1CIYA

Insecticidal toxin: structure and channel formation
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
577
structure length
577
Chain Sequence
YTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPSTIYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTNLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYIA(A)
publication title Bacillus thuringiensis CryIA(a) insecticidal toxin: crystal structure and channel formation.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Toxin
total genus 182
structure length 577
sequence length 577
ec nomenclature
pdb deposition date 1995-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00555 Endotoxin_M delta endotoxin
A PF03944 Endotoxin_C delta endotoxin
A PF03945 Endotoxin_N delta endotoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.190.10 Mainly Alpha Up-down Bundle Delta-Endotoxin; domain 1 Pesticidal crystal protein, N-terminal domain 1ciyA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1ciyA03
2.100.10.10 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Pesticidal crystal protein, central domain 1ciyA02
5IHRA 3HN3A 2VCBA 1OF4A 5EIYB 4M4RA 2R7EB 3F2ZA 1D7PM 1JZ4A 2W9XA 5JMOA 3SKJE 4DXSA 4D0QA 1WKYA 1GQPA 3NNGA 1UXXX 2WZEA 2X10A 3T2QA 4A3ZA 4ZXEA 3AC0A 3CDZB 1TG7A 3OGVA 3LPFA 2ORZA 2WUHA 3C7GA 4QAWA 3VD4A 2YG0A 4L0PA 4XUTA 3T2OA 1UX7A 4ARYA 3K4ZA 1UYYA 4GWJA 2VOTA 3J7HA 2CDPA 4CUCA 1SHWB 2J1AA 1UZ0A 1JHJA 4BDVB 2JE8A 3HEIA 3NRUA 1EUTA 2W3JA 4FI9A 2EIBA 4PQQA 2RJ2A 5G05L 1JZ2A 2QQOA 5F7UA 3OG2A 1UY3A 2BBAA 4JKLA 3WSOA 2ZXQA 4P00B 4OMDA 4KI5M 4QX3A 3GXUA 2WN2A 2WYSA 1PX3A 1F4HA 2VCAA 1US2A 5IJRA 4RYDA 4BXSV 3WF2A 1MPXA 3A22A 3I2GA 1CZVA 5LCWL 3T0AA 1UYXA 1NUKA 3C7HA 2QQIA 4UAPA 3BGAA 3T0DA 3WQBA 5FUIA 3LPGA 2VL4A 2OKXA 1GOHA 4A45A 2C4XA 2DCJA 3I2KA 4ZZ8A 1PMJX 2Y6GA 1UMIA 3MV11 2B9VA 2JD9A 1SDDB 1XNAA 5C7GA 2EIEA 3BN6A 2E32A 4MGSA 1XC6A 4UI9L 2ZEYA 4OUEA 4CU7A 2EICA 3MV01 3CZJA 2QBXA 1K12A 1UXZA 3FN9A 3DECA 4ZY9A 3HNYM 3X0UA 4DUWA 2E33A 5JUVA 2KD7A 4ARXA 2EIDA 4MO3M 1OF3A 2YB7A 4HG6B 2W91A 2Y6LA 1JU4A 5IFPA 3UNPA 2YFZA 4QB6A 3EYPA 4LKSA 4DEQA 2RVAA 1W9SA 1K45A 5G04L 1H6XA 1W99A 3T09A 2DDUA 4IUGA 3GGLA 4LPLA 3A23A 2VZPA 3I3EA 4CVUA 3OGSA 5CYYA 2YC2A 2J1VA 2WO3A 3FL7A 3CIHA 4W8JA 4ET7A 3ZM8A 1DP0A 3IIIA 5LA1A 1NAEA 4JHZA 3LEKA 4XUPA 1CIYA 4QDQA 3WF1A 4QDRA 2J1SA 2VZ1A 1JZ5A 1CX1A 3WF0A 4ZZ5A 4JKMA 3VDAA 4QX0A 2DCKA 4E8CA 4XVHA 4TTGA 3K4AA 1UY4A 3OB8A 1JYWA 2X05A 5B4NA 3NQHA 1KGYA 3IAPA 2W46A 1UMHA 2WAOA 2VQTA 3CQOA 3EB7A 2QQJA 3CKHA 4BK5A 1OD3A 4QDSA 3NJXA 2WO2A 2BERA 1K42A 2LS6A 3NJVA 3DYMA 3MO4A 4LHSA 5I0DA 3U37A 2Y6KA 3T2PA 5HPOA 2X09A 1UWWA 2B4KA 3PUIA 5JR2A 4BK4A 1GNYA 4QB1A 2Y64A 1J84A 2BZDA 3LE0A 1HN1A 3I3DA 3IAQA 1P8JA 2VM9A 2W92A 4CU8A 5EJ1B 3OEBA 3SKVA 4E8DA 4DXTA 1F4AA 3DYOA 3LEGA 5A1AA 1W9WA 4XURA 5J1XA 2V72A 2E31A 3HJRA 5JXJA 4QPWA 2HYXA 3WNKA 2QQKA 3D3AA 1JYXA 2WZ8A 3VDCA 3T08A 3W5MA 5B4XA 2WAAA 3ACFA 2JDAA 2W47A 2E26A 3FHQA 2VTFA 3ABZA 4OYUA 2W1SA 1SG3A 2W1UA 5DPNA 2XHNA 2C26A 2VZTA 2VC9A 3GDBA 4CUAA 1W0NA 5C71A 3ACHA 2VMCA 1IQDC 2W5FA 1UY1A 3P6BA 3K75B 2W95A 2J7MA 2BGOA 3C8XA 3WEZA 2YFUA 3WNPA 5HXMA 1XPWA 4XUNA 2WDBA 4QX2A 2RV9A 5DQ0A 1PX4A 4XZUG 3ECQA 5LA0A 1OH4A 4A4AA 3WNOA 4A6OA 3K77A 1J83A 4A42A 2W87A 1WCQA 1CZTA 2VZSA 1L7RA 2QQMA 3A7QA 3CMGA 3JXSA 1O8PA 3MUZ1 2QQLA 3T0BA 3K4DA 2V5DA 1LNSA 1GMMA 1BHGA 1W8NA 1JZ8A 3DYPA 2V4VA 3I97A 4A44A 2BGPA 5C70A 4QX1A 1DLCA 3UESA 1OT5A 2J1UA 3WF3A 1ULPA 2QQNA 2VR4A 2CDOA 3I2HA 3W5NA 4A41A 2VZVA 4DUXA 2WO1A 2VCCA 4KMQA 4CU9A 2C9KA 2XOMA 3K46A 4JX0A 3HOBA 4OZOA 4Z2AA 4D8MA 1K3IA 1W9TA 3C7EA 4P02B 1JZ3A 1JU3A 4DUVA 1I5PA 1UYZA 3VD9A 1GU3A 4PT6A 3UETA 1JYVA 3I3BA 5LA2A 4XUQA 1JI6A 3LEIA 3ACGA 4YPJA 3OBAA 2VZQA 3WNMA 1UY0A 2WABA 3MBWA 2ORXA 4W50A 1KEXA 2Z4FA 2VZRA 4W4ZA 1L7QA 3A21A 4CU6A 2LW8A 2VMDA 2J1EA 4M4PA 3THCA 1EUUA 4P5YA 3LQCA 5JXHA 1XNTA 2JKXA 1UY2A 4OMCA 2VJXA 1YQ2A 1O8SA 5DMYA 3HNBM 5JXIA 2ZEZA 3WNLA 3I2JA 5JXGA 1JZ7A 4GZ9A 1DYOA 2VO5A 4GWIA 2YC4A 4UOJA 4KWUA 3IB3A 2WQ8A 3OEAA 4MADA 1CZSA 3IDAA 1GOFA 3C7FA 1H6YA 2Y6JA 4JKKA 4XUOA 2W94A 3GM8A 4BJ0A 5IFTA 3OGRA 1PMHX 3MUY1 3CZUA 2XONA 3SEEA 1T2XA 1W8OA 2VMEA 2VQUA 2Y6HA 2L9LA 2WBKA 1NX9A 3THDA 1O59A 3VD3A 2VZOA 1NKGA 3FHAA 4DEVA 5IYYA 2ZEWA 1RYYA 1JZ6A 4AAXA 2VZ3A 3PUHA 5DN2A 1GOGA 3SEPA 2XQXA 2Y8KA 2J22A 3WF4A 4DXRA 4PF1A 1GUIA 5EJZB 2J1TA 4P08A 3C7OA 3P1IA 4MOAA 3VD5A 4CUBA 3VDBA 2ZEXA 2PQSA 1TVGA 3ETPA 2VMFA 4AG4A 3I2IA 2W1WA 1ULOA 2HLEA 4RN5A 1R64A 2W1QA 3HPNA 3HNMA 1JYNA 3WNNA 4MGQA 4QB2A 3VD7A 3E1F1 4TXWA 5CZKA 1US3A 2J1RA 2WN3A 3I2FA 4LQRA 2ID4A 2VZUA 3ACIA
chains in the Genus database with same CATH superfamily
1FMD1 5IHRA 5BV6A 1NCQA 3HN3A 1QOOA 4ZKTB 4D6QA 2GNMA 1OF4A 1W6QA 3VZJA 4XJ8A 5C9AA 4LULA 4AYUA 3KGLA 4HMZA 3M3OA 4Z82A 1HKDA 2QZ3A 2A6XA 2DV9A 3ROUA 5BUVA 1JZ4A 3DL3A 3CL1A 3AM2A 1ZBE3 1BLZA 3FHIB 5A3UA 1QF3A 3LEMA 1OSGA 4D0QA 1WKYA 3SMKA 4R4ZA 1S0EA 2RJKA 1R093 1WW5A 2X10A 4RR3A 3D5OA 2P6CA 3U0ZA 1BEV1 4A3ZA 5BY9A 4BG6A 4O9GA 1BKZA 3AC0A 3CDZB 1DZQA 4L99A 5JR7B 4Y4YA 4E4SA 1W6PB 2CAVA 2WWUA 3OGVA 1XE0A 3LPFA 2H0VA 1XU2A 4MGTA 2XKOA 1SBFA 2HEYF 3AL5A 4RFRB 3W59A 5J96B 4YG6A 4X6RB 5DUVA 1OD5A 2YG0A 1WLDA 3PVNA 4LBOA 4N90A 1M06G 1PK6A 5A7OA 1C5IA 3F95A 1TNFA 5FV3A 2Y0OA 4LT5A 2HWF2 1UZ0A 1W8HA 4CDQC 1ULCA 4RQPB 4XXPA 5LY2A 4QXHA 1SFYA 1SPPB 5FQ0A 2BN0A 1WS4A 1NLQA 1VRH1 2EXKA 4PQQA 2AEYA 5GJ6A 3LWCA 5DZEA 2DCYA 2RJ2A 3VY7A 1OLME 2WJSA 3WXPA 2BMYA 1Y7BA 1WA4A 3SH4A 4CDWC 5IK8A 1JUIA 2ZPXA 3N7JA 1UMZA 4NRMA 1LGCA 3OG2A 4YWAA 1UY3A 1ST8A 3MIFA 2C9AA 5CFDA 5JOZA 4JKLA 1DZTA 2LM3A 3H8RA 2BUKA 2ZXQA 3ZR6A 4AEDC 4NPLA 3CJXA 4QHBA 4KI5M 4B29A 4YFWA 3CNAA 2OIIA 3H7JA 3H7YA 2C23A 1JH5A 5C4WB 1YNAA 2WT0A 3ACLA 1SMVA 1VJ2A 2FQPA 1SDWA 4AWDA 1FX5A 3RYPA 3VKNA 2WYSA 1IZ3A 5FK7A 2O02A 1ULFA 1CGPA 1OOPC 3KD4A 4K6BA 3H8XA 3LDBA 1DIWA 1US2A 4LITA 3LL0A 3ZKYA 2BWCA 2GZWA 1MPXA 1VBC2 2VU9A 3Q8AA 2XR4A 4TSVA 2BQ0A 2HEVF 4AQSA 1UGWC 4XMAA 2GUCA 3WDTA 5FTTC 1MS5A 1FXZA 1GQGA 5EFUA 4YZ4A 3ZFFA 4SBVA 1NUKA 1DBNA 4GMP0 3BGAA 3WQBA 5FUIA 3BALA 3H3LA 2VQAA 4CPBA 3SH3A 2EVXA 1S0JA 4A45A 1ZBE1 4YM0A 2C4XA 2R042 3D0JA 4Y20A 1R092 5EHDA 2FZ1A 5H9SA 1XB9A 5FKCA 1UMIA 3VDDA 3G6JB 2XBO3 4CCMA 3EHKA 2RMU2 2JD9A 1GKBA 3GZEA 1LR5A 1XNAA 4AI3A 2EIEA 3BN6A 2WLQA 5FY9A 1QNYA 3NWKA 4LKFA 4LLFA 1W2TA 4BQYA 4UI9L 5FREA 4YM3A 3JCIA 2PLV2 4E2GA 1F8VA 1K12A 4XABA 4IEZA 1IB1A 5LK5A 3FN9A 1COV3 1I6XA 4P9YA 1DGWA 1HB1A 2VNGA 2VTXJ 1UN1A 3NNJA 2E33A 3WW2A 3ZYFA 3KLSA 4SLIA 1SLLA 4XJAA 4NIIA 1UH0A 3IIAA 4PI0A 1KFUL 2OVUA 2YB7A 4HG6B 2W91A 5JZGB 3ZSJA 5F3CA 2GTYA 2JZ4A 1EV11 1X1VA 1W05A 3SC7X 5J98B 4ZHNA 3DF0A 1O4YA 4JDDA 1YFUA 3GJBA 3RWNA 1A8MA 4ASKA 5CEHA 5DAVA 4GKYA 2XKPA 1K45A 4Q4X1 1H6XA 5G04L 1VMJA 1ZRRA 3T09A 3TN93 1ZRDA 1W6NA 1UAIA 1VR3A 2OX0A 2OW4A 4DINB 1J4SA 2ZMKA 2VH9A 3P3NA 4IERA 3JD73 3SCFA 4AHZA 2JKBA 3E6CC 3TEYA 1GQHA 1KRIA 1O7FA 4MYEA 3KCYA 2PHTA 2P37A 1QWRA 1S0BA 1X7NA 1ZM1A 3N9QA 5JZGC 1WCDJ 3WUDA 1VBE1 3UKVA 1V6JA 2R16A 3IIIA 4AFMA 5JOWA 3PVBB 2P6HA 4NJ4A 2HWB3 2VW1A 3LSDA 3IDEA 3S7EA 2ZA9A 4XUPA 1NT0A 4J6GA 3V65A 4QDRA 1VMOA 3ZXLA 1MS9A 2PQQA 2NPIA 