2YDE A;  2ZGQ A;  3CZU A;  1VJ2 A;  3O5S A;  4P9L A;  3UAL A;  3HQR A;  3VY6 A;  4IUG A;  1CAU A;  3VKF C;  3MI8 A;  3VZN A;  2VW0 A;  4ISQ A;  2IXH A;  2GDF A;  4W6X A;  2JWP A;  2HJI A;  4QX8 A;  2VR4 A;  3GZE A;  3IAP A;  4DEQ A;  3VUO A;  2BGP A;  2WLQ A;  1RMU 1;  1K5M A;  1CIY A;  4W6W A;  1OOP B;  2QBX A;  2GNT A;  2J1S A;  3PTY A;  5FYC A;  1F31 A;  3FLT A;  5B2G B;  1RVF 3;  3THT A;  5FOJ B;  3POF A;  3R52 A;  1R64 A;  5HPO A;  3LA2 A;  2XG3 A;  3PNA A;  5AC9 2;  5J7M A;  4XHB A;  1APN A;  2D44 A;  4NHL A;  4CUB A;  3KV6 A;  2RMU 1;  1VRH 3;  3KV5 A;  1ZZ6 A;  4CCE A;  5I0U A;  4AK4 A;  4SLI A;  1AJK A;  4DIN B;  5ISL A;  2BQP A;  4XUT A;  3H8O A;  3LLZ A;  2DUP A;  4BCU A;  4F83 A;  4TSV A;  1W05 A;  3LEM A;  4HVR A;  2JG8 B;  4Q1R A;  1EP0 A;  3S57 A;  1AYM 3;  1COV 2;  1SG3 A;  1RIT A;  1UXZ A;  4ES8 A;  1LU1 A;  2C4X A;  3KM5 A;  5FXX A;  2ZOE B;  3KHB A;  3ZFE A;  1VIW B;  2BWC A;  4HN1 A;  3ES4 A;  4XZP A;  5FYT A;  1AYM 1;  5LK7 B;  2B4K A;  1RUG 1;  3H8U A;  3EQE A;  5ACA 3;  1O3R A;  2X5I A;  3U37 A;  4SBV A;  4DO0 A;  1UOF A;  4JGY A;  5L19 A;  1J4U A;  2TBV A;  4LKE A;  4XJ9 A;  3HNY M;  1NCR A;  1PVC 3;  1ZBA 1;  4YVS A;  2HWD 2;  2A71 A;  1UQX A;  1WBL A;  2OVU A;  2VBD A;  4H3W A;  1FPN 1;  1KJL A;  3HR9 A;  1TNF A;  3VBR A;  2ARX A;  1SBF A;  2R07 1;  3DYM A;  1OI6 A;  4TWT A;  3NV3 A;  4OUS A;  3MIC A;  4J6G A;  2W91 A;  3KMH A;  3O7O A;  1NAE A;  5EFU A;  4ZS3 A;  1YIP A;  2VCB A;  5LA9 A;  4XJZ A;  4YVS B;  3MDP A;  4JCK A;  4EWD A;  1G9A A;  4Y20 B;  1A6C A;  3NAP C;  1RUE 3;  2BNM A;  2J22 A;  3JB8 A;  2I45 A;  1LOF A;  2ZML A;  4ARY A;  2BNN A;  1YRZ A;  3AYC A;  2R32 A;  4RN5 A;  2BV4 A;  2RS1 3;  1BVP 1;  2WRA A;  2IUW A;  2H6C A;  3UJQ A;  2BUK A;  1FOD 1;  1PO2 2;  1UMH A;  4CUC A;  3C7F A;  4UYB A;  3JD7 3;  2LW8 A;  2VMC A;  4IEY A;  1MZ5 A;  2JDZ A;  2KR2 A;  2ZAH A;  4PBP A;  2P34 A;  1HJG A;  2YV8 A;  3B9I A;  1XQN A;  2JG9 C;  1IZ3 A;  1I5P A;  1C57 A;  2RE9 A;  3TN9 3;  4AEJ A;  2ZZQ A;  3J7N A;  1AR8 2;  3MLK A;  2EAK A;  2VUJ A;  1DZT A;  5D3E A;  1QJY 1;  2TUN A;  1Z7S 2;  2RM2 3;  2SBA A;  3CDZ B;  4NE9 A;  4EZH A;  5J48 A;  5FYM A;  2XLG A;  5T3N A;  2QQK A;  5EXO A;  2HWF 3;  1YJK A;  1W3V A;  3USS A;  1HB2 A;  2JE8 A;  3PME A;  3RNS A;  3LA3 A;  2OPK A;  5IHR A;  3UJO A;  2QP2 A;  5LZ6 A;  3MIV A;  3IAQ A;  2ZS6 B;  5A3U A;  1C3H A;  1ZZB A;  4D69 A;  1LOG A;  2PTM A;  4NPR A;  5DUU A;  2JDA A;  5BNN B;  4Z2A A;  5L36 A;  3IPV B;  3VL8 A;  5FXV A;  2WNO A;  3KWV A;  3WNN A;  3I2I A;  5JPN B;  4FFI A;  1X9T A;  4YLZ A;  4C90 A;  4AKB A;  2AAC A;  3AVS A;  2YZ4 A;  3VHP A;  4YYO A;  3KHC A;  4YFZ A;  4WVV A;  1YLL A;  1DYK A;  1OUX A;  3PU8 A;  4RQP B;  3AFK A;  1PGS A;  1NXD 1;  4FPC A;  3RZZ A;  1RTV A;  2RS3 1;  1HRV 1;  3O0V A;  4LXL A;  3WXP A;  4IQP A;  1KJR A;  3C8X A;  3LOI A;  4HZF A;  3ACH A;  4YW2 A;  4QKF A;  5FZ4 A;  1IS5 A;  4GQ7 A;  3KF3 A;  4DDN A;  3NMB A;  3LSE A;  4C1W A;  5IVV A;  5CFC B;  4NR1 A;  4WM7 C;  3DN7 A;  1UD1 A;  5APA A;  4CDU B;  1NQJ A;  5J4T A;  2JEC A;  3ZFG A;  2RS3 2;  1W9T A;  1G6N A;  3L9J T;  4GMP 3;  1QJX 2;  4S2G A;  4WVW A;  5BYN A;  3R4U A;  3UKN A;  1CON A;  1W8H A;  3PUR A;  5LRR A;  3BYW A;  3NNJ A;  4H14 A;  1UU6 A;  2BTV C;  3CBN A;  4PI2 A;  1F8V A;  3WOC A;  1PK6 C;  4XVH A;  3ZN5 A;  4IV3 A;  2ZGP A;  4AL9 A;  4C8D A;  4NAO A;  5HCB A;  5F5Q A;  1WW6 A;  5C3Q A;  4Y1V A;  1DQ0 A;  1RJ7 A;  4ORF A;  3N7L A;  4IES A;  2OQ7 A;  3UV9 A;  4PCR A;  5A1L A;  3LOB A;  3HNB M;  3FX3 A;  3TB0 A;  1AL2 1;  1XPW A;  3THP A;  1F2N A;  3G7D A;  5A1F A;  5IW0 A;  2PHW A;  2WT2 A;  3LIH A;  1SCR A;  4R9B A;  5FLJ A;  4D7T A;  3HT2 A;  5BNQ A;  2WZR 3;  4Z82 A;  1OPO A;  2NMO A;  2VMI A;  1RHI 1;  2W94 A;  2BMY A;  2QQW A;  5IWF A;  3LDR A;  4ZHN A;  4F3J A;  2D3S A;  1GQH A;  1OD5 A;  2IXJ A;  3MID A;  4O7X A;  3VBU C;  4DPN A;  4PQ9 A;  4YM2 A;  5F7U A;  5C5T A;  3LL0 A;  2PAM A;  1GQP A;  3KV9 A;  4OQ9 A;  5C8C A;  5HBA A;  4N7I A;  5F2S A;  2VUL A;  1ZBE 3;  2PYT A;  4KGQ A;  4PIU A;  2JIG A;  1WCK A;  2PQS A;  2YGL A;  3BVC A;  2RDR A;  4QHO A;  3H8X A;  1JOB A;  3H3Z A;  3M7A A;  4QU2 A;  2BFU S;  5C3P A;  1QNY A;  1PNF A;  1TME 2;  1O5U A;  2QDR A;  1RJ8 A;  5C9A A;  2BZD A;  1GMM A;  4IET A;  2C5D A;  5AVA A;  4ZU7 A;  4Q5O A;  1W6O A;  5K4L A;  1WWY A;  2XQR A;  2BBA A;  1AR9 3;  3CNA A;  4PDW A;  4I0W B;  5FLI A;  3VDD A;  3ZPO A;  3O1R A;  1DFQ A;  2RS1 2;  2WWS A;  3VBO A;  2P1B A;  4AKD A;  4C91 A;  2EIB A;  2CGN A;  2CGO A;  3USU A;  5C9A B;  1UIJ A;  3WT3 A;  5HCA A;  2XVG A;  2WFP A;  3LDK A;  4LA3 A;  4MH0 E;  3CQG A;  2VZU A;  3QOP A;  2VL4 A;  2XVL A;  4M3C F;  4KWU A;  4FFG A;  3I49 A;  3NNF A;  1S0I A;  4BQ1 A;  4E2G A;  3VDD B;  3WDY A;  2XGX A;  2BP6 A;  4CTE A;  1N47 A;  3BUC A;  2W46 A;  4Q4X 3;  3VV1 A;  2V72 A;  1O3S A;  3EXU A;  4S2F A;  3DYO A;  2RM2 2;  5A3L A;  2HWB 3;  3NAP B;  2CNA A;  4ES9 A;  4MGY E;  2DVA A;  5CB7 A;  5BY9 A;  2ZHL A;  1LEN A;  2Y64 A;  3M4F A;  2MHF A;  2HWB 1;  1RUJ 3;  1FPN 3;  1LOE A;  2YC2 A;  