2VZ1A 1Q3EA 1RGSA 1XU1A 3T1MA 2BFUS 1TEIA 2EXHA 3PVEA 1JZ5A 5FXZA 4JGYB 1SEFA 2UY8A 3WY6A 5JVVA 4QX0A 4E8CA 3GCXA 1S1AA 2RHPA 3K4AA 1MACA 1UY4A 3OB8A 1S2EA 5EV7A 5IT6A 5FZ9A 3UX0A 3E6YA 4XF9A 4PBPA 4QPGB 4UFMA 5F3EA 5B4NA 2YDEA 1IGOA 2O1QA 4LORA 2XBO1 4Y1UA 5FOBB 5EYYA 4NAMA 1GANA 2W46A 4CXWA 4LE4A 4IEQA 4I02A 3MGUA 1SZBA 1WLWA 3UV9A 5KXDA 4RFT0 4UFHA 1A34A 4IV3A 2RDQA 3WP4A 1HIXA 1COV2 5FMDA 3S0MA 3NJXA 4AHXA 3ZIWA 1ZYBA 2RDRA 5GALA 3M7AA 4DNKA 5LRRA 4XHXA 5DZGA 2PELA 3RJ2X 4JGYC 1OC1A 5LU2A 2GMMA 4LHSA 5FZAA 2Y6KA 2R073 1OXCA 4KWJA 3RZGA 2D6KA 3AXEA 3HWJA 4XC9A 2VVFA 3WZ1A 3SMLA 2ZX3A 4XILA 2NMOA 3TYJA 3MIVA 5FMOS 3O8IA 2VOKA 2XDVA 5JR2A 4OI0A 4FOQA 2PHUA 3DKQA 3POSA 1H1AA 2VTXA 2WA3A 3JZVA 4KU7A 3WP3A 4QB1A 4N84A 2JG9B 4IL7A 3JQXA 4HN0A 4ITCA 2PFWA 2HWD3 5A7NA 1UQXA 5FZHA 3DXTA 4GB33 1YZ5A 1TNRA 4I0WB 4K20A 2BZDA 4AOCA 1CWPA 4DAUA 1GFF2 4AI2A 4CU8A 3JD71 3RS6A 2QQWA 2CGNA 5D2AA 2VMIA 4A7ZA 4CPBD 4DXTA 4GA9A 4E8DA 4XPVA 3O1PA 2FDGA 5FMBA 1LHWA 1N1TA 1OH3A 2TNFA 3T4HB 1KFXL 1DF0A 4A7YA 4CP0A 2ZX0A 5J1XA 1AYN1 5IVYA 5A80A 2HWB2 2V72A 5EQUA 2WZR3 1WMEA 3HJRA 4QPWA 1W3XA 2J42A 3WNKA 3K3NA 1TOQA 1XBFA 2KXLA 3NMBA 5A6ZA 4CTEA 3WOCA 2GN3A 1PM7A 3ZVXA 4QQOA 4BA6A 4QGNA 1PVC3 2HWC3 1W90A 3L9JT 1DGWX 2XJPA 3W5MA 1GP6A 3ACFA 2RG4A 1CPMA 2VOWA 4E2EA 1D4M3 4O9EA 4OQ9A 4AKDA 1BJQA 3AYDA 3VBSB 2WNOA 1MQTC 5IW0A 4XMIA 5B2GB 4QQHA 2DUQA 2W1SA 1RUC3 2XJSA 2W1UA 3NNFA 3NV2A 4Q0PA 3RRDA 5C33A 3GCWA 3W58A 3GDBA 1CVNA 4LHKA 4QD2A 4DRRA 4LBQB 3JB8A 3ACHA 4NOTA 3H8UA 2VMCA 4MGZE 3VKLA 2SLIA 5C3OA 5C3QA 2W95A 3PIGA 2PHWA 4KU8A 1N1VA 3KV6A 3U14A 3IDCB 1URXA 2BGOA 1UGYA 1RUH3 2YFUA 1X50A 1AJKA 4K3UA 2WS93 5DDJ3 5D2DA 5C9AB 5FYYA 2R071 3LM1A 1O9FA 2GNDA 1YHFA 4N7YA 3VZNA 2WZPP 3WNOA 2C0ZA 2XJRA 5D8AC 4A42A 3Q9OA 1WCQA 3T3YA 4U2AA 3A0NA 4H2AA 3CMGA 5HCAA 4NN0A 3JXSA 3GHMA 1H8TA 4C91A 2HWD1 4COWA 3K4DA 3R4DB 4GJYA 4AK3A 1GMMA 4GB31 1BHGA 1RMU1 2JDYA 3RI8A 5JSOA 3PUAA 1GNZA 5FR3A 1NA1A 4FO9A 4OQ8A 2EAAA 5LBFA 5BNPA 1EYBA 2CV6A 2KM2A 4A44A 4COYA 1WLCA 1ODNA 1QQP3 2P3KA 4XEZA 3ST7A 4QX1A 1DLCA 4NRPA 1OT5A 4OI2A 2XL7A 3WF3A 1PK6B 1V6MA 3RI9A 2BNNA 1OI6A 3PURA 1YEWA 1CAXA 1PGSA 3I2HA 4AQ2A 2XHKA 2B42B 4EN7B 3ASIA 3FLTA 3MW4A 4W6XA 4A41A 2HYRA 4LBKA 2VZVA 4DUXA 2E9QA 1FYUA 1OMIA 1RUJ3 4ATEA 3SITA 2K9ZA 1W2UA 2AC1A 4NIAA 4ATFA 3FX3A 1CD3G 1PVC2 2A1XA 2XJVA 3OBRA 1AYM3 3PJQA 2HBUA 2Z42A 4IV1C 1RUD3 2HWC1 2I45A 3HOBA 4CCDA 3OGJA 1W9TA 4BQ5A 3A0KA 3ALQA 4YZ1A 5A3LA 5JOYA 4GNTA 2GNBA 1UIKA 4Q4V3 1IPJA 3IQVA 1LODA 1PZ9A 4AVAA 2BV4A 4NVPA 3LL2A 3KVAA 4NIDA 3VBUA 1RUC2 4NHXA 3I3BA 1XXQA 2Q1FA 2ZGRA 4JGZB 4Y1YA 1VBA3 4YPJA 2VZQA 3WNMA 3U4SA 2C74A 1CAUB 4LOSA 5L7OA 1NY71 2ORXA 2Z69A 4QM9A 4WRQA 4Y1ZA 4MG2A 1KDMA 2G19A 1UKGA 3WG2A 3VBHA 1TQ5A 4AI9A 2Z4FA 5SV8A 1TMF1 1W0PA 1G86A 5IK5A 2LW8A 1SLBA 2OQ7A 3DKWA 1HRI2 2WS92 4N53C 5C3PA 1RUH1 4OUMA 2J1EA 1FNYA 4M4PA 3POGA 4JDOA 4ZPIA 5DDJ1 2QQVA 2CL2A 3THCA 4R9CA 4MHRA 2Q0AA 3RG0A 1V70A 4NAOA 4MGKE 2R6QA 5JXHA 5CG8A 3J8F1 1HQWA 2JKXA 3K51A 3MF6A 5EWSA 2IXKA 1ASJ2 1UY2A 1S4CA 2GH2A 2QDRA 2R32A 4OMCA 2VUAA 1LOEA 3N7MA 1R1A3 5DMYA 1KS4A 2BTVC 2VW2A 2ZEZA 2ZAAA 5CB7A 4JGZC 4UFIA 4AE2A 3B02A 2ZX1A 5JXGA 5HF3A 1JZ7A 3C3VA 2FCVA 1LTEA 3FBYA 2EF6A 3O7OA 1WBLA 2DYCA 4XDQA 1WA6X 2FDIA 2VO5A 3ZPYA 2ZGKA 3ZXKA 4Q4Y2 3HVDA 2Z5WA 1YQ8A 2GC1A 4KL1A 3IB3A 4QX5A 4YGEA 2B5HA 4QKFA 5CA6A 1QQP1 4X8NA 2C5DA 5K9YA 1YFYA 2EXJA 2ZGQA 3POJA 2C63A 4OUSA 2E7AA 1AL21 1NZIA 5FYCA 2XJQA 5L9RA 1WLTA 1GOFA 1S2XA 1X33A 2QZ2A 4NWVA 1H6YA 1JYCA 1SACA 2F4PA 2QUOA 4RHV1 5FLHA 3UK9A 2XUMA 4FPHA 2JDZA 4XUOA 2WH0A 5A7QA 1NOVA 3T4VA 3AZVA 1RUJ2 1UZYA 2XONA 1QJAA 2B7YA 4FXGB 5E8AA 2GUDA 3ZXFA 3H3UA 2GH8A 2Y6HA 4KBZA 1AYM1 4V2VA 1LGNA 3MIUA 1RUD1 2CSGA 4N43C 1LOFC 5FZKA 1MS3A 3SMOA 5FYVA 4NR1A 4CCJA 4AF9A 2TEPA 1W6NB 2D6MA 4C8DA 4DFSA 3NJYA 1IS3A 2VZ3A 3V56A 1OHFA 2WNVA 3RMXA 2DUPA 1HB4A 4AZZA 3CJIB 5FPLA 1UF2C 4UW3A 2RS32 3ZXAC 2DCZA 4N7IA 1H2LA 2RS51 4YG3A 2Y8KA 2J22A 4MX3A 4XETA 3KGZA 1AR91 3I49A 3MYXA 1ENQA 2ZHNA 1QJY1 2WFF1 5LX2A 5GZFA 5AC92 4XDOA 2XQRA 4LA3A 1XSRA 4MOAA 5JI7A 3VD5A 4CEWA 1BMV1 1YUDA 1ZZ9A 5DUXA 1XNBA 2BNOA 1ULOA 2HLEA 4RN5A 5BPXA 4AW7A 4NPRA 3ZFGA 5A3PA 1UGXA 4GWNA 1KD7A 4YGDA 5BNNA 1LRHA 2QKDA 1SBEA 2NN8A 2QTWB 1K5MA 5CZKA 1WBFA 1Z7S3 2ZHMA 3RZHA 1X8MA 1GZWB 3CJIC 2WLPA 1R1A1 2J1RA 4I30A 2WN3A 3W9AA 1RVF3 1JW6A 1JBCA 2ID4A 1ENSA 2QQUA 3ACIA 4UBGA 5H9PA 4EROA 4QPIC 1E57A 1N3PA 4INDA 3RYKA 4Q4W1 1DQ2A 4C1XA 1C8M3 1VBD2 5LK7B 4F7ZA 2ZAHA 3U11A 3NV4A 4M4RA 1AL0G 2R7EB 1X82A 1PO12 1BBT3 1S2BA 2KR2A 3ILFA 3KCXA 3NW4A 4IEOA 5KXCA 5D3EA 1VALA 2X29A 5JMOA 1VIWB 4CEYA 5J4TA 4GMP3 3VKFC 1AR83 1E5HA 3PU3A 4Y26A 3OPZA 4C0BA 2R0HA 3NNGA 4Y22A 1UXXX 2WZEA 4H7MA 3H42B 4CDXC 3KHCA 1KUJA 5FXVA 1CAVB 4ZXEA 2E6VA 3E6DA 3M3QA 3MICA 3O1RA 2GP5A 3B5LB 4K8RB 1HV0A 4XF1A 5I0SA 2NP0A 3WW3A 2X5IA 5EXGA 5T3NA 2ORZA 2FDFA 4XFIA 4CSWA 4BQ1A 3CQGA 4Y1VA 3VD4A 3ELNA 1OURA 4L0PA 4LA2A 4QU1A 4XUTA 4DMIA 1I3HA 4ARYA 4HANA 3P1SA 3OUHA 3K4ZA 4GWJA 3WP6A 4CUCA 4RGGA 5L19A 3GZUC 4JC1A 2BMZA 1XQNA 2OS2A 2JE8A 3N7KA 3VBRC 3HEIA 3RZMA 4PF5A 4YW3A 3NRUA 1UPIA 2W3JA 4FI9A 1LEMA 2RDNA 1ND3A 1OA4A 2XWBB 1YWTA 4IGQA 2D43A 3VBOC 2ARXA 1PIV1 2AH2A 2G9ZA 4HPKA 4P9GA 3ZYIB 5K0UB 5C6CA 4IW3A 4CCOA 3AVSA 2QQOA 2ZX2A 1RB8G 3PMEA 4O7XA 1LU1A 1UIJA 2CGOA 2FCTA 4AK4A 4LO4B 3OPTA 3WSOA 5FXXA 1S0IA 1FMD3 1D2QA 1QGLA 2Y34A 4JVAA 3AP5A 5EPAA 4DNYA 1QJEA 1UD1A 3VBFC 4URTA 4QX3A 5C8CB 3HMYA 2B45X 4DXZA 1ALYA 5CNAA 5CADA 2HH9A 3OTFA 1STMA 4URAA 1LAJA 4XF3A 3W21A 3ZYHA 5EWZA 4RYDA 4HSLA 1RVF1 3WF2A 5F6KA 5JWPA 4PBOA 3WW1A 4L8QA 2Q4SA 3MLLA 1EAH1 3M70A 5K0UC 1OVSA 2XUEA 1C8M2 2B9UA 3I2GA 1CZVA 3AK0A 5EXOA 3KV5A 4AHYA 2LUWA 3TOJA 1Z78A 4ZS2A 3WX5A 5FPXA 3RZKA 3QLQA 1BBT2 2MEV2 2D6OX 3DGTA 2AACA 3GALA 2VL4A 5T5LA 1KJLA 4S2DA 2VXRA 2ATFA 4FAGA 1UU6A 2ZBJA 4DRVA 4WVVA 3ZN6A 1IKPA 1VRBA 4NIGA 4OI4A 5C8CC 1SLTA 5IVEA 2VQ0A 5BY5A 2ZTNA 2HYQA 3M8LA 4WM7A 3PLQA 2W2IA 3O5SA 4FQZA 4N9IA 4UF0B 3OUJA 4XQ4A 4EWEA 4MGSA 5FYZA 1XC6A 4Q5OA 4E4HA 5KWRA 1J4UA 4CU7A 4QKBA 2EICA 4XYXA 1Y3TA 1LGBA 1POV1 2QBXA 1VRH3 1SFNA 3LD8A 4FOWA 5FP9A 3P5BA 4PIXA 1UXZA 1LOBA 2A3XA 1AF9A 3DECA 1W9FA 1BVP1 3HNYM 2UWBA 4DDNA 5EZWA 4DUWA 2LALA 2ZGSA 5JUVA 2ERFA 5EJ3A 1PO23 2A6VA 2HYKA 2VBDA 2KD7A 1ZX5A 1O9DA 4ARXA 2H6CA 4PDWA 4PIZA 3VKOA 4MO3M 1NA1B 3NNLA 2CGPA 3VV1A 3U4XA 5LBBA 2YPJA 1I9RA 1JU4A 4M0NA 3U78A 2YFZA 2BNMA 1YLLA 3DUIA 4Q8LA 3HT2A 4BCUA 3VLBB 3EYPA 4LKSA 1APNA 5D1IA 4XF0A 1TME1 1WW4A 1VLNA 4H55A 1D2SA 1HQLA 1V9U1 3P1NA 5A32A 3LKJA 4W6YA 2D6LX 2MNGA 2VNOA 1J1TA 3DPRB 4LO5B 5F3IA 5FBZA 4IUGA 2WNUA 4CCLA 2P3YA 1AXZA 3A23A 4BMBA 1ZZ8A 5I0RA 1W6MA 4NHKA 2YC0A 3OGSA 3LCPA 3AMMA 4DZGA 1H4GA 1RUE1 3EBRA 4R6PA 3JBG1 4XFFA 2WO3A 3CIHA 2ZS6B 4S2FA 1XOYA 2R1BA 4Q0UA 4R6OA 2XPJA 2D7FA 1DP0A 1X36A 3VZOA 2V7DA 5T50A 3TWIA 1CAWA 3N35A 3ZYGA 2GDFA 3AFKA 4CP2A 2H6BA 4GALA 3LSEA 4L2NA 1G7YA 4QDQA 1BEV2 4YLZA 3K3OA 5DAWA 4D6RA 1YJKA 2J1SA 1WCSA 1CX1A 3DPRC 4Q1RA 1AR71 4GKXA 3MF9A 1O4TA 4BZ4A 4OCTA 4YARA 5IVCA 5L7OB 3H1WA 3R52A 5JPMB 1Q8QA 2DCKA 4EN0A 1H30A 4XVHA 4TTGA 2VUDA 2JENA 3VN4A 5BNQA 2Y33A 3VBHB 2DVFA 1RXGA 4BXFA 2IXCA 5KR7A 3THPA 1SCRA 4XJZA 1REDA 5T5JA 3ME2A 1KGYA 2DFBA 4QX7A 1OPMA 2VAUA 2W52A 4IGOA 2DF7A 2VPVA 4Q0SA 5E89A 3K2OA 5FYMA 2GMPA 4AL9A 1VBB3 3CQOA 1YI7A 5AFEA 4LE3A 1VRH2 1EV13 3EB7A 4DHOA 3FJSA 4HL0A 4GX7A 1HRV2 1REFA 2RDSA 1XNKA 3LDRA 3GBGA 1QH7A 2IZWA 1K42A 1ZBA2 2LS6A 3WDYA 1MZFA 3VHPA 4MH0E 5F6LB 3DYMA 2BFUL 1QXRA 1XRUA 4Q4X3 4UW5A 2K2SA 1PO21 3U37A 2VD7A 4IEXA 1UWWA 2IFRA 4N7GA 1QJZA 2B4KA 2VULA 1UU5A 3N9OA 5ERLA 2Q1MA 3ZN4A 2IFWA 1JUHA 2P1BA 3IWZA 3LOIA 4JZRA 1R083 1JACA 2VOXA 4XFGA 1LULA 2BU9A 4EN9B 5JSPA 3DV8A 3ZFEA 3I4IA 1L7LA 2DVDA 4GH4A 5FLJA 3OYWB 2VVEA 4IEPA 4P9JA 4RQPC 4EV0A 1VBE3 5FDBA 5L36A 3O1SA 2A6ZA 2GN7A 3BU7A 5F74A 3I3DA 3IAQA 5CU1A 1YRZA 5F2WA 5FIXA 4WM8A 4DO0A 4YSFA 5I0UA 1K5JA 5EJ1B 3OEBA 4QHOA 4HK8A 3SKVA 3SXWA 3O1MA 4DHSA 1MR5A 1VAMA 3DYOA 3LEGA 4PQ9A 1W06A 3ZN5A 3GHNA 5D3FA 1QDOA 4MXWA 1W9WA 2KA3A 2ZGLA 3POIA 3VZFA 2E7QA 4JDMA 3CO2A 1ZBE2 4LBLA 5FMOL 2VUCA 2D3PA 3O1TA 4QMAA 3CEWA 1O3SA 4NRQA 2VE1A 5FKBA 3WCRA 3ZLIA 3R6SA 3GBFA 4RS5A 5C4WC 1JYXA 1POV0 3OBTA 3SHRA 4BLIA 5F5AA 3S57A 4GULA 2YBSA 3O0XA 5B4XA 2WAAA 2RS11 4FPOB 1ZZ7A 2JDAA 4K9SA 4XFBA 1J1LA 5FYSA 2BTPA 2IVJA 4HFSA 1V6OA 4MV2A 2NLRA 1UOFA 3WT3A 1QH6A 4EN6B 4IE6A 1V0AA 5IATA 2W68A 5BXXA 5CFCA 2D6PA 3R05A 4OYUA 5F8PA 1SG3A 3AZXA 3Q8BA 3ZFGB 2BOJA 2D98A 2O8OA 3AP7A 5BNNB 1BK1A 5DUWA 2R041 5T54A 4EZHA 1VBB1 4I01A 1K5MB 1NXD1 1IQDC 1W2NA 2QE3A 2W5FA 5CAZA 3H9AA 3N9NA 2RMU1 1NQDA 2A70A 5E16A 3GJAA 3C8XA 3M3CA 2HJIA 4HETA 3NNMA 3MPBA 1KU8A 4S2HA 2ZGTA 3WNPA 5HXMA 1L3JA 1XPWA 4WVMA 1LHUA 4Y5Z0 5C5UA 1J3PA 1RXFA 3KZ4C 4HVRA 4XZUG 3MW2A 2I74A 1G9BA 2ETEA 3EO6A 4UW6A 1GWKA 3M2MA 1CZTA 4HN1A 1GICA 2VZSA 1B09A 1Q5OA 1R081 3FWEA 1MZEA 2XLGA 3A7QA 3WQ0A 4AVTA 5IVVA 2BP6A 4YVSA 1O8PA 1GWMA 1Y4WA 2YU2A 5FFOC 3J26N 1A6CA 1UZWA 1VBE2 1ZZCA 2QQLA 4FP3A 4GQ7A 2V5DA 4BWOA 1AYN3 2Z79A 1V6KA 2NYYA 3RYRA 3ZOIA 4ONUA 4I0BA 2D5HA 5KHHA 2FMDA 4LHNA 1FI2A 1QJX3 5JM1A 1NLRA 2UYBA 5DUUA 5IK4A 3PJYA 3PTYA 3U10A 1XXRA 1ULPA 1F35A 5FPAA 2CDOA 2JE7A 2WKKA 4JV4A 4LK7A 3AL6A 1ULGA 3CLPA 3IPVB 4NO4A 5FCCA 4HKOA 3UBWA 4JC3A 5KXBA 1ZGRA 5KHKA 3NAPA 1VMHA 2WO1A 2ZOEB 1S0GA 4K1YA 1ND3B 4KMQA 2XBO2 3E97A 5FZ0A 2C9KA 3ZXJA 5LBEA 1LOGA 4PIYA 2ZHLA 5CBLA 3K46A 4GD4A 3VHNA 1H1IA 4B7EA 1TZOA 2C1JA 2VNVA 1K3IA 3C7EA 4AI0A 4C0HA 1ZVFA 2UURA 5GZEA 1A37A 1F5FA 1OUSA 5FYIA 3QCWA 5JPNB 5GLZA 5K8SA 1FT9A 5A6YA 2A5ZA 1GU3A 1HJFA 4P9XA 4EWAA 3HR9A 3J7LA 3VL9A 3PNAA 1AZDA 4HXCA 3BKZA 1JYVA 2D93A 4D94A 3V0AA 3LEIA 4AHWA 2PN5A 5FUPA 3KWVA 1OKOA 4FT8A 4L9BA 3ZIXA 5CKNA 5LY1A 5BN6E 1JXNA 3LOBA 1NLSA 4QPGC 1W6OA 4BQ4A 1KEXA 1MEC3 3BIWE 3PUSA 3E6BA 2D40A 5FY4A 5FY1A 4DY3A 2FDKA 2R30A 3P1PA 2UYAA 2VZRA 2AENA 3MEPA 3A21A 4W4ZA 3SLIA 2WC2A 5AVPA 2Z2SB 1B35B 1O9CA 2VMDA 3FBMA 3U9XA 5FPZA 2TUNA 3TN92 1XJAA 3O14A 4F7RA 2JICA 1RMU3 2DURA 1QDCA 1V6LA 2CY6A 3ZO0B 3O1OA 2OA2A 2FDJA 4FSJA 2LTNA 3JD72 5DG1A 4YG0A 4RD7A 2VJXA 5E1RA 1NCRA 3GF6A 3PHMA 3WNLA 3I2JA 1LECA 5JDBA 5FYBA 1X8EA 2UU8A 1KXGA 3FZ3A 5J36A 1DYOA 1IHMA 3POEA 1GZCA 2JG9C 4JDNA 3LAGA 3MLKA 2YZ4A 2JWPA 5CIRA 3FMGA 1QJX1 1B35C 3OEAA 1RUI1 4YGBA 4MGYE 4FTBA 1ND2B 1CZSA 1WMXA 4IEWA 2ZZJA 2JDPA 3AKRA 5ABJA 4PDWB 4YVWA 3S7IA 2JDMA 1KJRA 1A3KA 2DBNA 2GC2A 4FPYA 4LLOA 4BJ0A 4I09A 3OGRA 4EE2A 2PAEA 3D4KA 3WP5A 1PMHX 3SEEA 3AMPA 3N9PA 1W8OA 2VQUA 1YXWA 5AV7A 3RDHA 1U5XA 5A33B 3T0MA 2L9LA 5GM0A 2WBKA 5DAXA 1NX9A 4YW4A 5A32B 3VD3A 1O59A 3USUA 4OHYA 3LW1A 4META 4FFGA 2BQPA 2F6BA 2BBVA 2JG8B 5C3RA 2B05A 2VZOA 4LIUA 1EPWA 3FHAA 4IE0A 4N7UA 1N3QA 2CAUA 1CONA 1OQDA 1RUG1 1TMF3 2DTYA 1W6MB 2X53S 2ZKLA 5JCTA 3OUIA 5JIUA 5LB6A 1ND2C 5FZ3A 4ES9A 1NCQB 5JOXA 5IQPA 2AEZA 4XZPA 3VB9A 3UGFA 2R072 1OKQA 4FPGA 4XJ9A 4YW2A 1W6QB 5BNOA 5FYHA 2D97A 5F2SA 2O14A 3WF4A 4PF1A 3J8F3 1PGL1 4OHXA 2J1TA 5KC6A 4ZDRA 5FBJA 3VBSC 3HBZA 4LBNA 4QU2A 1MEC1 4V2WA 1DG6A 3KSCA 1LENA 3MIDA 5HCBA 2JD4A 1FPN1 2HWD2 2ZEXA 2PQSA 4XACA 2CYFA 3P3PA 4RR3B 1F2NA 1Q8PA 5FZCA 2YMZA 3KF3A 1AR61 2P3JA 4GB32 4A3XA 5FRAA 1WZXA 1R64A 2WSUA 2JG8C 1W0OA 3HPNA 5I8TA 1CX4A 4TWTA 1HV1A 4XIOA 5FZOA 3BTZA 3UL2A 3E1F1 2BOIA 1OFNA 1US3A 2JDKA 3H50A 3L2YA 4MUVA 4UFLA 1NCQC 5K4LA 3ZSLA 5I8YA 5J4XA 3AP4A 4IEUA 5L9BA 3ZXDA 2VVDA 5C9AC 1AL23 1AJOA 1VPHA 5T5PA 3IBMA 4FJ3A 4CDUA 1VAVA 5SV5A 3SH5A 4RHV3 2WZR2 2YU1A 2GALA 4UBHA 3UJOA 1HXS1 4AEMA 2DVGA 4L92A 5FQ0B 1MS1A 5IVFA 3AZYA 4C90A 4XW3A 3WV6A 5I91A 3JUUA 5FZBA 3TRSB 2IWGB 2W9XA 5LVZA 2Q30A 4RR3C 2HWC2 3SKJE 4DXSA 1GQPA 1IS5A 3APBA 5FYTA 1ZNPA 5FZDA 3T2QA 2QNKA 1D4M2 5J7MA 2JE9A 5CFDB 3IKWA 4GIQA 4YM1A 4I3GA 3JQWA 3AXYC 3QH7A 2YXSA 4NWWA 1PK6C 4IETA 5IVJA 2XVLA 1J3RA 1W3VA 3BOWA 3C7GA 2RS53 5FZ7A 2WWJA 1GP4A 4K40A 3ZFEB 1NE6A 4IXLA 3T2OA 1H8VA 3I2OA 4DHNA 3PVOA 1AR93 3Q8FA 5IVBA 2RM21 5KHGA 1QJY3 2VOTA 2WFF3 5I0TA 1WS4C 5F9TA 1ENRA 3UZDA 1JHNA 1TMF2 1YO8A 2I07B 4QHZA 4BDVB 4WM8B 1ZZ6A 2YBKA 1VB4A 4HSJA 1RUH2 1NZCA 2WT1A 5D21A 5DDJ2 1N47A 3B69A 4CDQA 4BQ3A 3ZFFB 4AGRA 1W03A 2XXZA 2DU1A 4AKCA 4CCEA 4R6RA 4P9LA 2AREA 5CFDC 4R8HA 4LO6B 5IUQA 5FP7A 4QQLA 1QIQA 5J31A 4CDWA 2BBAA 4Y20B 1RIRA 4COZA 4R9BA 4RS5B 3VDDB 2PMWB 4OMDA 1UZZA 3E5XA 4Q4W3 1IG3A 4KG0A 3HN1A 2NMNA 1DLLA 4JRLA 3WOGA 2XJUA 3MHZA 3OPWA 4AEDA 3R4UA 3RDIA 4B8EA 4H7LA 1RUF1 2VGDA 1HJGA 2CTVA 3HD8B 3EMRA 3NL1A 1PX3A 3WHTA 1QQP2 4HONA 5FP8A 4LR4A 1F4HA 1GP5A 4Q0VA 1W8FA 4NROA 5IJRA 4BXSV 2OYZA 5A3NA 1SPPA 4YGCA 3ZFFC 5L9VA 1LESA 3A22A 3P1OA 1OOPA 5FYUA 1ASJ1 1LHOA 4RA0A 4D69A 4HKLA 4Y5IA 3VKMA 3T0AA 1UYXA 1F5JA 2A3YA 2GMEA 3CU7A 1O91A 5JMCA 1UGWA 3C7HA 3AKTA 3D8CA 3T0DA 5LZ6A 5FPVA 2BGCA 4YNIA 4Q1PA 5LASA 2OKXA 1GOHA 3ZX7A 3VDDC 2ILMA 3HAGA 3WHUA 1AYM2 3MW3A 4XJWA 1RUD2 4H14A 4ZZ8A 3RZLA 4KGQA 3BVCA 3WLUA 4WVMB 1YFXA 2B9VA 4I0AA 4PI2A 5LW9A 4Q4V2 1DQ6A 1NG0A 5JLVA 5C7GA 5A6XA 2E32A 2X8KA 4OUEA 2D3SA 4K7JA 3CZJA 2HWE1 3BB6A 4Y3OA 2XB6C 1HX6A 2FCUA 4WZCA 4OVEA 5IK7A 1WWYA 1VBA2 4MSVA 4YRDA 1PIV3 1U12A 4QGMA 3X0UA 3DN7A 1AR92 4KG8A 3M51A 2G1MA 5LU1A 4B1MA 2O98A 1QJY2 4L11A 2WFF2 3H8OA 1F31A 2BRTA 2V09A 1S55A 3D82A 4UWDA 4AVVA 3J4UH 1UKRA 3L2HA 3M1HA 1BMV2 3LFMA 5T55A 4LBJA 1C3KA 3KCCA 1S0DA 5LATA 2WWSA 2FZ2A 4D3WA 5LRSA 3USSA 2YBPA 1DFQA 3UNPA 2ZGPA 4QB6A 3MIGA 4COVA 5ACA3 1YQ6A 4A2UA 5IYYA 4DEQA 2HBTA 2ADDA 1W9SA 3BTAA 4WVZA 1W99A 4DHMA 4BQWA 1GSLA 1RJ7A 2ARBA 1OA2A 1R1A2 2DDUA 5C5TA 1CPNA 3WDVA 5DAQA 2R063 3LIHA 3MFCA 3POYA 2A71A 4XFAA 4XXAA 3SMHA 2QJVA 2VZPA 3DXUA 4OHWA 4Q4W2 5FZGA 1EAH3 2OZ6A 3PMSA 2YC2A 4QQ2A 4HVQA 5GZGA 4D7TA 2IXLA 1RUNA 1JOJA 3ES1A 3FL7A 1POQA 4W8JA 3VZLA 4PJYA 1C5HA 4ZXKA 4IV3B 5GLUA 1C4RA 3O44A 4LKDA 2Q8CA 5LA1A 3INAA 1NAEA 3P1RA 1QJBA 1OBNA 4G9SB 4XAEA 1GR3A 1C8NA 1CIYA 3ZSKA 2JECA 3WF1A 3V0AB 2XVGA 1M4WA 3SNMA 4CP9A 1XEZA 4FPJA 3KB5A 3LL1A 1J3QA 2MHFA 2PAKA 1ONAA 3EJKA 2BWAA 5CG9A 3WF0A 4JKMA 4NHMA 1IS6A 3T30A 4LBMA 3UKTA 4YZ3A 1POV3 1URJA 1EY2A 1W6OB 1QJFA 1JYWA 3ORJA 1VBD1 2PHRA 5HCHA 1ZRFA 4R6NA 1FOD3 1AVBA 3NO8A 3B93A 2X05A 1YCIA 4JQTA 2G9GA 4UFJA 4LK6A 3UGHA 4BB3A 3TEZA 3ILNA 3IAPA 2D6NA 4LXLA 3WDXA 3APAA 1AX0A 2MPFA 4IV3C 4S2GA 2WAOA 4YFZA 5J09A 1G9FA 2GC3A 2VQTA 3KF5A 3U75A 3K48A 1MZ5A 3CKHA 4WZFA 1T6BX 4BK5A 5LEJA 2Q1ZB 4IE4A 4QDSA 1J58A 1NCRB 2BW8A 3SQOA 4QQPA 2WO2A 3WCSA 2BERA 4C1WA 