3I54 A;  4J25 A;  4KGG A;  4PI0 A;  4Y5Z 0;  3RQ0 A;  5JPM B;  3SQO A;  5FMO S;  1S2E A;  1ZBA 2;  4RFR B;  3RSJ A;  3T3Y A;  4DRV A;  3I59 A;  5SV8 A;  1IQD C;  1R1A 1;  4QT6 A;  4E27 A;  2I74 A;  2VVD A;  3A21 A;  3Q9O A;  4L8Q A;  1YZ5 A;  5EJZ B;  2SLI A;  3HIF A;  4WM7 B;  3WR0 A;  2VW2 A;  4XXA A;  5ANQ A;  4D94 A;  4YFW A;  4H7L A;  1TZO A;  1OF3 A;  2EXJ A;  2VVE A;  3VDA A;  4CVU A;  1CZT A;  1H6X A;  4N9I A;  5FYI A;  2XLF A;  3I59 B;  3WNX A;  4CCM A;  1FAY A;  1GZW B;  4RGK A;  3VBR C;  1CAV A;  1PIV 1;  1V6O A;  2Q8C A;  1MVQ A;  1QGL A;  5LBF A;  1J84 A;  2DUO A;  3JBG 2;  1WLW A;  1GUI A;  2ADD A;  2P6H A;  2HWE 1;  2WNV C;  1H9P A;  1LEM A;  3HVD A;  1MZ6 A;  1VAK A;  3OYW B;  1W8W A;  3D0J A;  4Q4V 3;  1I9R A;  1GZW A;  1XBF A;  2W1W A;  1S0C A;  3I97 A;  4Q1P A;  1DGR A;  3LW1 A;  4YWA A;  4IL7 A;  2BPA 2;  2D5H A;  2WQZ C;  3VKN A;  1Q8O A;  3ZXF A;  4HKL A;  1YQ8 A;  5CU1 A;  2VUD A;  2CWS A;  2ZGU A;  3AL6 A;  4Q4V 2;  1PIV 2;  5CIR A;  3R0R A;  1H30 A;  4RFT 0;  4ET7 A;  3CQC A;  1SEF A;  1ND3 B;  2UUR A;  2Z5W A;  3AZV A;  3VBH C;  1W8U A;  2EF6 A;  4YVW C;  1FI2 A;  3J8F 3;  4AHX A;  5FPU A;  1PO1 1;  4JTO A;  3KB5 A;  3KLS A;  3UNP A;  3FC0 A;  1K3I A;  3SNM A;  3AYD A;  3UBW A;  3P5B A;  4HKW A;  3SPR A;  5LHO A;  4X8P A;  5C3O A;  1S2X A;  2WFF 2;  1PO1 3;  1QOT A;  1IPJ A;  4GKY A;  4GZ9 A;  4TLF A;  4CA9 A;  2FDF A;  1XEZ A;  3AB0 A;  5T5P A;  4YVS C;  1Y9G A;  1PNG A;  1JZ6 A;  5FZO A;  3ZDS A;  4AI1 A;  2ZGL A;  3VZJ A;  3GDB A;  5JZG B;  2WSV A;  4DY5 A;  1PMH X;  1HW5 A;  2JEN A;  5J1X A;  3PMS A;  4YAR A;  1W8O A;  3B02 A;  4BXS V;  2VVF A;  5JLV A;  2A7A A;  2YY1 A;  4YM1 A;  1AYN 3;  1HQL A;  4BWO A;  4Y1Z A;  4GH4 B;  4AI2 A;  1UWW A;  3V0B A;  1ENQ A;  5FDB A;  3TOW A;  2V09 A;  2VZS A;  4JTN A;  3BU0 A;  3PHM A;  4YZ1 A;  1SBE A;  3B94 A;  2CU5 A;  5J36 A;  3WD5 A;  1LOB A;  2IC1 A;  3JB4 C;  2ZCW A;  5KWR A;  1GU3 A;  1RUD 1;  1FXZ A;  1ASJ 3;  5F5I A;  1PHM A;  2RJK A;  3BOW A;  5JUV A;  1HV1 A;  2RS1 1;  4XF1 A;  5FPL A;  2OA2 A;  2QE3 A;  3LEI A;  3VBU B;  3VD7 A;  4TTG A;  2AC1 A;  4BE3 A;  5C3S A;  2XVK A;  4CU8 A;  3OTF A;  2D6M A;  1KIT A;  4FTS A;  4XUR A;  1OFN A;  4AF9 A;  1GYK A;  2C1N A;  5FYH A;  4FPJ A;  3CU7 A;  5FKB A;  1OA3 A;  2PHF A;  4EYU A;  2OYZ A;  5IVB A;  3WDX A;  5DN2 A;  2WWJ A;  3C7E A;  4E2Q A;  2WBK A;  3B00 A;  3DGT A;  2Y6H A;  3BPZ A;  5LCW L;  1UL9 A;  4UFM A;  5EXG A;  5JSR A;  4MXW A;  1ODM A;  1JZ3 A;  1JU4 A;  4XET A;  1DZR A;  1G86 A;  3B5L B;  4RHV 1;  4CP0 A;  5DAB A;  3LKY A;  5FPZ A;  4EV0 A;  4DHP A;  1H1I A;  1CGP A;  3HT1 A;  1VBE 3;  4XDQ A;  5CAZ A;  1OVP A;  3ZN6 B;  4I30 A;  1YFY A;  4AOC A;  4F7Z A;  3T08 A;  1W6P B;  4RHV 3;  4DX0 A;  1HLC A;  2AEY A;  4Y22 A;  4HN0 A;  1C3N A;  1WW7 A;  1PGL 2;  1QH7 A;  4R9C A;  3ZHE B;  4UBH A;  5FZB A;  2VPV A;  1WMX A;  3ZFE C;  1ULO A;  2D98 A;  3AMH A;  2PQQ A;  1GP5 A;  1O5L A;  5B4X A;  5A1A A;  1JYI A;  1RUI 1;  1VLN A;  1AR8 3;  4HSL A;  4FPL A;  3OYW A;  3WP3 A;  4L92 A;  1GFF 2;  4ZZ5 A;  3H8R A;  2BEO A;  4QQO A;  2IZW A;  3F95 A;  3FE5 A;  3R4D B;  1KS5 A;  3BTZ A;  3B9C A;  4DEV A;  1BKZ A;  4OHY A;  2WA3 A;  1QJY 2;  3MGU A;  4YZ3 A;  2XJV A;  5E89 A;  4AFB A;  4AE2 A;  4CDQ C;  1WS5 A;  4HOO A;  3SH5 A;  4LO6 B;  2NN8 A;  3LWC A;  4DUW A;  5K9Y A;  2WO7 A;  1ND3 A;  2O14 A;  2V73 A;  2R1D A;  3I3B A;  5FTT C;  1QJX 1;  4TZD A;  4QD2 A;  3UGG A;  3WQ7 A;  4NVP A;  2R30 A;  1LOF C;  3DCQ A;  4ERO A;  3N9L A;  5IK4 A;  3CU8 A;  3IQV A;  4A3Z A;  3IIA A;  2XXZ A;  2ZX1 A;  3ES1 A;  2O98 A;  3IDB B;  2ZEZ A;  2ZEW A;  3IM0 A;  3MV1 1;  2XJT A;  1YQC A;  5FZI A;  1QIQ A;  3KCY A;  2W1Q A;  4ITC A;  2PFW A;  4IND A;  5DDJ 1;  1POV 3;  5A80 A;  5T55 A;  4DQA A;  5FLH A;  4EN8 B;  4XQW A;  4CU9 A;  5L9V A;  1AR6 2;  4KH9 A;  3FUQ A;  4COW A;  5EPA A;  2CAV A;  3MFA A;  3WOG A;  5FZO B;  5FUI A;  3OEA A;  4AED C;  4FAG A;  2QQN A;  1LGN A;  5E8A A;  3ZSJ A;  4NWW A;  5LX2 A;  2JG8 A;  1HQN A;  1JMU B;  3MFC A;  1QDC A;  3OD4 A;  2B9V A;  3PL0 A;  5T5L A;  1EPZ A;  5A3O A;  1XJA A;  4GB3 2;  5JDB A;  3V0A A;  3UET A;  2OUH A;  4FOV A;  1Y4W A;  4BU2 A;  2LTN A;  1YWT A;  1C1F A;  3RZH A;  1EAH 2;  4XEZ A;  2TNF A;  4IGO A;  4QPG A;  3AXY C;  4PT6 A;  5FZ6 A;  3WY6 A;  3P1N A;  2BDR A;  1JYT A;  3RJ2 X;  1H1A A;  3WDU A;  1MEC 3;  3N35 A;  4A7K A;  4JHZ A;  2VOW A;  5C4W C;  3V0A B;  3SML A;  1NCR B;  4HT1 T;  1LOD A;  4ATF A;  5G04 L;  4I2O A;  3VKM A;  1SLC A;  3UYJ A;  4IEZ A;  3RJR A;  2Y34 A;  2YBK A;  3MW2 A;  3U78 A;  5LVZ A;  2PHU A;  1HRI 1;  2OX0 A;  1ASJ 2;  3U11 A;  1OC1 A;  1ND2 B;  3KQ4 B;  4CUG A;  5LB6 A;  2BMZ A;  2PAK A;  4B29 A;  1OFS A;  4RS5 A;  1NKG A;  3PVO A;  4IE5 A;  4OHX A;  5DQ0 A;  3VDD C;  5CAD A;  2BN0 A;  1S4C A;  4DB5 A;  1FT9 A;  1ZYB A;  1C5H A;  3TNP B;  4YGC A;  2A6V A;  4M3C B;  4QX7 A;  1W2U A;  1ZZ8 A;  1XNC A;  5LU2 A;  1S55 A;  5EIY B;  3VBF C;  1GOH A;  1PX4 A;  2C26 A;  3EB7 A;  2ZHN A;  4WVM B;  2R0H A;  5GZF A;  2XPJ A;  1LHW A;  5FP7 A;  4XF4 A;  4NHY A;  4MXW