5JI9A 3N36A 3ZMOA 1TME3 3NJVA 3AXDA 1V9U3 3D6EA 3MO4A 4O65A 5I0DA 1C3MA 3GBWA 3T2PA 3WINE 2X09A 5HPOA 3AFGA 2GUXA 1OUXA 2JB4A 3PUIA 3ZKUA 1IPKA 2ARCA 4JGYA 4HZFA 5GLTA 1UCXA 1ODMA 4BK4A 1PGW2 1RUE3 5JSRA 2AGSA 3AKSA 3JBG3 1XYPA 4Q2FA 5ACA1 2C6SA 4UT5A 2AZ5A 4MGIE 3TAYA 1H2NA 2Y6FA 3LF7A 2PHDA 3RMYA 1XNCA 1QEXA 1Z7S2 2GNTA 3S5AA 1J84A 4YVWB 5ABJB 3VL8A 4PITA 3OY8A 3H1YA 4RGAA 1RVF2 4Z2WA 1HN1A 2E51A 1A38A 2R061 3ZDVA 4FPFA 2A7AA 4JCKA 2QP2A 1EAH2 3WNXA 5A1FA 4FPKA 1FNZA 1MVQA 1OVPA 4Y3BA 2CHHA 4LOTA 1LCLA 1AR73 4LUKA 3USUB 4ES8A 1OFSA 4FOVA 4DHUA 4XFCA 4TYSA 4XURA 1JOTA 2HKXA 3CQCA 3LA2A 1MS0A 1AR82 2ZZQA 3P8SA 1XE7A 1WMFA 2BDRA 2JEMA 3I7DA 4FXKB 5A7PA 1S0FA 4FTSA 1J4TA 3D3AA 2V5YA 3MFAA 2B46X 2WZ8A 1LU2A 3VDCA 4Z8BA 3T08A 1NYWA 2PHFA 2P34A 2C24A 2Q8DA 2VBBA 1WD4A 2DU0A 1CJPA 1HW5A 4Q26A 5FWEA 4BE3A 2ENRA 4LEJA 5A7WA 3CU8A 2WL1A 4JQRA 4JRAA 3KQRA 4TZDA 4PLOA 3LA7A 4LTAA 5A3WA 1FOD1 2MEV1 3FHQA 4HBNA 4XDPA 3VZEA 1H8TB 4IQPA 5KXEA 4QXKA 4LNVA 3IM0A 3LKYA 2XHNA 1M26A 2Q8EA 2C26A 2VZTA 4QWNA 2VC9A 4CUAA 5C71A 1PZ7A 4QLIA 1MQTA 4HOOA 1C1FA 2FD8A 4RSUA 1JMUB 4CZSA 2BVBA 2W08A 5BNPB 3OGGA 1UGYC 1UY1A 1QHDA 2IXIA 3K75B 4HLTA 4P9IA 4QGLA 4DHTA 1Y9QA 2J7MA 2HWF3 3N3HA 2A75A 1E5IA 2G4IA 2Q8OA 1V9U2 1LKNA 4XF4A 5J50A 3WOBA 1UO9A 1FATA 4AVCA 1Z0HA 4ASMB 3FUQA 1CAXB 4XUNA 2WDBA 2RV9A 1KDKA 3M3EA 4W6WA 5DQ0A 3S6PA 1PX4A 3JB4C 4K21A 4YW6A 1C28A 1QJU1 1OH4A 1Q56A 1SLCA 2GP3A 1FMD2 1UYPA 1ULEA 3FLRA 3KT4A 4A6OA 1W8WA 3HQXA 4BPZA 2W87A 1H8TC 1WW6A 1WCUA 1L7RA 2ZHKA 4J25A 4AVBA 1W8UA 2DBIA 5D8AA 1HB2A 2QFEA 3MUZ1 1N1SA 4W65A 3WQ1A 1NA1C 2RJLA 3AYAA 2VW0A 2O8QA 5BNPC 4R4XA 1W8NA 4XQDA 4HKCA 5LHOA 2XWJB 4F3JA 4BQXA 5J37A 3MITA 1DU3D 4JTNA 4WV8A 3DYPA 4QM8A 3VBUB 4JTOA 3KV9A 4V1PA 3FE5A 2WT2A 5C70A 4DIQA 2FDHA 1RHI1 1AR72 2VMGA 4GAZA 2RR11 3MIBA 2J1UA 2ZMNA 3Q8CA 4OLLA 1VBC3 4BHPA 1H9WA 1LEDA 4H3WA 5FP3A 2QQNA 2RS13 5FZFA 5EXAA 2JIJA 4AGGA 3M50A 1H9PA 1CJDA 3KHBA 3VZGA 1OPOA 3U07A 4TLFA 2Y60A 2UY9A 4DB5A 5IWFA 4U36A 2VCCA 4CDQB 2AYHA 4FPCA 2XOMA 2IUWA 1TP8A 5FPBA 5LEKA 2FBEA 4DPNA 2R043 3NKGA 4JX0A 2OUJA 1W2OA 4OZOA 4Z2AA 4P02B 2XMLA 4MQ0A 1JZ3A 2ZABA 1JU3A 2WA4A 4IV1A 2RMU3 3VBUC 3VD9A 4CDWB 1XE8A 3T2TA 3B9CA 4ISQA 3UETA 2PLV3 4ZU5A 1JS9A 2VXJA 5LA2A 1PO22 5DAPA 4CCKA 3WW4A 5L7OC 5I8SA 5ISLA 1WCKA 3ACGA 4AQ6A 4D7YA 1DZRA 1O5LA 5FY5A 4AEDB 4R6QA 2Y38A 2ZGUA 4E27A 1UY0A 4EWDA 3LB9A 3VBHC 5FMCA 2ES3A 3CHXA 1YIFA 4RL7A 3HQRA 1DQ4A 1AX1A 1QXPA 4OFGA 1BYHA 1X9PA 3MPPG 2XL9A 2HWF1 3AX4A 3AZZA 3BCWA 5F1RA 4B4QA 1Y9MA 2YYOA 2O8PA 3IQUA 1L7QA 2GU9A 2BYVE 1OOPB 1NE4A 3BU0A 4FBFA 1HRV1 5DABA 4R9DA 3ZXGA 5FZLA 2B39A 1EUUA 1G8WA 1ZBA1 4N53A 3BUCA 3LQCA 5GLWA 5GLVA 2ZGNA 3E5QA 3ZYPA 5FP4A 3I8TA 3AYCA 3T1LA 1YQ2A 2VCMA 3E5UA 3OOXA 3HNBM 4YZ5A 1CN1A 2JJ6A 5TSWA 4PLMA 1F15A 1D0GA 3B7MA 1I1EA 1H2KA 1D0HA 1YC61 5FZ8A 4WOGA 4XE9A 2VY0A 3GZTB 4CCNA 3TEXA 4XBLA 3SP5A 4JGZA 4AI1A 4GWIA 3ZR5A 5FPUA 2QQPA 1ZRIA 1CAUA 2WNVB 1PM4A 3ZXEA 3O1VA 4UOJA 4R52A 2YHJA 4KWUA 4A7KA 4MADA 1O4ZA 4MHUA 2UWAA 4BMEA 2XGXA 4E4DX 3BODA 5CVRA 3S5QA 4RGKA 1C3HA 1S0CA 2RS12 1VBC1 2F4LA 1QXJA 1HB3A 2DWRA 3B01A 3C7FA 3KM5A 3KT7A 3THTA 1V00A 2VECA 2HEWF 4JKKA 2VMHA 2W94A 3AKQA 5IFTA 4CEWB 2JB8A 3RQ0A 2VBPA 3VZMA 1C3NA 3FFQA 4AQTA 2EXIA 4IE5A 2VMEA 1GWLA 4XCBA 3WG3A 4Y33A 1UNBA 5HBAA 4IEVA 1ZREA 1VBB2 2C1FA 2JX9A 2DCTA 4CUGA 1EV12 1R091 1BXHA 2WRAA 5GKAC 2WNVC 5GZDA 4DEVA 3J7NA 4XCAA 2ZEWA 1RYYA 1LOFA 3QD6A 4N43A 4DX0A 4AAXA 1EPZA 5FLIA 1LB2A 5HCFA 3PUHA 5DN2A 4DS0A 4Q4X2 2PLV1 3RZJA 1NQJA 1JTZX 1NXMA 1GOGA 1QOTA 2I2SA 3SEPA 1GV9A 4QKNA 2ZKNA 4YZ2A 2XQXA 2LRPA 4GXLA 2P4EA 1IKQA 4QKDA 5LA9A 4BLJA 4G3YC 4DXRA 2WQ4A 1SQ4A 5EJZB 4CEWC 1ZZBA 1SLAA 2PA7A 3D0SA 4P08A 3LZZA 1R082 1KQRA 4CEYB 2Y0IA 5LA0A 4AAPA 4FFHA 4Y22B 3ZFGC 1UOGA 4CUBA 4LBQD 3VDBA 3DCQA 3OCPA 2NU5A 5BNNC 5GZCA 4CP9B 4J6SA 2VMFA 3I2IA 3IMNA 4EJRA 5A6QA 1IOAA 5T52A 2BJSA 1K5MC 2GAUA 4E9KA 2K0GA 5HV0A 4UXAA 5E88A 5JAXA 3WNNA 4QB2A 1U0AA 3VD7A 2X5IB 4NMIA 3ENRA 1RJ8A 3M4FA 3AJZA 1RUI3 4QXBA 3GNEA 4K8FA 1LHNA 3AMQA 4DQAA 5J48A 2P5BA 3ITQA 4E2QA 3B94A 3CJIA 2DVBA 3KS7A 1SCSA 2WINB 2VCBA 3TBDA 1HLCA 3R0RA 3I59A 5HV4A 4QPIA 1Y43B 5A1LA 5EIYB 3WDUA 4CEYC 3ZHEB 3F2ZA 5LBCA 1D7PM 1XXNA 2WSVA 4G4FA 3RVHA 4J1XA 5JIAA 2V73A 4UW4A 2XG3A 1A8DA 2WYFA 2XLFA 1UU4A 4HPKB 4BIOA 5FZMA 4NIHA 3WDWA 1CR7A 1ZA7A 4F8AA 5ANNA 3IMMA 4XIKA 3MI8A 2X5IC 2ET7A 2NPMA 3UKNA 3TB0A 4CDXA 1TG7A 1RUG3 4Q8KA 4R9AA 2A6YA 1UW8A 4GWMA 2IC1A 3PU8A 1RL3A 2OZJA 1CIWA 4FP2A 1FV2A 2R1DA 2WUHA 1GBGA 1BK0A 4LIVA 4TLGA 1O5UA 1GZWA 4MVTA 4IGPA 4QAWA 5FZ6A 1AXYA 2DVAA 5J3UA 2ET1A 1UX7A 2VUJA 2W0XA 2ZGOA 3AMNA 1UYYA 1QY4A 4XFHA 2OPKA 3J7HA 2CDPA 1SHWB 2J1AA 3OY8B 3QOPA 1ND3C 5BTVA 1JHJA 3OD4A 1Q8VA 5T5OA 1FPN3 4HT1T 5AVAA 1EUTA 1FAYA 4HKWA 1PNGA 4IHLA 2EIBA 1AR63 4I3PA 4AEJA 5C8WA 3VBRA 1COV1 1PVXA 4FTEA 1UOBA 4WBBA 5KC5A 1MVEA 1Y9GA 5G05L 1YIPA 2UWCA 2VG9A 1JZ2A 1VMFA 2AR6A 1WGPA 2EA7A 3MLJA 4KNCA 3VBOA 1CAVA 3MDPA 5F7UA 1YQ5A 3NVCA 3VHRA 4XOGA 1KS5A 1LHVA 1OQ1A 4NE9A 4B1LA 3ZN6B 5CKQA 2W39A 3OF1A 4QPYA 1E5RA 1QMJA 3AZWA 3BYWA 4KWLA 5DXDA 4PIUA 4XAAA 3N7LA 5F3GA 4P00B 1AYN2 4WM7B 5FY7A 3R50A 1HXS3 3GXUA 3PL0A 4XQWA 5FK8A 5A7WB 3VBFA 1PNFA 1W9YA 2SBAA 2QDNA 1QJX2 2WN2A 1ZA4A 1RUI2 4KWKA 4QT6A 3LLYA 3TN91 4XBQA 1DYKA 1CESA 2VCAA 4L97A 4DATA 3MIEA 3LDKA 5DZFA 1Q8SA 4XBNA 1XYNA 3BI3A 1GNHA 1W39A 3MZHA 1QNWA 3BPSA 1YJLA 2AUYA 5L73A 5LCWL 3QACA 1T6GC 2A6WA 1MQTB 2EIGA 4N9HA 5FXWA 4E4ZA 2QQIA 4UAPA 2GSYA 5K0UA 3ZSEA 3LPGA 2D44A 1MS8A 3RJRA 2HWB1 2XLAA 2DCJA 3I2KA 5FZIA 4WM7C 4JAAA 2BPA2 1PMJX 1C1LA 3P1QA 2JDNA 2Y6GA 5LWBA 3MV11 2RM23 2WQZC 3VHOA 2BR9A 1I5ZA 5K7PA 1UPSA 1GLHA 3B3QE 1SDDB 4LO8A 4FVVA 2WNUB 5C8CA 1RUG2 3EQEA 4I2OA 3MHRA 5ANQA 1SFPA 2ZEYA 5M0TA 2OT7A 1PMIA 3BOPA 3JU9A 3MV01 3A4UA 2IXJA 4Q0QA 2IVIB 2GC0A 4O61A 3B9IA 4M3CA 4Y5TA 4FR3A 4ZY9A 4PDWC 2NZ9A 5D8AB 1G9CA 1ZGSA 1WW7A 1Q43A 2E63A 2YV8A 1PGL2 1W8ZA 2PYTA 3IN9A 5H9RA 2V4AA 2OPWA 1PXDA 1OLRA 3AVRA 1MEC2 1CAWB 2EIDA 4YW7A 1OF3A 1FPN2 5FY8A 2XJTA 4PIFA 2ZMLA 2Y6LA 5IFPA 3O0WA 1ZRCA 1AR62 1C57A 3S30A 4IDZA 1RMU2 3POFA 3URFA 3C2UA 3U1XA 1A4OA 2R0FA 1XYOA 4ZU4A 2WNUC 2RVAA 2Y26A 3KT1A 3R4SA 5HI0A 1RUF3 3PDQA 4GJZA 3V0BA 2DFCA 1HRI3 4KQ7A 4ISRA 4ZQ0A 2OUHA 4UF0A 2VOVA 3GGLA 3Q8EA 1H4HA 4LPLA 5A7SA 4B7KA 1WS5A 4YW5A 5FZ4A 3I3EA 4CVUA 5F37A 5CYYA 1ASJ3 3I3QA 2J1VA 1A78A 1HXS2 4ET7A 1DHKB 4FPLA 4Y5SA 3ZM8A 4D6SA 3H3ZA 4NUBA 4IV1B 1PZ8A 4BU2A 5FWJA 4CE8A 4JHZA 3RSJA 3LEKA 3UYJA 4Q4Y3 1V6NA 4PHZA 1X9TA 3ILRA 4LMFA 3QH6A 5FO8B 3LGRA 4ZZ5A 3AP9A 3VDAA 4UYBA 4WVWA 3PUQA 2HWE3 5FJHA 3POBA 2YROA 1RC6A 3DPRA 2WZR1 1YI9A 1YWKA 5EYXA 5EP9A 2E53A 4F83A 4GH4B 2RM22 1NY72 1AX2A 3NQHA 5IAXA 3RZZA 1HDKA 1JYIA 1U5ZA 2GUEA 1WMDA 1PVC1 3ZMNA 2BVVA 1UMHA 4N53B 3AMHA 4XJUA 4Z1VA 4DY5A 3J9SA 2QQJA 1YQCA 1BCXA 5BYNA 1IPSA 1OLQA 1OD3A 1D4M1 4IEAA 3SMMA 4NPMA 1O6UA 4BM8A 3LIGA 3HQUA 3J8F2 4MXWB 1RTVA 4CCCA 1RUC1 4LJHA 2H0BA 2RS33 4XTPA 3EXUA 1GZ9A 2A3WA 5F32A 2P2KA 3H0OA 4AFDA 3WUCA 1W6PA 3ZFEC 4FFFA 4EYUA 4GH4C 1H0BA 1GNYA 4LKEA 5AC93 4PLNA 2CNAA 5A3MA 4BYYA 1RUOA 1RUF2 2WNEA 4ORFA 4FAHA 4ZS3A 3DEMA 2YGMA 4E2SA 4LO7A 2Y64A 3WQ7A 2B8MA 2CWSA 3UALA 1HRI1 2WS91 4WM8C 4CYDA 2ZJCA 1LJ7A 4QXCA 1H1MA 3LE0A 4X8PA 5FO9B 4RQPA 1P8JA 4DHQA 1AL22 2VM9A 1AXKA 5F5QA 1QOSA 5CFCB 2W92A 4AFCA 4RHV2 2OXBA 3LA3A 4YM2A 1F4AA 5IAVA 3UGGA 3EFZA 1VBOA 2PHXA 5C3SA 3RGBA 1DQ5A 2N7GA 3N9LA 1MZ6A 5A1AA 1OA3A 3RFRA 4K1ZA 4AEKA 3TEWA 3ES4A 1VBPA 3KQ4B 4RS5C 1VBD3 1DYPA 2E31A 3CBNA 4KBBA 4N43B 1QU0A 5CISA 5JXJA 3SPRA 1YYNA 2A73B 2HYXA 3HIFA 4PIKA 1W28A 1PO13 2QQKA 5FAXA 4M3CE 4Q4Y1 1UH1A 3ZPOA 3OBZA 1G6NA 1HN0A 4OZXA 3UJQA 4EN8B 3VZKA 5C4WA 1BVVA 5FO7B 5J51A 4MZUA 5FY0A 2P3IA 2HWE2 3OYWA 4IEYA 4Z07A 2Q5TA 1IQAA 5DG2A 4AR2A 2W47A 4J1WA 5CFCC 2RE9A 2RS52 1G9DA 3AQGA 2E26A 4YVSB 2VTFA 4IESA 3ABZA 1RUJ1 3GZAA 3BPZA 1HQNA 1VAKA 5DPNA 4DHPA 3WR0A 1N1YA 1S2KA 4QX8A 1W0NA 2NUOA 3SCGA 4BOWA 4LUMA 1DCSA 4D7SA 2C1NA 1R1ZA 2WO7A 3J7MA 1PHMA 3P6BA 2WIIB 4M00A 4Q4V1 2PXJA 1F9KA 1D4VB 1DGRN 1UOJA 4MLOA 3I4RA 1BQPA 1U5IA 2P17A 3V64A 3ZYJB 3WEZA 4XHBA 3R51A 3AB0A 5F5CA 3TNPB 4ASLA 4AI8A 1TE1B 1JODA 3I59B 4NHYA 2K46A 1VBA1 2RS31 4QX2A 2WR9A 4QPIB 4B3NA 4FQ4A 3TNQA 4OHZA 3RPQA 3ECQA 2IXHA 5FOJB 3B00A 3NAPB 4A4AA 3K77A 1J83A 3OSDA 4YVSC 4AXOA 2JDHA 2JDUA 1JOPA 2QQMA 4UFKA 5AC91 4Z92B 2DTWA 1V6IA 1VP6A 4KH9A 3GYDA 3T0BA 1LNSA 1ENXA 4A6SA 4IE7A 4Q29A 2D5FA 4CDXB 2QVSB 1AHSA 5FJKA 5JZGA 1JZ8A 2YUEA 1SBDA 3RWKX 3NKTA 4AFBA 2NM1A 2ADEA 2V4VA 3I97A 3TOWA 2BGPA 5I93A 3UESA 3BTXA 3ZYBA 3QBQA 1REEA 2VR4A 2VNRA 3NAPC 3WVJA 3AP6A 1N3OA 1QKQA 3W5NA 3LLZA 4ZU7A 1JN2P 3ZSMA 1IS4A 4P9WA 5KBFA 4X6QB 2MEV3 3FUOA 5FZEA 1PO11 2DUOA 3NJZA 4CU9A 1EP0A 2EAKA 4FCAA 4P5HA 5F39A 3VBRB 1CQ9A 4Y4RA 1UZVA 4PCRA 3AKPA 1SLIA 2G9FA 4D8MA 3SCHA 4M0HA 3VBOB 1LOCA 5CKMA 4HK9A 4DUVA 1I5PA 4DHRA 1UYZA 1FV3A 3I54A 1U5YA 4FL5A 1PIV2 3OJBA 1JOBA 4PT6A 3O12A 4CXYA 1XSQA 4M3CF 4XUQA 2CWMA 1JI6A 4COUA 1OQEA 5A3OA 4BQ2A 4HVOA 3W20A 1J59A 2ZACA 3OBAA 5HXVA 2LROA 3SISA 3HT1A 3IQJA 1QJU3 3VBFB 3ETQA 1O3QA 2WABA 4OHVA 4Y1XA 3IDBB 3MBWA 2TBVA 4W50A 2ZCWA 2ZX4A 3NV1A 4ZONA 3IPVA 3ZDSA 5A3TA 2E7TA 3AYEA 5ACA2 4EQVA 1DDLA 1OUWA 4B4RA 2PAMA 3VUOA 4TN7A 2R49A 3ZYRA 4KGGA 3G7DA 4QPGA 5FUNA 3WD5A 4P14A 4CU6A 1UX6A 4OULA 3N4MA 4BISA 5KHJA 2YGLA 4YW1A 4OI1A 4Y24A 1H2MA 2R062 4P5YA 1W04A 1LOAA 1NCRC 3X29B 1XNTA 1RINA 1RHI3 1O8SA 2ARAA 1DGRA 1RITA 2ZGMA 5JXIA 1G9AA 2RR13 3UT0A 3KMHA 1JYTA 1W2AX 3NKXA 3FFZA 3FC0A 4FPEA 5F5IA 1MS4A 4Q27A 4CA9A 4M01A 1O3TA 1IG0A 1OLMA 3MIHA 3FLPA 3ON7A 5A70A 1PGW1 2EALA 2FMYA 1VE0A 1XNDA 1UL9A 2OQ6A 4GZ9A 2YC4A 3AJYA 2PTMA 1Z7S1 5APAA 1BZWA 1AUYA 2WQ8A 3NSTA 2O0OA 3NV3A 4M3CB 3IZOA 3T0LA 2JG9A 5ABJC 4YVWC 5BNOB 3I3MA 1ACCA 2FHRA 3POWA 1B35A 3IDAA 4XTMA 3KV4A 3VGIA 1BEV3 5H9QA 2Y6JA 1C8M1 2XH6A 3BTYA 1O3RA 1YFWA 3GM8A 1FOD2 3KVBA 1GYKA 1BBT1 3MUY1 3CZUA 1WUVA 3CF6E 1T2XA 4LHLA 4AKBA 1Q8OA 4GMP1 1AR81 1DGLA 3PIJA 3V0BB 5FZOB 4FFIA 3THDA 3WG1A 4AFAA 4DOUA 1E5SA 3N9MA 4NHLA 2WFPA 1NKGA 1VB2A 1KITA 3I2DA 4B4PA 1JZ6A 3H1MA 2NQYA 5KHIA 1TME2 3HBKA 5E6HA 5BNOC 4Y32A 4CDUB 1HRV3 3WG4A 3M3IA 2JIGA 2F17A 1QJU2 1ND2A 1ZBA3 3SMNA 1GUIA 2YY1A 1WD3A 4AGVA 4FOYA 3RNSA 4BH9A 5AFBA 1RUE2 1ULDA 3JBG2 2PHLA 4CRQA 3C7OA 3P1IA 1DQ0A 3BIEA 3VY6A 1W8TA 3PTRB 3OD0A 2CU5A 4MXVA 3VBSA 1TVGA 3ETPA 4AG4A 3O1UA 2D3RA 1GZTA 2W1WA 4AVSA 1DQ1A 5FZ1A 4O46A 2JXAA 2W1QA 2YPDA 2XVKA 3HNMA 5A33A 1JYNA 4MGQA 3O0VA 4LBQA 4EZ4A 3IT8A 4N8MA 4CXXA 1WS5C 4JHTA 4TXWA 3LFIA 2BEOA 2JG8A 3ATGA 1RHI2 4CDUC 2RR12 1O9EA 2QCSB 4BIFA 4YYOA 3I2FA 4LQRA 2VZUA 4CP1A
chains in the Genus database with same CATH topology
5IHRA 3HN3A 2VCBA 1OF4A 5EIYB 4M4RA 2R7EB 3F2ZA 1D7PM 1JZ4A 2W9XA 5JMOA 3SKJE 4DXSA 4D0QA 1WKYA 1GQPA 3NNGA 1UXXX 2WZEA 2X10A 3T2QA 4A3ZA 4ZXEA 3AC0A 3CDZB 1TG7A 3OGVA 3LPFA 2ORZA 2WUHA 3C7GA 4QAWA 3VD4A 2YG0A 4L0PA 4XUTA 3T2OA 1UX7A 4ARYA 3K4ZA 1UYYA 4GWJA 2VOTA 3J7HA 2CDPA 4CUCA 1SHWB 2J1AA 1UZ0A 1JHJA 4BDVB 2JE8A 3HEIA 3NRUA 1EUTA 2W3JA 4FI9A 2EIBA 4PQQA 2RJ2A 5G05L 1JZ2A 2QQOA 5F7UA 3OG2A 1UY3A 2BBAA 4JKLA 3WSOA 2ZXQA 4P00B 4OMDA 4KI5M 4QX3A 3GXUA 2WN2A 2WYSA 1PX3A 1F4HA 2VCAA 1US2A 5IJRA 4RYDA 4BXSV 3WF2A 1MPXA 3A22A 3I2GA 1CZVA 5LCWL 3T0AA 1UYXA 1NUKA 3C7HA 2QQIA 4UAPA 3BGAA 3T0DA 3WQBA 5FUIA 3LPGA 2VL4A 2OKXA 1GOHA 4A45A 2C4XA 2DCJA 3I2KA 4ZZ8A 1PMJX 2Y6GA 1UMIA 3MV11 2B9VA 2JD9A 1SDDB 1XNAA 5C7GA 2EIEA 3BN6A 2E32A 4MGSA 1XC6A 4UI9L 2ZEYA 4OUEA 4CU7A 2EICA 3MV01 3CZJA 2QBXA 1K12A 1UXZA 3FN9A 3DECA 4ZY9A 3HNYM 3X0UA 4DUWA 2E33A 5JUVA 2KD7A 4ARXA 2EIDA 4MO3M 1OF3A 2YB7A 4HG6B 2W91A 2Y6LA 1JU4A 5IFPA 3UNPA 2YFZA 4QB6A 3EYPA 4LKSA 4DEQA 2RVAA 1W9SA 1K45A 5G04L 1H6XA 1W99A 3T09A 2DDUA 4IUGA 3GGLA 4LPLA 3A23A 2VZPA 3I3EA 4CVUA 3OGSA 5CYYA 2YC2A 2J1VA 2WO3A 3FL7A 3CIHA 4W8JA 4ET7A 3ZM8A 1DP0A 3IIIA 5LA1A 1NAEA 4JHZA 3LEKA 4XUPA 1CIYA 4QDQA 3WF1A 4QDRA 2J1SA 2VZ1A 1JZ5A 1CX1A 3WF0A 4ZZ5A 4JKMA 3VDAA 4QX0A 2DCKA 4E8CA 4XVHA 4TTGA 3K4AA 1UY4A 3OB8A 1JYWA 2X05A 5B4NA 3NQHA 1KGYA 3IAPA 2W46A 1UMHA 2WAOA 2VQTA 3CQOA 3EB7A 2QQJA 3CKHA 4BK5A 1OD3A 4QDSA 3NJXA 2WO2A 2BERA 1K42A 2LS6A 3NJVA 3DYMA 3MO4A 4LHSA 5I0DA 3U37A 2Y6KA 3T2PA 5HPOA 2X09A 1UWWA 2B4KA 3PUIA 5JR2A 4BK4A 1GNYA 4QB1A 2Y64A 1J84A 2BZDA 3LE0A 1HN1A 3I3DA 3IAQA 1P8JA 2VM9A 2W92A 4CU8A 5EJ1B 3OEBA 3SKVA 4E8DA 4DXTA 1F4AA 3DYOA 3LEGA 5A1AA 1W9WA 4XURA 5J1XA 2V72A 2E31A 3HJRA 5JXJA 4QPWA 2HYXA 3WNKA 2QQKA 3D3AA 1JYXA 2WZ8A 3VDCA 3T08A 3W5MA 5B4XA 2WAAA 3ACFA 2JDAA 2W47A 2E26A 3FHQA 2VTFA 3ABZA 4OYUA 2W1SA 1SG3A 2W1UA 5DPNA 2XHNA 2C26A 2VZTA 2VC9A 3GDBA 4CUAA 1W0NA 5C71A 3ACHA 2VMCA 1IQDC 2W5FA 1UY1A 3P6BA 3K75B 2W95A 2J7MA 2BGOA 3C8XA 3WEZA 2YFUA 3WNPA 5HXMA 1XPWA 4XUNA 2WDBA 4QX2A 2RV9A 5DQ0A 1PX4A 4XZUG 3ECQA 5LA0A 1OH4A 4A4AA 3WNOA 4A6OA 3K77A 1J83A 4A42A 2W87A 1WCQA 1CZTA 2VZSA 1L7RA 2QQMA 3A7QA 3CMGA 3JXSA 1O8PA 3MUZ1 2QQLA 3T0BA 3K4DA 2V5DA 1LNSA 1GMMA 1BHGA 1W8NA 1JZ8A 3DYPA 2V4VA 3I97A 4A44A 2BGPA 5C70A 4QX1A 1DLCA 3UESA 1OT5A 2J1UA 3WF3A 1ULPA 2QQNA 2VR4A 2CDOA 3I2HA 3W5NA 4A41A 2VZVA 4DUXA 2WO1A 2VCCA 4KMQA 4CU9A 2C9KA 2XOMA 3K46A 4JX0A 3HOBA 4OZOA 4Z2AA 4D8MA 1K3IA 1W9TA 3C7EA 4P02B 1JZ3A 1JU3A 4DUVA 1I5PA 1UYZA 3VD9A 1GU3A 4PT6A 3UETA 1JYVA 3I3BA 5LA2A 4XUQA 1JI6A 3LEIA 3ACGA 4YPJA 3OBAA 2VZQA 3WNMA 1UY0A 2WABA 3MBWA 2ORXA 4W50A 1KEXA 2Z4FA 2VZRA 4W4ZA 1L7QA 3A21A 4CU6A 2LW8A 2VMDA 2J1EA 4M4PA 3THCA 1EUUA 4P5YA 3LQCA 5JXHA 1XNTA 2JKXA 1UY2A 4OMCA 2VJXA 1YQ2A 1O8SA 5DMYA 3HNBM 5JXIA 2ZEZA 3WNLA 3I2JA 5JXGA 1JZ7A 4GZ9A 1DYOA 2VO5A 4GWIA 2YC4A 4UOJA 4KWUA 3IB3A 2WQ8A 3OEAA 4MADA 1CZSA 3IDAA 1GOFA 3C7FA 1H6YA 2Y6JA 4JKKA 4XUOA 2W94A 3GM8A 4BJ0A 5IFTA 3OGRA 1PMHX 3MUY1 3CZUA 2XONA 3SEEA 1T2XA 1W8OA 2VMEA 2VQUA 2Y6HA 2L9LA 2WBKA 1NX9A 3THDA 1O59A 3VD3A 2VZOA 1NKGA 3FHAA 4DEVA 5IYYA 2ZEWA 1RYYA 1JZ6A 4AAXA 2VZ3A 3PUHA 5DN2A 1GOGA 3SEPA 2XQXA 2Y8KA 2J22A 3WF4A 4DXRA 4PF1A 1GUIA 5EJZB 2J1TA 4P08A 3C7OA 3P1IA 4MOAA 3VD5A 4CUBA 3VDBA 2ZEXA 2PQSA 1TVGA 3ETPA 2VMFA 4AG4A 3I2IA 2W1WA 1ULOA 2HLEA 4RN5A 1R64A 2W1QA 3HPNA 3HNMA 1JYNA 3WNNA 4MGQA 4QB2A 3VD7A 3E1F1 4TXWA 5CZKA 1US3A 2J1RA 2WN3A 3I2FA 4LQRA 2ID4A 2VZUA 3ACIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHR A;  3HN3 A;  2VCB A;  1OF4 A;  5EIY B;  4M4R A;  2R7E B;  3F2Z A;  1D7P M;  1JZ4 A;  2W9X A;  5JMO A;  3SKJ E;  4DXS A;  4D0Q A;  1WKY A;  1GQP A;  3NNG A;  