B;  1N3Q A;  2XJR A;  2W3J A;  3PVE A;  3W5N A;  3JQX A;  1UX7 A;  5FCC A;  1QXJ A;  3RG0 A;  1HXS 3;  1FMD 1;  1QWR A;  4CXX A;  2W2I A;  2Q4S A;  3Q8E A;  3ZYB A;  1PK6 A;  1F5F A;  1UOB A;  2BW8 A;  2RS5 3;  4GWI A;  4XBL A;  1E5I A;  1KFU L;  2A6W A;  2V5Y A;  3SKV A;  1QJU 1;  4Y22 B;  1ZZC A;  1OLR A;  1NCQ B;  1STM A;  5A6Q A;  4TLG A;  2JB4 A;  1WMF A;  4LE3 A;  5JIU A;  1MS1 A;  5JI7 A;  3T0D A;  4PIT A;  3RMY A;  5JIA A;  1WCU A;  2KM2 A;  2XBO 3;  3D5O A;  1PK6 B;  2HYQ A;  1BQP A;  4CE8 A;  3WEZ A;  2R04 3;  1IS3 A;  4WBB A;  3EO6 A;  4CCK A;  1ZM1 A;  1MR5 A;  5CFC A;  4CU7 A;  1JYV A;  2PHX A;  4AI3 A;  4CEY C;  4XFI A;  5KHH A;  2QQL A;  4QM9 A;  4N9H A;  1SQ4 A;  2D6L X;  2WAB A;  2ZAB A;  1S2K A;  1VAV A;  1H8V A;  2B9U A;  5GLU A;  3FZ3 A;  1DLC A;  1W0O A;  3OG2 A;  1QQP 2;  1YEW A;  1O7F A;  4EJR A;  4MZU A;  4Q8K A;  3HN3 A;  4JZR A;  1NE6 A;  1LCL A;  1REE A;  2DU1 A;  4ZY9 A;  4BIF A;  5ERL A;  3I7D A;  1U12 A;  3VBU A;  5BTV A;  2EXI A;  2VZ3 A;  2XWJ B;  1D4M 1;  1KEX A;  2HWC 3;  1AL2 3;  1V9U 3;  1EPW A;  3POW A;  4CDW C;  3QH6 A;  5T5J A;  3O1M A;  2OS2 A;  3LL2 A;  1BEV 3;  4HAN A;  1YC6 1;  5CEH A;  1JOJ A;  1AR6 3;  1CPM A;  1MQT C;  3ILF A;  4EN7 B;  5JZG C;  1RUC 2;  2CDO A;  1ULD A;  4P08 A;  4GD4 A;  2ZGO A;  2ES3 A;  2ENR A;  3U0Z A;  3M3I A;  1E5H A;  1EY2 A;  1NXM A;  4OQ8 A;  2GP5 A;  1VBB 1;  2ID4 A;  4GNT A;  2Q1M A;  4LNV A;  4MOA A;  5F5C A;  3N9N A;  1IB1 A;  5A70 A;  3MEP A;  1TP8 A;  3KVA A;  2PLV 2;  4IE6 A;  1YQ5 A;  1O3T A;  1AX0 A;  1SCS A;  4QPG B;  2HH9 A;  2HEV F;  2P37 A;  3HWJ A;  3VBR B;  4Z2W A;  1ENR A;  3WDT A;  3O44 A;  3MUZ 1;  1GIC A;  5L7O B;  4OZO A;  4CU6 A;  4W4Z A;  4HON A;  4MGT A;  1MZF A;  4NII A;  3ZKY A;  4QWN A;  3EHK A;  4MYE A;  2ZEY A;  2XON A;  5BUV A;  4DS0 A;  5C71 A;  2QQV A;  1LU2 A;  4Z07 A;  3SCG A;  3T0L A;  3U4X A;  4FFH A;  4XOG A;  3NNG A;  3IT8 A;  4A6O A;  4BLJ A;  1BEV 2;  3OEB A;  2E33 A;  1Q5O A;  4WVZ A;  4UXA A;  3QCW A;  1N1T A;  2VCM A;  2ZBJ A;  4QXB A;  5LBC A;  3ZXE A;  1LJ7 A;  2WAA A;  3MIB A;  4PLO A;  4LBL A;  3EYP A;  3T30 A;  2PXJ A;  2Q1Z B;  2WAO A;  3VZG A;  1W39 A;  2Y38 A;  4CCD A;  3X0U A;  3W20 A;  3WW4 A;  1RUG 2;  1HJF A;  4R6P A;  1O4Y A;  1A38 A;  4OZX A;  4BA6 A;  2VQU A;  4BPZ A;  4BZ4 A;  4CDX B;  4DAU A;  4LO8 A;  1O9C A;  1GNY A;  1V6J A;  1O9D A;  2XLA A;  2DVD A;  5HV0 A;  4AFA A;  3GYD A;  3MIG A;  3WHT A;  5KHK A;  4EWE A;  5FYY A;  2VTX J;  3J26 N;  3ORJ A;  2VMH A;  2ZMK A;  4BQW A;  2JX9 A;  2VZR A;  3B01 A;  3E5U A;  3OBT A;  1N1V A;  1PM7 A;  5JSO A;  2OZ6 A;  2HLE A;  4JHT A;  4Q27 A;  4BHP A;  4DIQ A;  3VZM A;  2ZGK A;  1NZC A;  3LL1 A;  2HYR A;  4FPY A;  1UCX A;  3E6C C;  5LA1 A;  1RUN A;  2EAA A;  3R50 A;  4GJZ A;  3ZDV A;  1CWP A;  2W52 A;  3VY7 A;  1P8J A;  2QUO A;  1UPS A;  4LUM A;  4BQY A;  3FN9 A;  4QQH A;  4AVV A;  1RED A;  2B45 X;  5AFE A;  3USU B;  4CEW B;  2D6N A;  4K8F A;  2HWC 2;  4Q4W 3;  4YZ2 A;  2JDY A;  4M3C E;  4D6Q A;  2GP3 A;  4EE2 A;  1ZZ9 A;  4MX3 A;  5TSW A;  1D2S A;  1IG0 A;  1MS5 A;  4AFM A;  3PUH A;  1OLM A;  5GM0 A;  4JKM A;  4BK4 A;  4LOT A;  1H1M A;  1UMI A;  2NM1 A;  3POB A;  4E4S A;  4DOU A;  5H9Q A;  3QAC A;  2GC2 A;  1D0G A;  3BU7 A;  4CPB D;  1Y3T A;  3AMQ A;  4DHU A;  2VNR A;  4HMZ A;  3LZZ A;  4MGZ E;  4R6N A;  4JRA A;  2NUO A;  3K2O A;  4PF1 A;  5KXB A;  2Q30 A;  3E6D A;  1KGY A;  1PGW 2;  1RXF A;  1LHU A;  4B8E A;  4N43 C;  2WNV B;  5IYY A;  3WF0 A;  2ZJC A;  3ILR A;  1RUF 1;  4YGB A;  4GX7 A;  1K5J A;  2BGC A;  2C0Z A;  4BXF A;  2EID A;  3AJZ A;  4U2A A;  5FZ1 A;  3ZLI A;  4AI9 A;  2H0V A;  3LB9 A;  2HEW F;  4K40 A;  4AXO A;  1IPS A;  2ZTN A;  3DPR C;  3JQW A;  1X8E A;  2DVG A;  3AP5 A;  3NWK A;  4YG0 A;  4Q4X 2;  4LBK A;  3CZJ A;  1GNZ A;  4WM7 A;  2DUQ A;  2DVB A;  3KQR A;  5LAS A;  2CDP A;  2B39 A;  1MS4 A;  3DL3 A;  2QCS B;  4BQ2 A;  1BBT 1;  2Q8O A;  4K9S A;  4MO3 M;  1MEC 2;  3OSD A;  4IEW A;  3KGZ A;  4D6R A;  3MLJ A;  2DWR A;  4Q4Y 3;  2OII A;  3NKT A;  1BK1 A;  5T5O A;  1GP4 A;  5A3N A;  2XHN A;  5EP9 A;  1VBA 2;  1PVX A;  3TRS B;  1POV 0;  5JR2 A;  1C8M 2;  2A75 A;  3VD4 A;  1KRI A;  4XC9 A;  5FP4 A;  1VAM A;  2LM3 A;  4JC1 A;  2V4A A;  5LY1 A;  2Y6J A;  4Q0U A;  5AFB A;  1B09 A;  1WKY A;  1NY7 1;  3LEK A;  4L2N A;  2MNG A;  4N90 A;  3JD7 1;  2XUM A;  4AZZ A;  2PLV 1;  2GUC A;  4P9W A;  3U75 A;  3NJV A;  2QQP A;  3BIE A;  4CDQ B;  1WS4 A;  3IB3 A;  2X29 A;  1R08 1;  4Q0S A;  4D7Y A;  5L9B A;  4O9G A;  2IFR A;  4XDO A;  5IVE A;  1YNA A;  5FYV A;  2HWD 1;  3GJB A;  1UZV A;  2VMG A;  2X8K A;  3AL5 A;  4QGN A;  3AZX A;  3V64 A;  2DVF A;  4BQ4 A;  4CP2 A;  5BNO B;  1RIN A;  1WLC A;  1VRH 2;  4XE9 A;  3ROU A;  2Z42 A;  2YPD A;  5BV6 A;  3W59 A;  3H7Y A;  4RGA A;  4YW3 A;  3LDB A;  2J1V A;  5CFD A;  1W6O B;  1RUH 2;  2WS9 2;  3OPZ A;  4TYS A;  4FOW A;  4PDW B;  4A4A A;  1IKQ A;  4N84 A;  3GCX A;  4FVV A;  4YVW A;  4IER A;  5FPV A;  1A34 A;  3ZSL A;  4KG8 A;  1MEC 1;  3T09 A;  2MPF A;  2PMW B;  2BVV A;  3OOX A;  1SDD B;  3VBS A;  2WR9 A;  3K48 A;  1AX2 A;  1AXK