1UXX X;  2WZE A;  2X10 A;  3T2Q A;  4A3Z A;  4ZXE A;  3AC0 A;  3CDZ B;  1TG7 A;  3OGV A;  3LPF A;  2ORZ A;  2WUH A;  3C7G A;  4QAW A;  3VD4 A;  2YG0 A;  4L0P A;  4XUT A;  3T2O A;  1UX7 A;  4ARY A;  3K4Z A;  1UYY A;  4GWJ A;  2VOT A;  3J7H A;  2CDP A;  4CUC A;  1SHW B;  2J1A A;  1UZ0 A;  1JHJ A;  4BDV B;  2JE8 A;  3HEI A;  3NRU A;  1EUT A;  2W3J A;  4FI9 A;  2EIB A;  4PQQ A;  2RJ2 A;  5G05 L;  1JZ2 A;  2QQO A;  5F7U A;  3OG2 A;  1UY3 A;  2BBA A;  4JKL A;  3WSO A;  2ZXQ A;  4P00 B;  4OMD A;  4KI5 M;  4QX3 A;  3GXU A;  2WN2 A;  2WYS A;  1PX3 A;  1F4H A;  2VCA A;  1US2 A;  5IJR A;  4RYD A;  4BXS V;  3WF2 A;  1MPX A;  3A22 A;  3I2G A;  1CZV A;  5LCW L;  3T0A A;  1UYX A;  1NUK A;  3C7H A;  2QQI A;  4UAP A;  3BGA A;  3T0D A;  3WQB A;  5FUI A;  3LPG A;  2VL4 A;  2OKX A;  1GOH A;  4A45 A;  2C4X A;  2DCJ A;  3I2K A;  4ZZ8 A;  1PMJ X;  2Y6G A;  1UMI A;  3MV1 1;  2B9V A;  2JD9 A;  1SDD B;  1XNA A;  5C7G A;  2EIE A;  3BN6 A;  2E32 A;  4MGS A;  1XC6 A;  4UI9 L;  2ZEY A;  4OUE A;  4CU7 A;  2EIC A;  3MV0 1;  3CZJ A;  2QBX A;  1K12 A;  1UXZ A;  3FN9 A;  3DEC A;  4ZY9 A;  3HNY M;  3X0U A;  4DUW A;  2E33 A;  5JUV A;  2KD7 A;  4ARX A;  2EID A;  4MO3 M;  1OF3 A;  2YB7 A;  4HG6 B;  2W91 A;  2Y6L A;  1JU4 A;  5IFP A;  3UNP A;  2YFZ A;  4QB6 A;  3EYP A;  4LKS A;  4DEQ A;  2RVA A;  1W9S A;  1K45 A;  5G04 L;  1H6X A;  1W99 A;  3T09 A;  2DDU A;  4IUG A;  3GGL A;  4LPL A;  3A23 A;  2VZP A;  3I3E A;  4CVU A;  3OGS A;  5CYY A;  2YC2 A;  2J1V A;  2WO3 A;  3FL7 A;  3CIH A;  4W8J A;  4ET7 A;  3ZM8 A;  1DP0 A;  3III A;  5LA1 A;  1NAE A;  4JHZ A;  3LEK A;  4XUP A;  1CIY A;  4QDQ A;  3WF1 A;  4QDR A;  2J1S A;  2VZ1 A;  1JZ5 A;  1CX1 A;  3WF0 A;  4ZZ5 A;  4JKM A;  3VDA A;  4QX0 A;  2DCK A;  4E8C A;  4XVH A;  4TTG A;  3K4A A;  1UY4 A;  3OB8 A;  1JYW A;  2X05 A;  5B4N A;  3NQH A;  1KGY A;  3IAP A;  2W46 A;  1UMH A;  2WAO A;  2VQT A;  3CQO A;  3EB7 A;  2QQJ A;  3CKH A;  4BK5 A;  1OD3 A;  4QDS A;  3NJX A;  2WO2 A;  2BER A;  1K42 A;  2LS6 A;  3NJV A;  3DYM A;  3MO4 A;  4LHS A;  5I0D A;  3U37 A;  2Y6K A;  3T2P A;  5HPO A;  2X09 A;  1UWW A;  2B4K A;  3PUI A;  5JR2 A;  4BK4 A;  1GNY A;  4QB1 A;  2Y64 A;  1J84 A;  2BZD A;  3LE0 A;  1HN1 A;  3I3D A;  3IAQ A;  1P8J A;  2VM9 A;  2W92 A;  4CU8 A;  5EJ1 B;  3OEB A;  3SKV A;  4E8D A;  4DXT A;  1F4A A;  3DYO A;  3LEG A;  5A1A A;  1W9W A;  4XUR A;  5J1X A;  2V72 A;  2E31 A;  3HJR A;  5JXJ A;  4QPW A;  2HYX A;  3WNK A;  2QQK A;  3D3A A;  1JYX A;  2WZ8 A;  3VDC A;  3T08 A;  3W5M A;  5B4X A;  2WAA A;  3ACF A;  2JDA A;  2W47 A;  2E26 A;  3FHQ A;  2VTF A;  3ABZ A;  4OYU A;  2W1S A;  1SG3 A;  2W1U A;  5DPN A;  2XHN A;  2C26 A;  2VZT A;  2VC9 A;  3GDB A;  4CUA A;  1W0N A;  5C71 A;  3ACH A;  2VMC A;  1IQD C;  2W5F A;  1UY1 A;  3P6B A;  3K75 B;  2W95 A;  2J7M A;  2BGO A;  3C8X A;  3WEZ A;  2YFU A;  3WNP A;  5HXM A;  1XPW A;  4XUN A;  2WDB A;  4QX2 A;  2RV9 A;  5DQ0 A;  1PX4 A;  4XZU G;  3ECQ A;  5LA0 A;  1OH4 A;  4A4A A;  3WNO A;  4A6O A;  3K77 A;  1J83 A;  4A42 A;  2W87 A;  1WCQ A;  1CZT A;  2VZS A;  1L7R A;  2QQM A;  3A7Q A;  3CMG A;  3JXS A;  1O8P A;  3MUZ 1;  2QQL A;  3T0B A;  3K4D A;  2V5D A;  1LNS A;  1GMM A;  1BHG A;  1W8N A;  1JZ8 A;  3DYP A;  2V4V A;  3I97 A;  4A44 A;  2BGP A;  5C70 A;  4QX1 A;  1DLC A;  3UES A;  1OT5 A;  2J1U A;  3WF3 A;  1ULP A;  2QQN A;  2VR4 A;  2CDO A;  3I2H A;  3W5N A;  4A41 A;  2VZV A;  4DUX A;  2WO1 A;  2VCC A;  4KMQ A;  4CU9 A;  2C9K A;  2XOM A;  3K46 A;  4JX0 A;  3HOB A;  4OZO A;  4Z2A A;  4D8M A;  1K3I A;  1W9T A;  3C7E A;  4P02 B;  1JZ3 A;  1JU3 A;  4DUV A;  1I5P A;  1UYZ A;  3VD9 A;  1GU3 A;  4PT6 A;  3UET A;  1JYV A;  3I3B A;  5LA2 A;  4XUQ A;  1JI6 A;  3LEI A;  3ACG A;  4YPJ A;  3OBA A;  2VZQ A;  3WNM A;  1UY0 A;  2WAB A;  3MBW A;  2ORX A;  4W50 A;  1KEX A;  2Z4F A;  2VZR A;  4W4Z A;  1L7Q A;  3A21 A;  4CU6 A;  2LW8 A;  2VMD A;  2J1E A;  4M4P A;  3THC A;  1EUU A;  4P5Y A;  3LQC A;  5JXH A;  1XNT A;  2JKX A;  1UY2 A;  4OMC A;  2VJX A;  1YQ2 A;  1O8S A;  5DMY A;  3HNB M;  5JXI A;  2ZEZ A;  3WNL A;  3I2J A;  5JXG A;  1JZ7 A;  4GZ9 A;  1DYO A;  2VO5 A;  4GWI A;  2YC4 A;  4UOJ A;  4KWU A;  3IB3 A;  2WQ8 A;  3OEA A;  4MAD A;  1CZS A;  3IDA A;  1GOF A;  3C7F A;  1H6Y A;  2Y6J A;  4JKK A;  4XUO A;  2W94 A;  3GM8 A;  4BJ0 A;  5IFT A;  3OGR A;  1PMH X;  3MUY 1;  3CZU A;  2XON A;  3SEE A;  1T2X A;  1W8O A;  2VME A;  2VQU A;  2Y6H A;  2L9L A;  2WBK A;  1NX9 A;  3THD A;  1O59 A;  3VD3 A;  2VZO A;  1NKG A;  3FHA A;  4DEV A;  5IYY A;  2ZEW A;  1RYY A;  1JZ6 A;  4AAX A;  2VZ3 A;  3PUH A;  5DN2 A;  1GOG A;  3SEP A;  2XQX A;  2Y8K A;  2J22 A;  3WF4 A;  4DXR A;  4PF1 A;  1GUI A;  5EJZ B;  2J1T A;  4P08 A;  3C7O A;  3P1I A;  4MOA A;  3VD5 A;  4CUB A;  3VDB A;  2ZEX A;  2PQS A;  1TVG A;  3ETP A;  2VMF A;  4AG4 A;  3I2I A;  2W1W A;  1ULO A;  2HLE A;  4RN5 A;  1R64 A;  2W1Q A;  3HPN A;  3HNM A;  1JYN A;  3WNN A;  4MGQ A;  4QB2 A;  3VD7 A;  3E1F 1;  4TXW A;  5CZK A;  1US3 A;  2J1R A;  2WN3 A;  3I2F A;  4LQR A;  2ID4 A;  2VZU A;  3ACI A; 
#chains in the Genus database with same CATH topology
 1FMD 1;  5IHR A;  5BV6 A;  1NCQ A;  3HN3 A;  1QOO A;  4ZKT B;  4D6Q A;  2GNM A;  1OF4 A;  1W6Q A;  3VZJ A;  4XJ8 A;  5C9A A;  4LUL A;  4AYU A;  3KGL A;  4HMZ A;  3M3O A;  4Z82 A;  1HKD A;  2QZ3 A;  2A6X A;  2DV9 A;  3ROU A;  5BUV A;  1JZ4 A;  3DL3 A;  3CL1 A;  3AM2 A;  1ZBE 3;  1BLZ A;  3FHI B;  5A3U A;  1QF3 A;  3LEM A;  1OSG A;  4D0Q A;  1WKY A;  3SMK A;  4R4Z A;  1S0E A;  2RJK A;  1R09 3;  1WW5 A;  2X10 A;  4RR3 A;  3D5O A;  2P6C A;  3U0Z A;  1BEV 1;  4A3Z A;  5BY9 A;  4BG6 A;  4O9G A;  1BKZ A;  3AC0 A;  3CDZ B;  1DZQ A;  4L99 A;  5JR7 B;  4Y4Y A;  4E4S A;  1W6P B;  2CAV A;  2WWU A;  3OGV A;  1XE0 A;  3LPF A;  2H0V A;  1XU2 A;  4MGT A;  2XKO A;  1SBF A;  2HEY F;  3AL5 A;  4RFR B;  3W59 A;  5J96 B;  4YG6 A;  4X6R B;  5DUV A;  1OD5 A;  2YG0 A;  1WLD A;  3PVN A;  4LBO A;  4N90 A;  1M06 G;  1PK6 A;  5A7O A;  1C5I A;  3F95 A;  1TNF A;  5FV3 A;  2Y0O A;  4LT5 A;  2HWF 2;  1UZ0 A;  1W8H A;  4CDQ C;  1ULC A;  4RQP B;  4XXP A;  5LY2 A;  4QXH A;  1SFY A;  1SPP B;  5FQ0 A;  2BN0 A;  1WS4 A;  1NLQ A;  1VRH 1;  2EXK A;  4PQQ A;  2AEY A;  5GJ6 A;  3LWC A;  5DZE A;  2DCY A;  2RJ2 A;  3VY7 A;  1OLM E;  2WJS A;  3WXP A;  2BMY A;  1Y7B A;  1WA4 A;  3SH4 A;  4CDW C;  5IK8 A;  1JUI A;  2ZPX A;  3N7J A;  1UMZ A;  4NRM A;  1LGC A;  3OG2 A;  4YWA A;  1UY3 A;  1ST8 A;  3MIF A;  2C9A A;  5CFD A;  5JOZ A;  4JKL A;  1DZT A;  2LM3 A;  3H8R A;  2BUK A;  2ZXQ A;  3ZR6 A;  4AED C;  4NPL A;  3CJX A;  4QHB A;  4KI5 M;  4B29 A;  4YFW A;  3CNA A;  2OII A;  3H7J A;  3H7Y A;  2C23 A;  1JH5 A;  5C4W B;  1YNA A;  2WT0 A;  3ACL A;  1SMV A;  1VJ2 A;  2FQP A;  1SDW A;  4AWD A;  1FX5 A;  3RYP A;  3VKN A;  2WYS A;  1IZ3 A;  5FK7 A;  2O02 A;  1ULF A;  1CGP A;  1OOP C;  3KD4 A;  4K6B A;  3H8X A;  3LDB A;  1DIW A;  1US2 A;  4LIT A;  3LL0 A;  3ZKY A;  2BWC A;  2GZW A;  1MPX A;  1VBC 2;  2VU9 A;  3Q8A A;  2XR4 A;  4TSV A;  2BQ0 A;  2HEV F;  4AQS A;  1UGW C;  4XMA A;  2GUC A;  3WDT A;  5FTT C;  1MS5 A;  1FXZ A;  1GQG A;  5EFU A;  4YZ4 A;  3ZFF A;  4SBV A;  1NUK A;  