A;  1VB4 A;  4QXH A;  3ZYF A;  3OUI A;  1NA1 B;  4GUL A;  2Y26 A;  3VKL A;  2R04 2;  1SFY A;  4JDM A;  3MIT A;  4ZQ0 A;  2YFU A;  3ZMN A;  4AYU A;  1GZC A;  3SMO A;  3FWE A;  3LM1 A;  1GP6 A;  1XND A;  2WLP A;  3UK9 A;  1RUD 2;  4P5H A;  3OPW A;  5F3I A;  5A3W A;  1LHO A;  5DAP A;  2W68 A;  5EHD A;  1UY3 A;  2PN5 A;  4NN0 A;  1RUD 3;  5D8A B;  2C23 A;  1X7N A;  4CDW A;  1UKR A;  1JI6 A;  1FAT A;  1LNS A;  1U5Y A;  4Y33 A;  2BGO A;  3WG1 A;  5AC9 3;  4R8H A;  5A7Q A;  5HXM A;  3AMM A;  4EQV A;  4CCJ A;  2FMY A;  2I07 B;  2Y60 A;  4UFH A;  3O8I A;  4LLF A;  1H6Y A;  1YWK A;  1IGO A;  5A3P A;  3RYP A;  1WCD J;  4R4X A;  1HN0 A;  1TME 3;  1VBC 1;  3IDE A;  1VBD 1;  4DHN A;  3POJ A;  4HLT A;  2ADE A;  4MGQ A;  3RDI A;  3RWK X;  3N7K A;  1QJZ A;  4CDW B;  3JUU A;  5F9T A;  3U9X A;  2VZT A;  3F2Z A;  2V5D A;  1ND2 C;  2FZ1 A;  2W5F A;  1AX1 A;  3I8T A;  4QAW A;  4Z8B A;  4ZXK A;  4IGP A;  2R0F A;  5I93 A;  1CX1 A;  2XKO A;  5ANN A;  4CP9 A;  1UO9 A;  2VD7 A;  1QOS A;  1CN1 A;  2OUJ A;  4MGI E;  2VCC A;  1Z7S 3;  3VZF A;  4Y5I A;  2F6B A;  5C33 A;  3JU9 A;  4LBN A;  5A6X A;  3RZG A;  3HMY A;  3DF0 A;  4QX0 A;  1OLQ A;  2RG4 A;  4N53 B;  4Q0V A;  4O9E A;  3ZKU A;  1CX4 A;  5KC5 A;  2ZZJ A;  2J42 A;  3M70 A;  5C4W A;  4EN9 B;  4LTA A;  1HN1 A;  1GKB A;  4R4Z A;  4A3X A;  5FPX A;  4JGZ B;  4K1Z A;  1I6X A;  2FDI A;  1PZ7 A;  4EWA A;  2ILM A;  3AX4 A;  2KD7 A;  1WZX A;  4FI9 A;  4AWD A;  4JV4 A;  1GAN A;  5HV4 A;  2QQJ A;  3HN1 A;  1HRV 2;  5DAW A;  1BEV 1;  4LK6 A;  1DYO A;  3D8C A;  2DBN A;  3J9S A;  1XOY A;  1YQ2 A;  1Y43 B;  3O0W A;  4OI4 A;  4R9A A;  3RYR A;  2FBE A;  4IGQ A;  2C9K A;  1DGR N;  2VQA A;  4LIU A;  4NHK A;  3UES A;  2Z69 A;  1F5J A;  3N36 A;  4QPY A;  4NIA A;  4UBG A;  3RPQ A;  1VRB A;  4FPE A;  2G4I A;  5GLT A;  1R1A 2;  4M00 A;  2XQX A;  4ASM B;  2MEV 1;  5E1R A;  5GZC A;  1A8D A;  3ZPY A;  3LPG A;  4LBQ D;  5IQP A;  2HYK A;  4FFF A;  4UFJ A;  5FKC A;  5KXD A;  4YW5 A;  2QZ2 A;  1HXS 2;  2NMN A;  3AXE A;  4P02 B;  4D3W A;  1C3K A;  4X6R B;  3ZYJ B;  2A3X A;  4RS5 B;  4QDS A;  3UKT A;  4MHU A;  1FNZ A;  3I2K A;  3OBR A;  1R09 2;  3VD9 A;  3HBZ A;  5I8S A;  3R6S A;  1YHF A;  1VBA 3;  2PAE A;  1PO2 3;  2K46 A;  1QNW A;  1D2Q A;  1F4A A;  3H1W A;  1GZT A;  1RUH 3;  4BG6 A;  2DCT A;  1EV1 3;  2E9Q A;  1TME 1;  1VBC 3;  3NV1 A;  1BZW A;  4BYY A;  4LK7 A;  5GZE A;  3ZXG A;  1ULG A;  2H0B A;  1LUL A;  2HWE 2;  3LQC A;  4JX0 A;  1JU3 A;  4DFS A;  5CFC C;  1JZ5 A;  4QKB A;  2GMM A;  3VLB B;  1FMD 3;  5EV7 A;  1RUH 1;  5M0T A;  4Q0Q A;  3HEI A;  1UOG A;  5D8A A;  5I91 A;  4XDP A;  2DCZ A;  2Y6G A;  2C74 A;  1OSG A;  4ARX A;  1IPK A;  5FO8 B;  4OLL A;  2VNG A;  5DAV A;  3M50 A;  3WG2 A;  4QU1 A;  5C70 A;  1NCQ C;  1PZ9 A;  2J1E A;  2WH0 A;  2A70 A;  1US3 A;  2WO1 A;  5FZE A;  3TWI A;  5IVC A;  2VW1 A;  3ST7 A;  3WHU A;  3ZXJ A;  1GBG A;  1ZRC A;  2BTP A;  4AGG A;  3GF6 A;  2O8Q A;  3PIJ A;  2QKD A;  4WVM A;  1J58 A;  1R09 3;  3MHR A;  1DP0 A;  2DUR A;  2YB7 A;  4XFA A;  3LLY A;  1SLA A;  4QXC A;  2E31 A;  3TOJ A;  3BTX A;  4QXK A;  3CMG A;  5FY9 A;  2NPI A;  4LOS A;  3ACI A;  4NID A;  5FMO L;  5EZW A;  1R09 1;  3OGR A;  3N4M A;  1OOP C;  4P9G A;  1UGY C;  2P6C A;  1UF2 C;  2HKX A;  5BNP C;  2BOJ A;  5GKA C;  3THD A;  5F39 A;  2R49 A;  4UWD A;  5JXJ A;  1OPM A;  3WDV A;  2VZV A;  3IPV A;  3N7J A;  1SFN A;  1WS4 C;  4AW7 A;  4YW1 A;  3ELN A;  4BK5 A;  3ATG A;  4LOR A;  2JKX A;  3O0X A;  4NMI A;  3ZFG B;  1UKG A;  2RR1 1;  4P14 A;  3POY A;  1AYN 1;  1TOQ A;  2FCT A;  3AZZ A;  2DFB A;  3POS A;  5EJ3 A;  4DHS A;  4TXW A;  5FZG A;  3WG3 A;  4CXY A;  5LBE A;  2XL7 A;  2DYC A;  4AVB A;  1GOG A;  2JG8 C;  2JB8 A;  2R1B A;  4P9X A;  5K8S A;  1NUK A;  3LGR A;  1ZVF A;  5IUQ A;  4BOW A;  2VOK A;  4IEX A;  1HKD A;  1ASJ 1;  2JIC A;  1POV 1;  4HVO A;  4LBJ A;  3RI8 A;  1LOC A;  2WS9 3;  2XML A;  3WP6 A;  2VMF A;  5F2W A;  2GND A;  2VUA A;  4MG2 A;  1Q8Q A;  1DZQ A;  1JOD A;  3PUS A;  5JM1 A;  2O0O A;  2W0X A;  4G9S B;  3D82 A;  3MIF A;  2B5H A;  5F5A A;  2FMD A;  3DKW A;  1M26 A;  2JZ4 A;  1ULC A;  4Y26 A;  2DCJ A;  5JOY A;  4OHZ A;  5FZ0 A;  4MGK E;  4YZ4 A;  2JDK A;  4V1P A;  4IDZ A;  4A6S A;  5BNP A;  4PLM A;  3RZK A;  1JH5 A;  2GNM A;  3E5Q A;  4N53 C;  4XQD A;  1VBP A;  1W9S A;  2VQT A;  4AQ2 A;  3P1R A;  2VGD A;  3AYE A;  5JOX A;  1OMI A;  2VOX A;  3WF2 A;  3WF3 A;  3VKO A;  1GNH A;  3T0B A;  1BLZ A;  2RM2 1;  1LHN A;  4YG3 A;  1U5X A;  2UY9 A;  3CJI B;  4HKO A;  3AKP A;  2UWC A;  4OUE A;  5LEJ A;  2O02 A;  3WW1 A;  3A0N A;  2BR9 A;  5CFD C;  1JZ4 A;  2ET7 A;  1CZS A;  5LEK A;  5J09 A;  1PZ8 A;  3GBF A;  5F32 A;  1G9B A;  3I4I A;  1ZBE 2;  4F8A A;  2CL2 A;  4J1X A;  5FBZ A;  2EA7 A;  2FCV A;  2VZQ A;  4I3G A;  4AVA A;  2ZHK A;  2VG9 A;  3ZYG A;  3P3N A;  1LB2 A;  3JCI A;  2RMU 3;  4MVT A;  4CRQ A;  1MS9 A;  3O1U A;  3NVC A;  4QDR A;  3DV8 A;  1PX3 A;  2GC3 A;  4G4F A;  4X8N A;  4IV1 B;  2VQ0 A;  2ZGN A;  3PDQ A;  4BM8 A;  1J83 A;  3RGB A;  2NPM A;  1BYH A;  1W2A X;  5BNO C;  4AR2 A;  2XB6 C;  2X05 A;  3WNO A;  4XFH A;  1AF9 A;  1RXG A;  2QJV A;  