1DBN A;  4GMP 0;  3BGA A;  3WQB A;  5FUI A;  3BAL A;  3H3L A;  2VQA A;  4CPB A;  3SH3 A;  2EVX A;  1S0J A;  4A45 A;  1ZBE 1;  4YM0 A;  2C4X A;  2R04 2;  3D0J A;  4Y20 A;  1R09 2;  5EHD A;  2FZ1 A;  5H9S A;  1XB9 A;  5FKC A;  1UMI A;  3VDD A;  3G6J B;  2XBO 3;  4CCM A;  3EHK A;  2RMU 2;  2JD9 A;  1GKB A;  3GZE A;  1LR5 A;  1XNA A;  4AI3 A;  2EIE A;  3BN6 A;  2WLQ A;  5FY9 A;  1QNY A;  3NWK A;  4LKF A;  4LLF A;  1W2T A;  4BQY A;  4UI9 L;  5FRE A;  4YM3 A;  3JCI A;  2PLV 2;  4E2G A;  1F8V A;  1K12 A;  4XAB A;  4IEZ A;  1IB1 A;  5LK5 A;  3FN9 A;  1COV 3;  1I6X A;  4P9Y A;  1DGW A;  1HB1 A;  2VNG A;  2VTX J;  1UN1 A;  3NNJ A;  2E33 A;  3WW2 A;  3ZYF A;  3KLS A;  4SLI A;  1SLL A;  4XJA A;  4NII A;  1UH0 A;  3IIA A;  4PI0 A;  1KFU L;  2OVU A;  2YB7 A;  4HG6 B;  2W91 A;  5JZG B;  3ZSJ A;  5F3C A;  2GTY A;  2JZ4 A;  1EV1 1;  1X1V A;  1W05 A;  3SC7 X;  5J98 B;  4ZHN A;  3DF0 A;  1O4Y A;  4JDD A;  1YFU A;  3GJB A;  3RWN A;  1A8M A;  4ASK A;  5CEH A;  5DAV A;  4GKY A;  2XKP A;  1K45 A;  4Q4X 1;  1H6X A;  5G04 L;  1VMJ A;  1ZRR A;  3T09 A;  3TN9 3;  1ZRD A;  1W6N A;  1UAI A;  1VR3 A;  2OX0 A;  2OW4 A;  4DIN B;  1J4S A;  2ZMK A;  2VH9 A;  3P3N A;  4IER A;  3JD7 3;  3SCF A;  4AHZ A;  2JKB A;  3E6C C;  3TEY A;  1GQH A;  1KRI A;  1O7F A;  4MYE A;  3KCY A;  2PHT A;  2P37 A;  1QWR A;  1S0B A;  1X7N A;  1ZM1 A;  3N9Q A;  5JZG C;  1WCD J;  3WUD A;  1VBE 1;  3UKV A;  1V6J A;  2R16 A;  3III A;  4AFM A;  5JOW A;  3PVB B;  2P6H A;  4NJ4 A;  2HWB 3;  2VW1 A;  3LSD A;  3IDE A;  3S7E A;  2ZA9 A;  4XUP A;  1NT0 A;  4J6G A;  3V65 A;  4QDR A;  1VMO A;  3ZXL A;  1MS9 A;  2PQQ A;  2NPI A;  2VZ1 A;  1Q3E A;  1RGS A;  1XU1 A;  3T1M A;  2BFU S;  1TEI A;  2EXH A;  3PVE A;  1JZ5 A;  5FXZ A;  4JGY B;  1SEF A;  2UY8 A;  3WY6 A;  5JVV A;  4QX0 A;  4E8C A;  3GCX A;  1S1A A;  2RHP A;  3K4A A;  1MAC A;  1UY4 A;  3OB8 A;  1S2E A;  5EV7 A;  5IT6 A;  5FZ9 A;  3UX0 A;  3E6Y A;  4XF9 A;  4PBP A;  4QPG B;  4UFM A;  5F3E A;  5B4N A;  2YDE A;  1IGO A;  2O1Q A;  4LOR A;  2XBO 1;  4Y1U A;  5FOB B;  5EYY A;  4NAM A;  1GAN A;  2W46 A;  4CXW A;  4LE4 A;  4IEQ A;  4I02 A;  3MGU A;  1SZB A;  1WLW A;  3UV9 A;  5KXD A;  4RFT 0;  4UFH A;  1A34 A;  4IV3 A;  2RDQ A;  3WP4 A;  1HIX A;  1COV 2;  5FMD A;  3S0M A;  3NJX A;  4AHX A;  3ZIW A;  1ZYB A;  2RDR A;  5GAL A;  3M7A A;  4DNK A;  5LRR A;  4XHX A;  5DZG A;  2PEL A;  3RJ2 X;  4JGY C;  1OC1 A;  5LU2 A;  2GMM A;  4LHS A;  5FZA A;  2Y6K A;  2R07 3;  1OXC A;  4KWJ A;  3RZG A;  2D6K A;  3AXE A;  3HWJ A;  4XC9 A;  2VVF A;  3WZ1 A;  3SML A;  2ZX3 A;  4XIL A;  2NMO A;  3TYJ A;  3MIV A;  5FMO S;  3O8I A;  2VOK A;  2XDV A;  5JR2 A;  4OI0 A;  4FOQ A;  2PHU A;  3DKQ A;  3POS A;  1H1A A;  2VTX A;  2WA3 A;  3JZV A;  4KU7 A;  3WP3 A;  4QB1 A;  4N84 A;  2JG9 B;  4IL7 A;  3JQX A;  4HN0 A;  4ITC A;  2PFW A;  2HWD 3;  5A7N A;  1UQX A;  5FZH A;  3DXT A;  4GB3 3;  1YZ5 A;  1TNR A;  4I0W B;  4K20 A;  2BZD A;  4AOC A;  1CWP A;  4DAU A;  1GFF 2;  4AI2 A;  4CU8 A;  3JD7 1;  3RS6 A;  2QQW A;  2CGN A;  5D2A A;  2VMI A;  4A7Z A;  4CPB D;  4DXT A;  4GA9 A;  4E8D A;  4XPV A;  3O1P A;  2FDG A;  5FMB A;  1LHW A;  1N1T A;  1OH3 A;  2TNF A;  3T4H B;  1KFX L;  1DF0 A;  4A7Y A;  4CP0 A;  2ZX0 A;  5J1X A;  1AYN 1;  5IVY A;  5A80 A;  2HWB 2;  2V72 A;  5EQU A;  2WZR 3;  1WME A;  3HJR A;  4QPW A;  1W3X A;  2J42 A;  3WNK A;  3K3N A;  1TOQ A;  1XBF A;  2KXL A;  3NMB A;  5A6Z A;  4CTE A;  3WOC A;  2GN3 A;  1PM7 A;  3ZVX A;  4QQO A;  4BA6 A;  4QGN A;  1PVC 3;  2HWC 3;  1W90 A;  3L9J T;  1DGW X;  2XJP A;  3W5M A;  1GP6 A;  3ACF A;  2RG4 A;  1CPM A;  2VOW A;  4E2E A;  1D4M 3;  4O9E A;  4OQ9 A;  4AKD A;  1BJQ A;  3AYD A;  3VBS B;  2WNO A;  1MQT C;  5IW0 A;  4XMI A;  5B2G B;  4QQH A;  2DUQ A;  2W1S A;  1RUC 3;  2XJS A;  2W1U A;  3NNF A;  3NV2 A;  4Q0P A;  3RRD A;  5C33 A;  3GCW A;  3W58 A;  3GDB A;  1CVN A;  4LHK A;  4QD2 A;  4DRR A;  4LBQ B;  3JB8 A;  3ACH A;  4NOT A;  3H8U A;  2VMC A;  4MGZ E;  3VKL A;  2SLI A;  5C3O A;  5C3Q A;  2W95 A;  3PIG A;  2PHW A;  4KU8 A;  1N1V A;  3KV6 A;  3U14 A;  3IDC B;  1URX A;  2BGO A;  1UGY A;  1RUH 3;  2YFU A;  1X50 A;  1AJK A;  4K3U A;  2WS9 3;  5DDJ 3;  5D2D A;  5C9A B;  5FYY A;  2R07 1;  3LM1 A;  1O9F A;  2GND A;  1YHF A;  4N7Y A;  3VZN A;  2WZP P;  3WNO A;  2C0Z A;  2XJR A;  5D8A C;  4A42 A;  3Q9O A;  1WCQ A;  3T3Y A;  4U2A A;  3A0N A;  4H2A A;  3CMG A;  5HCA A;  4NN0 A;  3JXS A;  3GHM A;  1H8T A;  4C91 A;  2HWD 1;  4COW A;  3K4D A;  3R4D B;  4GJY A;  4AK3 A;  1GMM A;  4GB3 1;  1BHG A;  1RMU 1;  2JDY A;  3RI8 A;  5JSO A;  3PUA A;  1GNZ A;  5FR3 A;  1NA1 A;  4FO9 A;  4OQ8 A;  2EAA A;  5LBF A;  5BNP A;  1EYB A;  2CV6 A;  2KM2 A;  4A44 A;  4COY A;  1WLC A;  1ODN A;  1QQP 3;  2P3K A;  4XEZ A;  3ST7 A;  4QX1 A;  1DLC A;  4NRP A;  1OT5 A;  4OI2 A;  2XL7 A;  3WF3 A;  1PK6 B;  1V6M A;  3RI9 A;  2BNN A;  1OI6 A;  3PUR A;  1YEW A;  1CAX A;  1PGS A;  3I2H A;  4AQ2 A;  2XHK A;  2B42 B;  4EN7 B;  3ASI A;  3FLT A;  3MW4 A;  4W6X A;  4A41 A;  2HYR A;  4LBK A;  2VZV A;  4DUX A;  2E9Q A;  1FYU A;  1OMI A;  1RUJ 3;  4ATE A;  3SIT A;  2K9Z A;  1W2U A;  2AC1 A;  4NIA A;  4ATF A;  3FX3 A;  1CD3 G;  1PVC 2;  2A1X A;  2XJV A;  3OBR A;  1AYM 3;  3PJQ A;  2HBU A;  2Z42 A;  4IV1 C;  1RUD 3;  2HWC 1;  2I45 A;  3HOB A;  4CCD A;  3OGJ A;  1W9T A;  4BQ5 A;  3A0K A;  3ALQ A;  4YZ1 A;  5A3L A;  5JOY A;  4GNT A;  2GNB A;  1UIK A;  4Q4V 3;  1IPJ A;  3IQV A;  1LOD A;  1PZ9 A;  4AVA A;  2BV4 A;  4NVP A;  3LL2 A;  3KVA A;  4NID A;  3VBU A;  1RUC 2;  4NHX A;  3I3B A;  1XXQ A;  2Q1F A;  2ZGR A;  4JGZ B;  4Y1Y A;  1VBA 3;  4YPJ A;  2VZQ A;  3WNM A;  3U4S A;  2C74 A;  1CAU B;  4LOS A;  5L7O A;  1NY7 1;  2ORX A;  2Z69 A;  4QM9 A;  4WRQ A;  4Y1Z A;  4MG2 A;  1KDM A;  2G19 A;  1UKG A;  3WG2 A;  3VBH A;  1TQ5 A;  4AI9 A;  2Z4F A;  5SV8 A;  1TMF 1;  1W0P A;  1G86 A;  5IK5 A;  2LW8 A;  1SLB A;  2OQ7 A;  3DKW A;  1HRI 2;  2WS9 2;  4N53 C;  5C3P A;  1RUH 1;  4OUM A;  2J1E A;  1FNY A;  4M4P A;  3POG A;  4JDO A;  4ZPI A;  5DDJ 1;  2QQV A;  2CL2 A;  3THC A;  4R9C A;  4MHR A;  2Q0A A;  3RG0 A;  1V70 A;  4NAO A;  4MGK E;  2R6Q A;  5JXH A;  5CG8 A;  3J8F 1;  1HQW A;  2JKX A;  3K51 A;  3MF6 A;  5EWS A;  2IXK A;  1ASJ 2;  1UY2 A;  1S4C A;  2GH2 A;  2QDR A;  2R32 A;  4OMC A;  2VUA A;  1LOE A;  3N7M A;  1R1A 3;  5DMY A;  1KS4 A;  2BTV C;  2VW2 A;  2ZEZ A;  2ZAA A;  5CB7 A;  4JGZ C;  4UFI A;  4AE2 A;  3B02 A;  2ZX1 A;  5JXG A;  5HF3 A;  1JZ7 A;  3C3V A;  2FCV A;  1LTE A;  3FBY A;  2EF6 A;  3O7O A;  1WBL A;  2DYC A;  4XDQ A;  1WA6 X;  2FDI A;  2VO5 A;  3ZPY A;  2ZGK A;  3ZXK A;  4Q4Y 2;  3HVD A;  2Z5W A;  1YQ8 A;  2GC1 A;  4KL1 A;  3IB3 A;  4QX5 A;  4YGE A;  2B5H A;  4QKF A;  5CA6 A;  1QQP 1;  4X8N A;  2C5D A;  5K9Y A;  1YFY A;  2EXJ A;  2ZGQ A;  3POJ A;  2C63 A;  4OUS A;  2E7A A;  1AL2 1;  1NZI A;  5FYC A;  2XJQ A;  5L9R A;  1WLT A;  1GOF A;  1S2X A;  1X33 A;  2QZ2 A;  4NWV A;  1H6Y A;  1JYC A;  1SAC A;  2F4P A;  2QUO A;  4RHV 1;  5FLH A;  3UK9 A;  2XUM A;  4FPH A;  2JDZ A;  4XUO A;  2WH0 A;  5A7Q A;  1NOV A;  3T4V A;  3AZV A;  1RUJ 2;  1UZY A;  2XON A;  1QJA A;  2B7Y A;  4FXG B;  5E8A A;  