1F4H A;  2WA4 A;  5FPA A;  2Z79 A;  3LA7 A;  1VMF A;  4L11 A;  2W1U A;  4UFI A;  4QPI A;  3RDH A;  1DU3 D;  5ACA 1;  3IBM A;  5KR7 A;  2Y0O A;  4LUK A;  3LEG A;  2XOM A;  2ZX0 A;  2GU9 A;  1M06 G;  4DHO A;  2IXK A;  4A7Y A;  4BME A;  1IS4 A;  4KL1 A;  4LJH A;  4XHX A;  3KCX A;  3PUI A;  4UAP A;  5F37 A;  1AXY A;  1QOO A;  2FQP A;  4FO9 A;  1XYO A;  4UFK A;  1CVN A;  4YGE A;  3LSD A;  3ZXL A;  5FZD A;  3KCC A;  4MHR A;  3DYP A;  2ZA9 A;  1ZA4 A;  1VBE 2;  3AVR A;  1ZRD A;  2H6B A;  5LAT A;  1DQ2 A;  3Q8B A;  1RVF 2;  1XXN A;  4QKN A;  1NG0 A;  4UW6 A;  3WNM A;  4Q0P A;  2BQ0 A;  5D2D A;  3WCS A;  3DUI A;  2DCK A;  4JGZ C;  1FV2 A;  4XQ4 A;  1S0G A;  3GBG A;  5A32 A;  4IHL A;  3P8S A;  3M2M A;  4EN6 B;  4AVT A;  1W99 A;  4FR3 A;  2ZGS A;  4NPL A;  1TVG A;  3TEY A;  3S30 A;  5A6Z A;  2HBU A;  1H8T C;  5IAV A;  2E7Q A;  3MPP G;  5T54 A;  4DXT A;  4RL7 A;  3H9A A;  1J3P A;  2VME A;  5FV3 A;  1DQ6 A;  5L73 A;  5GZD A;  5DZG A;  1IOA A;  5FYZ A;  2Q1F A;  1QJA A;  2P3K A;  2YYO A;  3H42 B;  4L0P A;  4A42 A;  2Y33 A;  2GNB A;  4KU7 A;  2DDU A;  3RMX A;  5BNP B;  2AZ5 A;  1A78 A;  2CSG A;  5DAX A;  3VZO A;  3ZX7 A;  3CJX A;  1C28 A;  2GAU A;  1VBD 2;  1VMH A;  5FZ3 A;  4ONU A;  3RVH A;  1GLH A;  3KGL A;  5K0U B;  1UZW A;  3S5A A;  5J98 B;  1QXP A;  4URT A;  1UX6 A;  4BLI A;  1J59 A;  2YU1 A;  3KVB A;  2IXC A;  1D7P M;  3CEW A;  1U5I A;  3T0A A;  4R6R A;  3JD7 2;  3VBF A;  1PVC 2;  1H9W A;  2AH2 A;  5H9P A;  3SH3 A;  1B35 B;  1NLR A;  3VZL A;  1LES A;  5C8C B;  5IFP A;  2Q8D A;  3UZD A;  2WQ8 A;  3ZIX A;  2GC1 A;  4Q29 A;  1QJU 3;  4Z1V A;  5BXX A;  4Y32 A;  5JWP A;  3GGL A;  4K21 A;  3AKS A;  2YC0 A;  1XU1 A;  1YI9 A;  4GH4 A;  4GWJ A;  2HBT A;  1DHK B;  1PO1 2;  1UW8 A;  1CJP A;  3WOB A;  2A6X A;  2G19 A;  2RS3 3;  1HXS 1;  1A37 A;  2A5Z A;  3GHM A;  3VBS B;  4CDX A;  2R04 1;  2WYF A;  2WL1 A;  1UGX A;  1JHN A;  1W90 A;  3I2J A;  4MGS A;  1W04 A;  4GXL A;  3I3Q A;  4FTE A;  3EBR A;  3AP4 A;  1WGP A;  4E8C A;  4M0N A;  2VOT A;  4BIO A;  4I09 A;  1RMU 3;  3O1O A;  1AYN 2;  3VN4 A;  5F6L B;  3PJY A;  1YFX A;  4IE4 A;  4B4Q A;  4UW3 A;  3LFI A;  3M1H A;  4XJ8 A;  5FY1 A;  1RUF 2;  5CYY A;  3KD4 A;  2CGP A;  1V6M A;  1N1Y A;  1UZY A;  2BWA A;  2CY6 A;  2C1F A;  3OBZ A;  3S6P A;  3V0B B;  1SMV A;  1PMI A;  5A7W A;  1W0P A;  4L97 A;  4R9D A;  4ZPI A;  4HVQ A;  2D7F A;  2JDU A;  4D0Q A;  4LHS A;  1CJD A;  2B42 B;  1NA1 A;  4AI0 A;  1OUR A;  1RUJ 1;  1YFU A;  2D6P A;  2XJU A;  1Q8S A;  3LKJ A;  4QHZ A;  3R05 A;  4ZU4 A;  2YHJ A;  3LIG A;  1KQR A;  3LE0 A;  3SKJ E;  4FPH A;  3KS7 A;  4ZU5 A;  3AP6 A;  2I2S A;  2GAL A;  2C1J A;  3ME2 A;  3C7H A;  1YCI A;  5A33 A;  1FOD 2;  2BJS A;  4LLO A;  4AKC A;  4QGM A;  4QKD A;  5JMC A;  4FQ4 A;  3LAG A;  1VB2 A;  1JXN A;  2VEC A;  3POI A;  2NP0 A;  4W8J A;  1VP6 A;  1W8Z A;  1AR6 1;  3OY8 B;  3VDB A;  3E1F 1;  2JJ6 A;  4QM8 A;  2W92 A;  4I0B A;  5FPB A;  5FZK A;  1A3K A;  4AQT A;  4CCN A;  1H2K A;  3A23 A;  3QD6 A;  1VMO A;  4NOT A;  5ABJ C;  1LKN A;  1LAJ A;  3BOD A;  4KG0 A;  2OZJ A;  1VBB 3;  4E4D X;  2YPJ A;  3LFM A;  3MUY 1;  2RHP A;  1T2X A;  4XMI A;  1JZ8 A;  5C4W B;  3PTR B;  3CKH A;  2VU9 A;  4B4P A;  3IWZ A;  1OUS A;  5A3M A;  4D8M A;  5LWB A;  1G7Y A;  1NZI A;  1H4G A;  1SAC A;  1ULE A;  2DF7 A;  5FMC A;  5FYB A;  3P1P A;  5LBB A;  5JI9 A;  1UN1 A;  1J4S A;  1RGS A;  2A3W A;  3T2O A;  1IQA A;  1X50 A;  2XR4 A;  1YQ6 A;  1AR8 1;  3ACG A;  3SLI A;  3NO8 A;  2BNO A;  2AEN A;  4XF9 A;  3P1Q A;  3VBH B;  2RS5 2;  4H7M A;  2BYV E;  3WF1 A;  1NYW A;  3MYX A;  3MBW A;  3T2T A;  4Q26 A;  4QPI C;  3I2G A;  3N7M A;  3OD0 A;  1XU2 A;  2AR6 A;  3CJI C;  2B7Y A;  1V9U 2;  4C0H A;  3UX0 A;  1FPN 2;  1ST8 A;  2R16 A;  4FAH A;  3HQX A;  3J7H A;  2JE7 A;  4XFG A;  3ENR A;  3P6B A;  4M4P A;  3H1Y A;  4QLI A;  5C3R A;  2PLV 3;  3ZR5 A;  2C24 A;  4W65 A;  4MET A;  4RR3 B;  5JVV A;  1L7L A;  3WW2 A;  4FJ3 A;  4GAZ A;  2CAU A;  4XIK A;  2OKX A;  4NIG A;  4DHQ A;  3K77 A;  3NV2 A;  1JS9 A;  3D4K A;  3WIN E;  3CIH A;  3N9P A;  5BNO A;  5DAQ A;  5DMY A;  1TEI A;  4AQ6 A;  1YFW A;  1R08 2;  3ZVX A;  4KNC A;  4ASK A;  3O1S A;  2E7A A;  3WP5 A;  1W6Q A;  1IKP A;  2VAU A;  2VOV A;  1R1A 3;  2FHR A;  2VE1 A;  3AP7 A;  2WJS A;  3VD3 A;  2HWF 2;  4HL0 A;  1PMJ X;  5DUV A;  2HEY F;  4GWN A;  1C4R A;  2VNO A;  4HXC A;  4WRQ A;  5EYX A;  2E7T A;  2E53 A;  4RQP C;  1YXW A;  3SCF A;  3IDA A;  2AEZ A;  5LY2 A;  4GA9 A;  4K20 A;  5FWJ A;  4IV1 C;  2QQU A;  3TYJ A;  1WLD A;  1RUF 3;  1AR9 2;  1O8P A;  2ZEX A;  3TBD A;  1F9K A;  2VNV A;  3K3N A;  3SIT A;  1L3J A;  2D5F A;  1ONA A;  1RUJ 2;  1X33 A;  4IV3 C;  1Q56 A;  4LHL A;  2YC4 A;  4LIT A;  5DPN A;  1SBD A;  3VHR A;  5CKN A;  2VBP A;  5FP3 A;  1HQW A;  2BOI A;  1DYP A;  2RDQ A;  2ZX3 A;  5F74 A;  1KDK A;  2ETE A;  3BGA A;  3BIW E;  3K46 A;  1YI7 A;  5G05 L;  4OI0 A;  3ON7 A;  1OKO A;  4A45 A;  1Q43 A;  2JEM A;  2RMU 2;  2JD9 A;  1X8M A;  2WFF 3;  1DDL A;  4ISR A;  1WCS A;  5A33 B;  5LU1 A;  4CEW C;  5T52 A;  3ZYP A;  5LRS A;  3ACF A;  1EUU A;  5FZH A;  4JKL A;  4MUV A;  5FIX A;  5FOB B;  2DCY A;  3GM8 A;  4LE4 A;  4PQQ A;  4Y3O A;  5A7P A;  5IVF A;  1J1T A;  4LEJ A;  2W39 A;  3WG4 A;  3W5M A;  1JYC A;  4MV2 A;  4A2U A;  4I0A A;  1JN2 P;  2DTY A;  2JKB A;  3PUQ A;  5E16 A;  1W6P A;  2CYF A;  4DNK A;  1CAU B;  1UH1 A;  4YPJ A;  1HB3 A;  3BKZ A;  1OXC A;  4KQ7 A;  5CNA A;  4OI1 A;  4CP9 B;  4FPK A;  4XUO A;  4B1L A;  3U4S A;  1VBB 2;  3TEW A;  1RHI 3;  1O91 A;  2GMP A;  3VB9 A;  2XUE A;  3N9Q A;  1JYW A;  3OUH A;  4CCC A;  1WBF A;  1COV 3;  1OF4 A;  2LRP A;  4P00 B;  3INA A;  4BQ3 A;  1NCQ A;  1URX A;  2XBO 2;  3WNP A;  4QPW A;  1SPP A;  5D21 A;  1RB8 G;  1L7R A;  4NJ4 A;  1H8T B;  2XHK A;  3THC A;  4EZ4 A;  3MLL A;  3WNL A;  1W8T A;  4HET A;  1HB4 A;  1LHV A;  4Y1U A;  3MIE A;  4XTP A;  5CG8 A;  1DQ4 A;  1SZB A;  1W8N A;  3LCP A;  4FPG A;  4PIZ A;  5IVY A;  3I3M A;  4R6Q A;  3EJK A;  1W2O A;  4I01 A;  1H8T A;  4KI5 M;  4UW5 A;  4CUA A;  1O3Q A;  2R06 1;  5CVR A;  4P9J A;  4QQP A;  1J3Q A;  2EIC A;  4B4R A;  4FT8 A;  1ZA7 A;  2CHH A;  3ZOI A;  3FHQ A;  1I1E A;  3I4R A;  2L9L A;  4PBO A;  1V9U 1;  5EJ1 B;  3VBS C;  1Y7B A;  3O14 A;  1UYY A;  1QJE A;  4XAC A;  1CZV A;  5C8W A;  1V6L A;  3SEP A;  1W9W A;  4JGY B;  3NW4 A;  4PIY A;  1Y9M A;  1S1A A;  2IVJ A;  2QQO A;  2BER A;  3EMR A;  4XJA A;  4AVC A;  4P9Y A;  1G9C A;  2IFW A;  3G6J B;  5DZF A;  5FXZ A;  1AR7 3;  3IZO A;  3APA A;  2D6K A;  3WCR A;  3ZXK A;  3SP5 A;  1LGC A;  1JOT A;  3LPF A;  1DLL A;  1AVB A;  1RUI 2;  1C8M 1;  2JDM A;  1BK0 A;  3W21 A;  4Y20 A;  2W87 A;  3WZ1 A;  1GWK A;  2GUD A;  1PGL 1;  5IFT A;  1UMZ A;  1UY0 A;  3IN9 A;  5J51 A;  2R07 2;  5L7O A;  2FDJ A;  4LBQ A;  4I02 A;  1W6N B;  4Y1Y A;  1BMV 1;  1DGL A;  1J4T A;  1WS5 C;  4YZ5 A;  3O1T A;  2ARB A;  4LT5 A;  4FSJ A;  4DRR A;  4AK3 A;  1W2T A;  4IV1 A;  4TN7 A;  1QKQ A;  4XFC A;  3CJI A;  4JRL A;  4N7G A;  5FRA A;  3T4H B;  3ZFF A;  3R51 A;  1UAI A;  3Q8A A;  1UNB A;  2WN3 A;  1ENS A;  5K7P A;  1W6N A;  3J7L A;  4ZON A;  2WZP P;  3NNL A;  4PJY A;  2VXJ A;  3PIG A;  3V65 A;  3VDC A;  3T1L A;  1LR5 A;  2GH2 A;  5BPX A;  3MHZ A;  1EUT A;  1A4O A;  5DXD A;  4XFF A;  4O61 A;  2WII B;  2QDN A;  3NKX A;  1QQP 1;  1DCS A;  3AMN A;  2XDV A;  4XMA A;  3O1V A;  1JHJ A;  3IQJ A;  3DPR A;  4XZU G;  3RZM A;  4B3N A;  3E6Y A;  4WOG A;  4ZS2 A;  2QNK A;  3NJZ A;  2V7D A;  5JR7 B;  4H2A A;  5BNN A;  3KT4 A;  5CKM A;  3III A;  2R06 2;  4YRD A;  1ND3 C;  4HFS A;  4DXS A;  2XJQ A;  4UF0 B;  5C9A C;  4QPG C;  5C5U A;  4R52 A;  3ASI A;  3CLP A;  3OB8 A;  2R06 3;  4FOY A;  4LPL A;  3SXW A;  3URF A;  3WVJ A;  2ERF A;  2VTF A;  5L7O C;  4RQP A;  1LED A;  2XJS A;  5FUN A;  1UY2 A;  5J50 A;  5FUP A;  1C8N A;  5L9R A;  1J3R A;  1RMU 2;  2WO2 A;  3B93 A;  2DV9 A;  1MPX A;  4AED A;  1FMD 2;  4R6O A;  5EYY A;  4YM3 A;  2A6Z A;  4DXR A;  3H1M A;  3V56 A;  1D4M 3;  3D0S A;  3UGF A;  4B7K A;  5A7O A;  1SLT A;  1ZGS A;  2P3J A;  1IHM A;  4MLO A;  4E9K A;  1ULP A;  2DBI A;  4YGD A;  5IAT A;  1QJU 2;  3H50 A;  4GMP 1;  5DDJ 2;  1PVC 1;  1GSL A;  3K51 A;  1EV1 1;  2WIN B;  3FFQ A;  4XUP A;  4NRM A;  3GZU C;  1H4H A;  3WQ1 A;  3J8F 1;  4FBF A;  1V6N A;  5C7G A;  2R07 3;  2ZAC A;  3FMG A;  4IW3 A;  4AAX A;  3I2D A;  5LA2 A;  1IG3 A;  5GJ6 A;  1FNY A;  2VZP A;  4FPO B;  4IEP A;  3DEC A;  5EWS A;  1ZRI A;  4A41 A;  1V6K A;  1S0D A;  2J1U A;  5C8C C;  1WME A;  1CPN A;  5E88 A;  3M3C A;  5KBF A;  5CG9 A;  5J4X A;  1CAW B;  5JSP A;  1OVS A;  2PHL A;  1XYN A;  2ZXQ A;  4RHV 2;  1CQ9 A;  4LKF A;  2HWE 3;  4PF5 A;  4AHZ A;  1D4M 2;  2WYS A;  5F3G A;  4XCA A;  4NRP A;  4AAP A;  1TMF 2;  2YBS A;  2WNU C;  4IV3 B;  3DXT A;  4CCO A;  1BMV 2;  3FHI B;  1W9F A;  5D2A A;  1HRI 2;  3A22 A;  3M8L A;  4XUN A;  1OHF A;  1QQP 3;  1FV3 A;  4XPV A;  1W3X A;  3AZY A;  2EAL A;  2QZ3 A;  2O8P A;  4KWL A;  5FP9 A;  2ZHM A;  1ODN A;  2R7E B;  3IQU A;  4OFG A;  4GJY A;  4YVW B;  5ACA 2;  4IEQ A;  4HSJ A;  5LK5 A;  4E4Z A;  1VBE 1;  4OVE A;  3BI3 A;  1VRH 1;  4OHV A;  2HWF 1;  1D4V B;  1US2 A;  1YYN A;  4CEY B;  1RUE 2;  4W6Y A;  3IMN A;  4YM0 A;  3WQ0 A;  3WUC A;  1QHD A;  1OA2 A;  1RUC 3;  1XNA A;  3MW3 A;  4GMP 0;  2LUW A;  3IDC B;  4YG6 A;  3VBO B;  3ZN4 A;  1W0N A;  4JC3 A;  1QDO A;  2A3Y A;  3UGH A;  1H2M A;  2RDN A;  1UYP A;  3CQO A;  2UYA A;  4HPK B;  4KMQ A;  1XNB A;  4P5Y A;  4QB1 A;  4COY A;  3ABZ A;  3OPT A;  3VGI A;  4CXW A;  5JOZ A;  1YO8 A;  1R1Z A;  5J96 B;  1Y9Q A;  4XFB A;  5FZC A;  4AHY A;  4OMD A;  2ARE A;  1ACC A;  4RGG A;  4YW4 A;  2WC2 A;  4GH4 C;  5GAL A;  3UL2 A;  4DY3 A;  3HJR A;  5CA6 A;  5ABJ B;  1JYX A;  1GWL A;  3WUD A;  2RJ2 A;  5A7S A;  4JDN A;  2JG9 A;  2Z2S B;  3A7Q A;  4FP3 A;  2VZO A;  4QX2 A;  2D3R A;  3KZ4 C;  5FY4 A;  5IT6 A;  5FZA A;  1JBC A;  2HWB 2;  1URJ A;  3JXS A;  2GC0 A;  3NNM A;  3SCH A;  3CF6 E;  5DDJ 3;  5FZL A;  3GCW A;  1OBN A;  5A7N A;  3BN6 A;  2OT7 A;  4MXV A;  3FL7 A;  1OUW A;  2X10 A;  2YGM A;  3U1X A;  2GTY A;  3U14 A;  4DXZ A;  2IXL A;  1JOP A;  3C3V A;  3FHA A;  5DG2 A;  2WT1 A;  2E63 A;  3T4V A;  4WV8 A;  4AED B;  4PIK A;  1LGB A;  5FYU A;  2FCU A;  1YIF A;  2B05 A;  2PA7 A;  2UY8 A;  3P3P A;  3DXU A;  4JKK A;  1JUH A;  1L7Q A;  4PLN A;  3RWN A;  3ZO0 B;  4DZG A;  4AGV A;  2QQI A;  3ETP A;  3SMK A;  4DAT A;  5D3F A;  1OQ1 A;  1Q3E A;  2J1T A;  2UWB A;  2VCA A;  1NLQ A;  4YNI A;  1O9E A;  3ZSM A;  3HD8 B;  5A32 B;  1VPH A;  1VAL A;  1XNK A;  3QBQ A;  1NA1 C;  2D93 A;  1JUI A;  4QQ2 A;  4PDW C;  2DU0 A;  3KV4 A;  1K5M C;  1QJY 3;  4I3P A;  4U36 A;  3ACL A;  4JGZ A;  4XBQ A;  4IE7 A;  3UT0 A;  2C6S A;  1SLL A;  3IKW A;  3S7I A;  1T6B X;  5LW9 A;  4Q4V 1;  4Y24 A;  2F4L A;  1QF3 A;  4M0H A;  4DMI A;  1KU8 A;  2C63 A;  5CZK A;  3M3O A;  2FDK A;  4KU8 A;  3Q8C A;  5FZM A;  4AHW A;  1PXD A;  4RR3 A;  1BHG A;  2GME A;  5FYS A;  4O46 A;  2ZMN A;  1UH0 A;  4BDV B;  1EAH 1;  4JAA A;  3VBF B;  1G9F A;  1SFP A;  2ZGR A;  2OW4 A;  5HCF A;  3M3E A;  1F15 A;  2JD4 A;  2WZE A;  3P1I A;  4QX1 A;  1LRH A;  4Y5S A;  4B1M A;  5C6C A;  2WNE A;  1VBC 2;  1QEX A;  3J4U H;  4WM8 A;  2WSU A;  3HPN A;  1HRV 3;  4JDD A;  4DHT A;  3ECQ A;  4XBN A;  3BB6 A;  3WV6 A;  4LKD A;  1O8S A;  3RYK A;  3HAG A;  2XL9 A;  4NRQ A;  4XJW A;  2X5I C;  1KDM A;  4AQS A;  3O1P A;  4COU A;  2EVX A;  2JE9 A;  2IVI B;  5CFD B;  4CEY A;  5SV5 A;  3SH4 A;  5FP8 A;  3H0O A;  1W6M B;  2PHD A;  5CBL A;  5GLZ A;  1HRI 3;  2B8M A;  4RSU A;  3TNQ A;  2WZ8 A;  3ZFE B;  3H3L A;  3NST A;  1DG6 A;  1UOJ A;  5CIS A;  1QJX 3;  3FBM A;  3DEM A;  1UXX X;  4K8R B;  4OUL A;  3VHO A;  4AFD A;  3OUJ A;  4UW4 A;  1W6Q B;  4QX5 A;  4FP2 A;  4FXK B;  4L99 A;  1QU0 A;  5HXV A;  1ULF A;  3WNK A;  2N7G A;  4JVA A;  4E2E A;  1W9Y A;  3MPB A;  4JQT A;  1JYN A;  2OPW A;  2GUE A;  5AV7 A;  2ZGT A;  2V4V A;  4Y4R A;  5FY8 A;  2Y6F A;  4Z92 B;  2WT0 A;  1UY4 A;  4JGY C;  4XAE A;  3OGS A;  4YW6 A;  1CAX A;  1PO2 1;  1AZD A;  1NCR C;  1RUE 1;  4C1X A;  3HQU A;  2EXH A;  3EFZ A;  4LO7 A;  1QJB A;  4XCB A;  3GHN A;  3OGG A;  1PM4 A;  2RS5 1;  4F7R A;  2FZ2 A;  4GB3 3;  1O6U A;  1C3M A;  2P4E A;  3O12 A;  5D1I A;  5FFO C;  2ZPX A;  3NRU A;  3VL9 A;  5E6H A;  1X82 A;  3NV4 A;  1MS8 A;  2P3I A;  1DQ1 A;  2W9X A;  1HX6 A;  3SHR A;  4C0B A;  4LKS A;  4BB3 A;  3AQG A;  1ZBE 1;  2RR1 2;  2WKK A;  4OCT A;  5FBJ A;  1W03 A;  3JZV A;  2NLR A;  3K75 B;  3OGV A;  5FK7 A;  4Q2F A;  1H2N A;  2E32 A;  5J3U A;  1POQ A;  1W2N A;  1HDK A;  2ARC A;  3N9O A;  4LA2 A;  1SPP B;  5F1R A;  2NU5 A;  3PJQ A;  4K1Y A;  2YXS A;  1Z7S 1;  1O9F A;  3S5Q A;  1GQG A;  1RVF 1;  2BVB A;  5DUX A;  1K5M B;  3T1M A;  1C8M 3;  1E5S A;  2VZ1 A;  1VBO A;  5FAX A;  5BY5 A;  4NO4 A;  5IK5 A;  1RHI 2;  1NE4 A;  1DQ5 A;  1XSR A;  3ZMO A;  3RI9 A;  4RD7 A;  3RRD A;  2ET1 A;  3I3D A;  4N53 A;  5F8P A;  1XSQ A;  2ZKN A;  3GAL A;  4URA A;  1GR3 A;  4AG4 A;  1XE0 A;  2LS6 A;  4XIL A;  3T2P A;  2VUC A;  3ZSK A;  1VMJ A;  3I2F A;  2UWA A;  4XJU A;  5FZ9 A;  2F4P A;  1XXQ A;  4ZDR A;  5IAX A;  1UPI A;  1YUD A;  2NZ9 A;  1JW6 A;  5KHI A;  3B69 A;  3LD8 A;  2X53 S;  3GJA A;  3T0M A;  4LO4 B;  4COZ A;  4Y4Y A;  4E8D A;  3AC0 A;  3C7G A;  3P1S A;  1OOP A;  1OQE A;  5JCT A;  3VHN A;  5JXH A;  1UGY A;  1XB9 A;  1E57 A;  3ZFF C;  5JAX A;  3M3Q A;  1BVV A;  1CIW A;  3L2Y A;  3OCP A;  4XAA A;  3NJY A;  1NLS A;  4Q4X 1;  2X5I B;  1CR7 A;  3U10 A;  4LBO A;  3K4A A;  3GZA A;  3N9M A;  1W6M A;  5FO7 B;  2A1X A;  3POE A;  4LHK A;  1WCQ A;  4LO5 B;  1QMJ A;  4LMF A;  4LHN A;  4QGL A;  5FZ7 A;  4AFC A;  5KXC A;  4K7J A;  2FDG A;  1ALY A;  1UY1 A;  1WW4 A;  1OQD A;  1X9P A;  4FXG B;  4IXL A;  4ASL A;  4A7Z A;  4BIS A;  3OF1 A;  5CKQ A;  5DZE A;  3RZL A;  1XXR A;  1N3P A;  4RS5 C;  4OI2 A;  2X09 A;  3ZFG C;  4COV A;  3C2U A;  3GBW A;  3D3A A;  3E5X A;  1UYX A;  3H3U A;  2UYB A;  3KT1 A;  3X29 B;  1BXH A;  4MAD A;  4ZZ8 A;  4OUM A;  1AL2 2;  1RUO A;  4BQX A;  2D97 A;  4UT5 A;  2BFU L;  3I3E A;  3H7J A;  1X1V A;  3LF7 A;  1G8W A;  2GN7 A;  2O1Q A;  3SIS A;  4P9I A;  1AJO A;  5EQU A;  4BJ0 A;  2NYY A;  1SLB A;  4GAL A;  1IS6 A;  4IEV A;  4WZF A;  4BMB A;  2AYH A;  4CSW A;  5KHG A;  4NIH A;  4QB2 A;  2JDN A;  1S2B A;  4N8M A;  4DNY A;  2ORZ A;  3MIH A;  1PIV 3;  1JTZ X;  2Y6K A;  2YRO A;  4M3C A;  4S2D A;  5F3C A;  4OHW A;  1TG7 A;  5FMB A;  1K45 A;  1OH3 A;  2IWG B;  4EN0 A;  4LBQ B;  2AGS A;  3NKG A;  4E4H A;  3WW3 A;  1Q8P A;  3APB A;  2DTW A;  1ZNP A;  1TQ5 A;  5F3E A;  1KD7 A;  3ILN A;  3GXU A;  4WM8 C;  5IK8 A;  1UIK A;  2YFZ A;  3U07 A;  3RZJ A;  2WNU B;  1S0J A;  2Y6L A;  2O8O A;  4QPI B;  4S2H A;  2PEL A;  4MQ0 A;  4Y1X A;  3FJS A;  4PIF A;  1XYP A;  2ZX4 A;  3JBG 1;  2P3Y A;  1AUY A;  4IE0 A;  3D6E A;  4FOQ A;  2RR1 3;  3AMP A;  2YBP A;  1RYY A;  1FOD 3;  3I2O A;  1RIR A;  2W1S A;  1M4W A;  4RR3 C;  1MAC A;  1JZ7 A;  1S0F A;  1MZE A;  4FCA A;  2GUX A;  4O65 A;  5JOW A;  3KT7 A;  2LAL A;  3N3H A;  5GZG A;  4E2S A;  1B35 C;  2MEV 3;  4XAB A;  3SMM A;  3TEX A;  3ZYR A;  5I0S A;  4NPM A;  1XE8 A;  1ZBA 3;  3TAY A;  2W47 A;  3S0M A;  1RL3 A;  2GH8 A;  2HYX A;  1SDW A;  4NHM A;  5DUW A;  3FBY A;  1TMF 1;  4UF0 A; 
#chains in the Genus database with same CATH homology
 2V5D A;  1JYW A;  2W5F A;  4QAW A;  1IQD C;  1OF4 A;  4P00 B;  1CX1 A;  3A21 A;  3MV0 1;  5EJZ B;  3WNP A;  4QPW A;  2RVA A;  1L7R A;  5JMO A;  2Z4F A;  1OF3 A;  3THC A;  3VDA A;  2VCC A;  4CVU A;  1CZT A;  1H6X A;  3WNL A;  4W50 A;  4QX0 A;  5JXI A;  1W8N A;  1J84 A;  4KI5 M;  5IJR A;  1GUI A;  1HN1 A;  1XNT A;  4CUA A;  4QX3 A;  2J1R A;  1UYZ A;  2EIC A;  2KD7 A;  2W1W A;  3I97 A;  4FI9 A;  3FHQ A;  3OBA A;  4RYD A;  2L9L A;  5EJ1 B;  2QQJ A;  1UYY A;  1CZV A;  3SEP A;  1W9W A;  1DYO A;  4ET7 A;  2WN2 A;  1YQ2 A;  2QQO A;  2BER A;  2W95 A;  2C9K A;  3UES A;  3UNP A;  2WUH A;  1K3I A;  2J1A A;  3NQH A;  1K42 A;  1OD3 A;  2XQX A;  4GZ9 A;  4QB6 A;  3LPF A;  5LA0 A;  1NX9 A;  3LPG A;  1JZ6 A;  2W87 A;  2VJX A;  1O59 A;  3GDB A;  5B4N A;  5IFT A;  1UY0 A;  1PMH X;  5J1X A;  4P02 B;  3ZM8 A;  1W8O A;  4BXS V;  4QDS A;  3I2K A;  3VD9 A;  1UWW A;  2VZS A;  1F4A A;  2WN3 A;  3LQC A;  4JX0 A;  4ZXE A;  2VMD A;  1JU3 A;  1JZ5 A;  3VDC A;  1SHW B;  1GU3 A;  2YG0 A;  4A44 A;  1EUT A;  3HEI A;  5JUV A;  3NJX A;  2Y6G A;  3LEI A;  3VD7 A;  1JHJ A;  4ARX A;  4XZU G;  4TTG A;  2RV9 A;  4CU8 A;  5C70 A;  4XUR A;  2J1E A;  1US3 A;  3K4D A;  2WO1 A;  2VO5 A;  3III A;  1OH4 A;  3I2H A;  4DXS A;  5DN2 A;  3K4Z A;  3C7E A;  5LCW L;  2WBK A;  1DP0 A;  2Y6H A;  2YB7 A;  3OB8 A;  4LPL A;  2VTF A;  1JZ3 A;  1JU4 A;  2E31 A;  1UY2 A;  3CMG A;  2VM9 A;  2WO2 A;  3ACI A;  4M4R A;  3OGR A;  3WF4 A;  2WO3 A;  3T08 A;  1MPX A;  1JZ2 A;  3THD A;  4DXR A;  4QDQ A;  5JXJ A;  2VZV A;  4HG6 B;  4BK5 A;  1ULO A;  3SEE A;  1K12 A;  5A1A A;  2JKX A;  5B4X A;  2QQM A;  4UI9 L;  3MO4 A;  4DUX A;  4ZZ5 A;  1ULP A;  5I0D A;  4DEV A;  1OT5 A;  4TXW A;  4DUV A;  4XUP A;  1XC6 A;  1GOG A;  2ORX A;  1NUK A;  2J7M A;  5C7G A;  4DUW A;  3HOB A;  3I3B A;  4AAX A;  5LA2 A;  2VZP A;  3DEC A;  2VMF A;  4A41 A;  4A3Z A;  2J1U A;  2ZEZ A;  2ZEW A;  3MV1 1;  2W1Q A;  4CU9 A;  2ZXQ A;  2DCJ A;  1UZ0 A;  2WYS A;  5FUI A;  2WDB A;  3OEA A;  2QQN A;  2Y8K A;  4XUN A;  3A22 A;  2B9V A;  1W9S A;  2VQT A;  3UET A;  2R7E B;  3WF2 A;  3WF3 A;  4UOJ A;  3T0B A;  4PT6 A;  4OMC A;  4OUE A;  1GOF A;  1US2 A;  1JZ4 A;  3HNM A;  4JHZ A;  1CZS A;  3T2Q A;  1XNA A;  2VC9 A;  5G04 L;  4XUQ A;  1W0N A;  2VZQ A;  4KMQ A;  3CQO A;  4QB1 A;  4P5Y A;  3ABZ A;  3C7O A;  1NKG A;  5DQ0 A;  4QDR A;  4OMD A;  4LQR A;  1PX3 A;  1JYX A;  3WQB A;  3HJR A;  1J83 A;  2RJ2 A;  5EIY B;  1GOH A;  1PX4 A;  2C26 A;  3EB7 A;  3A7Q A;  2VZO A;  2X05 A;  3WNO A;  4QX2 A;  5JXG A;  2EIE A;  2W3J A;  3JXS A;  3W5N A;  1UX7 A;  1F4H A;  3BN6 A;  2W1U A;  4OYU A;  3FL7 A;  3VD5 A;  2X10 A;  3FHA A;  3LEG A;  4GWI A;  2XOM A;  3SKV A;  4JKK A;  3PUI A;  4UAP A;  3T0D A;  1L7Q A;  3ETP A;  2QQI A;  3WSO A;  2E26 A;  2J1T A;  2VCA A;  3CZU A;  3DYP A;  4IUG A;  3WEZ A;  4CU7 A;  1JYV A;  3WNM A;  2QQL A;  3IAP A;  2VR4 A;  2WAB A;  4DEQ A;  2BGP A;  2DCK A;  1CIY A;  2QBX A;  2J1S A;  1DLC A;  3OG2 A;  3HN3 A;  1W99 A;  1R64 A;  4ZY9 A;  5HPO A;  1TVG A;  5CZK A;  2VZ3 A;  1KEX A;  4CUB A;  4DXT A;  1BHG A;  2VME A;  4A42 A;  4BDV B;  4L0P A;  2CDO A;  4P08 A;  2DDU A;  4XUT A;  2WZE A;  3P1I A;  4QX1 A;  2ID4 A;  1SG3 A;  1UXZ A;  4MOA A;  3HPN A;  1D7P M;  3T0A A;  3ECQ A;  2C4X A;  1O8S A;  5IFP A;  2B4K A;  3MUZ 1;  3U37 A;  2WQ8 A;  4OZO A;  4CU6 A;  4W4Z A;  3HNY M;  3GGL A;  4GWJ A;  2ZEY A;  2XON A;  2WZ8 A;  5C71 A;  3DYM A;  3NNG A;  4A6O A;  1UXX X;  2W91 A;  3OEB A;  1NAE A;  2E33 A;  2VCB A;  4MGS A;  3I2J A;  2WAA A;  3EYP A;  4E8C A;  2WAO A;  3WNK A;  3X0U A;  2J22 A;  2VOT A;  1JYN A;  4ARY A;  4RN5 A;  2VQU A;  2V4V A;  1UMH A;  1GNY A;  1UY4 A;  4CUC A;  3OGS A;  3C7F A;  5CYY A;  2LW8 A;  2VMC A;  2VZR A;  4D0Q A;  1I5P A;  2HLE A;  3NRU A;  4LHS A;  3CDZ B;  5LA1 A;  2W9X A;  2QQK A;  1P8J A;  3LE0 A;  4LKS A;  3FN9 A;  3SKJ E;  3C7H A;  2JE8 A;  5IHR A;  3K75 B;  3IAQ A;  3OGV A;  2E32 A;  2JDA A;  3PUH A;  4W8J A;  4Z2A A;  4JKM A;  4BK4 A;  3VDB A;  3E1F 1;  1UMI A;  3WNN A;  3I2I A;  2W92 A;  3A23 A;  2VZ1 A;  4PF1 A;  3MUY 1;  3I3D A;  1KGY A;  1T2X A;  1JZ8 A;  5IYY A;  4AG4 A;  3WF0 A;  2LS6 A;  3C8X A;  3CKH A;  4D8M A;  3ACH A;  2EID A;  3T2P A;  3I2F A;  3T2O A;  3CZJ A;  3ACG A;  2CDP A;  4E8D A;  3WF1 A;  3AC0 A;  1W9T A;  3C7G A;  5JXH A;  3MBW A;  4MO3 M;  3I2G A;  4XVH A;  2XHN A;  3J7H A;  4M4P A;  3P6B A;  5JR2 A;  3VD4 A;  2Y6J A;  3HNB M;  3K4A A;  1XPW A;  2OKX A;  1WCQ A;  3K77 A;  1WKY A;  3LEK A;  3CIH A;  1UY1 A;  5DMY A;  3NJV A;  3IB3 A;  2W94 A;  2X09 A;  3D3A A;  1UYX A;  5F7U A;  4MAD A;  4ZZ8 A;  3VD3 A;  1GQP A;  1PMJ X;  3I3E A;  2J1V A;  4BJ0 A;  2PQS A;  4A4A A;  3IDA A;  4QB2 A;  2ORZ A;  2Y6K A;  1O8P A;  2ZEX A;  1TG7 A;  3T09 A;  1K45 A;  5DPN A;  2BZD A;  1GMM A;  1SDD B;  2YC4 A;  2BBA A;  3BGA A;  3K46 A;  5G05 L;  3GXU A;  4A45 A;  2YFU A;  2YFZ A;  2EIB A;  2JD9 A;  2Y6L A;  3ACF A;  1EUU A;  4KWU A;  2VZU A;  4JKL A;  2VL4 A;  1RYY A;  3GM8 A;  1UY3 A;  2W1S A;  4PQQ A;  2W46 A;  1JZ7 A;  2V72 A;  3W5M A;  3DYO A;  1JI6 A;  1LNS A;  5HXM A;  2BGO A;  1H6Y A;  4YPJ A;  2W47 A;  4XUO A;  2Y64 A;  4MGQ A;  2HYX A;  2YC2 A;  2VZT A;  3F2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...