2GUD A;  3ZXF A;  3H3U A;  2GH8 A;  2Y6H A;  4KBZ A;  1AYM 1;  4V2V A;  1LGN A;  3MIU A;  1RUD 1;  2CSG A;  4N43 C;  1LOF C;  5FZK A;  1MS3 A;  3SMO A;  5FYV A;  4NR1 A;  4CCJ A;  4AF9 A;  2TEP A;  1W6N B;  2D6M A;  4C8D A;  4DFS A;  3NJY A;  1IS3 A;  2VZ3 A;  3V56 A;  1OHF A;  2WNV A;  3RMX A;  2DUP A;  1HB4 A;  4AZZ A;  3CJI B;  5FPL A;  1UF2 C;  4UW3 A;  2RS3 2;  3ZXA C;  2DCZ A;  4N7I A;  1H2L A;  2RS5 1;  4YG3 A;  2Y8K A;  2J22 A;  4MX3 A;  4XET A;  3KGZ A;  1AR9 1;  3I49 A;  3MYX A;  1ENQ A;  2ZHN A;  1QJY 1;  2WFF 1;  5LX2 A;  5GZF A;  5AC9 2;  4XDO A;  2XQR A;  4LA3 A;  1XSR A;  4MOA A;  5JI7 A;  3VD5 A;  4CEW A;  1BMV 1;  1YUD A;  1ZZ9 A;  5DUX A;  1XNB A;  2BNO A;  1ULO A;  2HLE A;  4RN5 A;  5BPX A;  4AW7 A;  4NPR A;  3ZFG A;  5A3P A;  1UGX A;  4GWN A;  1KD7 A;  4YGD A;  5BNN A;  1LRH A;  2QKD A;  1SBE A;  2NN8 A;  2QTW B;  1K5M A;  5CZK A;  1WBF A;  1Z7S 3;  2ZHM A;  3RZH A;  1X8M A;  1GZW B;  3CJI C;  2WLP A;  1R1A 1;  2J1R A;  4I30 A;  2WN3 A;  3W9A A;  1RVF 3;  1JW6 A;  1JBC A;  2ID4 A;  1ENS A;  2QQU A;  3ACI A;  4UBG A;  5H9P A;  4ERO A;  4QPI C;  1E57 A;  1N3P A;  4IND A;  3RYK A;  4Q4W 1;  1DQ2 A;  4C1X A;  1C8M 3;  1VBD 2;  5LK7 B;  4F7Z A;  2ZAH A;  3U11 A;  3NV4 A;  4M4R A;  1AL0 G;  2R7E B;  1X82 A;  1PO1 2;  1BBT 3;  1S2B A;  2KR2 A;  3ILF A;  3KCX A;  3NW4 A;  4IEO A;  5KXC A;  5D3E A;  1VAL A;  2X29 A;  5JMO A;  1VIW B;  4CEY A;  5J4T A;  4GMP 3;  3VKF C;  1AR8 3;  1E5H A;  3PU3 A;  4Y26 A;  3OPZ A;  4C0B A;  2R0H A;  3NNG A;  4Y22 A;  1UXX X;  2WZE A;  4H7M A;  3H42 B;  4CDX C;  3KHC A;  1KUJ A;  5FXV A;  1CAV B;  4ZXE A;  2E6V A;  3E6D A;  3M3Q A;  3MIC A;  3O1R A;  2GP5 A;  3B5L B;  4K8R B;  1HV0 A;  4XF1 A;  5I0S A;  2NP0 A;  3WW3 A;  2X5I A;  5EXG A;  5T3N A;  2ORZ A;  2FDF A;  4XFI A;  4CSW A;  4BQ1 A;  3CQG A;  4Y1V A;  3VD4 A;  3ELN A;  1OUR A;  4L0P A;  4LA2 A;  4QU1 A;  4XUT A;  4DMI A;  1I3H A;  4ARY A;  4HAN A;  3P1S A;  3OUH A;  3K4Z A;  4GWJ A;  3WP6 A;  4CUC A;  4RGG A;  5L19 A;  3GZU C;  4JC1 A;  2BMZ A;  1XQN A;  2OS2 A;  2JE8 A;  3N7K A;  3VBR C;  3HEI A;  3RZM A;  4PF5 A;  4YW3 A;  3NRU A;  1UPI A;  2W3J A;  4FI9 A;  1LEM A;  2RDN A;  1ND3 A;  1OA4 A;  2XWB B;  1YWT A;  4IGQ A;  2D43 A;  3VBO C;  2ARX A;  1PIV 1;  2AH2 A;  2G9Z A;  4HPK A;  4P9G A;  3ZYI B;  5K0U B;  5C6C A;  4IW3 A;  4CCO A;  3AVS A;  2QQO A;  2ZX2 A;  1RB8 G;  3PME A;  4O7X A;  1LU1 A;  1UIJ A;  2CGO A;  2FCT A;  4AK4 A;  4LO4 B;  3OPT A;  3WSO A;  5FXX A;  1S0I A;  1FMD 3;  1D2Q A;  1QGL A;  2Y34 A;  4JVA A;  3AP5 A;  5EPA A;  4DNY A;  1QJE A;  1UD1 A;  3VBF C;  4URT A;  4QX3 A;  5C8C B;  3HMY A;  2B45 X;  4DXZ A;  1ALY A;  5CNA A;  5CAD A;  2HH9 A;  3OTF A;  1STM A;  4URA A;  1LAJ A;  4XF3 A;  3W21 A;  3ZYH A;  5EWZ A;  4RYD A;  4HSL A;  1RVF 1;  3WF2 A;  5F6K A;  5JWP A;  4PBO A;  3WW1 A;  4L8Q A;  2Q4S A;  3MLL A;  1EAH 1;  3M70 A;  5K0U C;  1OVS A;  2XUE A;  1C8M 2;  2B9U A;  3I2G A;  1CZV A;  3AK0 A;  5EXO A;  3KV5 A;  4AHY A;  2LUW A;  3TOJ A;  1Z78 A;  4ZS2 A;  3WX5 A;  5FPX A;  3RZK A;  3QLQ A;  1BBT 2;  2MEV 2;  2D6O X;  3DGT A;  2AAC A;  3GAL A;  2VL4 A;  5T5L A;  1KJL A;  4S2D A;  2VXR A;  2ATF A;  4FAG A;  1UU6 A;  2ZBJ A;  4DRV A;  4WVV A;  3ZN6 A;  1IKP A;  1VRB A;  4NIG A;  4OI4 A;  5C8C C;  1SLT A;  5IVE A;  2VQ0 A;  5BY5 A;  2ZTN A;  2HYQ A;  3M8L A;  4WM7 A;  3PLQ A;  2W2I A;  3O5S A;  4FQZ A;  4N9I A;  4UF0 B;  3OUJ A;  4XQ4 A;  4EWE A;  4MGS A;  5FYZ A;  1XC6 A;  4Q5O A;  4E4H A;  5KWR A;  1J4U A;  4CU7 A;  4QKB A;  2EIC A;  4XYX A;  1Y3T A;  1LGB A;  1POV 1;  2QBX A;  1VRH 3;  1SFN A;  3LD8 A;  4FOW A;  5FP9 A;  3P5B A;  4PIX A;  1UXZ A;  1LOB A;  2A3X A;  1AF9 A;  3DEC A;  1W9F A;  1BVP 1;  3HNY M;  2UWB A;  4DDN A;  5EZW A;  4DUW A;  2LAL A;  2ZGS A;  5JUV A;  2ERF A;  5EJ3 A;  1PO2 3;  2A6V A;  2HYK A;  2VBD A;  2KD7 A;  1ZX5 A;  1O9D A;  4ARX A;  2H6C A;  4PDW A;  4PIZ A;  3VKO A;  4MO3 M;  1NA1 B;  3NNL A;  2CGP A;  3VV1 A;  3U4X A;  5LBB A;  2YPJ A;  1I9R A;  1JU4 A;  4M0N A;  3U78 A;  2YFZ A;  2BNM A;  1YLL A;  3DUI A;  4Q8L A;  3HT2 A;  4BCU A;  3VLB B;  3EYP A;  4LKS A;  1APN A;  5D1I A;  4XF0 A;  1TME 1;  1WW4 A;  1VLN A;  4H55 A;  1D2S A;  1HQL A;  1V9U 1;  3P1N A;  5A32 A;  3LKJ A;  4W6Y A;  2D6L X;  2MNG A;  2VNO A;  1J1T A;  3DPR B;  4LO5 B;  5F3I A;  5FBZ A;  4IUG A;  2WNU A;  4CCL A;  2P3Y A;  1AXZ A;  3A23 A;  4BMB A;  1ZZ8 A;  5I0R A;  1W6M A;  4NHK A;  2YC0 A;  3OGS A;  3LCP A;  3AMM A;  4DZG A;  1H4G A;  1RUE 1;  3EBR A;  4R6P A;  3JBG 1;  4XFF A;  2WO3 A;  3CIH A;  2ZS6 B;  4S2F A;  1XOY A;  2R1B A;  4Q0U A;  4R6O A;  2XPJ A;  2D7F A;  1DP0 A;  1X36 A;  3VZO A;  2V7D A;  5T50 A;  3TWI A;  1CAW A;  3N35 A;  3ZYG A;  2GDF A;  3AFK A;  4CP2 A;  2H6B A;  4GAL A;  3LSE A;  4L2N A;  1G7Y A;  4QDQ A;  1BEV 2;  4YLZ A;  3K3O A;  5DAW A;  4D6R A;  1YJK A;  2J1S A;  1WCS A;  1CX1 A;  3DPR C;  4Q1R A;  1AR7 1;  4GKX A;  3MF9 A;  1O4T A;  4BZ4 A;  4OCT A;  4YAR A;  5IVC A;  5L7O B;  3H1W A;  3R52 A;  5JPM B;  1Q8Q A;  2DCK A;  4EN0 A;  1H30 A;  4XVH A;  4TTG A;  2VUD A;  2JEN A;  3VN4 A;  5BNQ A;  2Y33 A;  3VBH B;  2DVF A;  1RXG A;  4BXF A;  2IXC A;  5KR7 A;  3THP A;  1SCR A;  4XJZ A;  1RED A;  5T5J A;  3ME2 A;  1KGY A;  2DFB A;  4QX7 A;  1OPM A;  2VAU A;  2W52 A;  4IGO A;  2DF7 A;  2VPV A;  4Q0S A;  5E89 A;  3K2O A;  5FYM A;  2GMP A;  4AL9 A;  1VBB 3;  3CQO A;  1YI7 A;  5AFE A;  4LE3 A;  1VRH 2;  1EV1 3;  3EB7 A;  4DHO A;  3FJS A;  4HL0 A;  4GX7 A;  1HRV 2;  1REF A;  2RDS A;  1XNK A;  3LDR A;  3GBG A;  1QH7 A;  2IZW A;  1K42 A;  1ZBA 2;  2LS6 A;  3WDY A;  1MZF A;  3VHP A;  4MH0 E;  5F6L B;  3DYM A;  2BFU L;  1QXR A;  1XRU A;  4Q4X 3;  4UW5 A;  2K2S A;  1PO2 1;  3U37 A;  2VD7 A;  4IEX A;  1UWW A;  2IFR A;  4N7G A;  1QJZ A;  2B4K A;  2VUL A;  1UU5 A;  3N9O A;  5ERL A;  2Q1M A;  3ZN4 A;  2IFW A;  1JUH A;  2P1B A;  3IWZ A;  3LOI A;  4JZR A;  1R08 3;  1JAC A;  2VOX A;  4XFG A;  1LUL A;  2BU9 A;  4EN9 B;  5JSP A;  3DV8 A;  3ZFE A;  3I4I A;  1L7L A;  2DVD A;  4GH4 A;  5FLJ A;  3OYW B;  2VVE A;  4IEP A;  4P9J A;  4RQP C;  4EV0 A;  1VBE 3;  5FDB A;  5L36 A;  3O1S A;  2A6Z A;  2GN7 A;  3BU7 A;  5F74 A;  3I3D A;  3IAQ A;  5CU1 A;  1YRZ A;  5F2W A;  5FIX A;  4WM8 A;  4DO0 A;  4YSF A;  5I0U A;  1K5J A;  5EJ1 B;  3OEB A;  4QHO A;  4HK8 A;  3SKV A;  3SXW A;  3O1M A;  4DHS A;  1MR5 A;  1VAM A;  3DYO A;  3LEG A;  4PQ9 A;  1W06 A;  3ZN5 A;  3GHN A;  5D3F A;  1QDO A;  4MXW A;  1W9W A;  2KA3 A;  2ZGL A;  3POI A;  3VZF A;  2E7Q A;  4JDM A;  3CO2 A;  1ZBE 2;  4LBL A;  5FMO L;  2VUC A;  2D3P A;  3O1T A;  4QMA A;  3CEW A;  1O3S A;  4NRQ A;  2VE1 A;  5FKB A;  3WCR A;  3ZLI A;  3R6S A;  3GBF A;  4RS5 A;  5C4W C;  1JYX A;  1POV 0;  3OBT A;  3SHR A;  4BLI A;  5F5A A;  3S57 A;  4GUL A;  2YBS A;  3O0X A;  5B4X A;  2WAA A;  2RS1 1;  4FPO B;  1ZZ7 A;  2JDA A;  4K9S A;  4XFB A;  1J1L A;  5FYS A;  2BTP A;  2IVJ A;  4HFS A;  1V6O A;  4MV2 A;  2NLR A;  1UOF A;  3WT3 A;  1QH6 A;  4EN6 B;  4IE6 A;  1V0A A;  5IAT A;  2W68 A;  5BXX A;  5CFC A;  2D6P A;  3R05 A;  4OYU A;  5F8P A;  1SG3 A;  3AZX A;  3Q8B A;  3ZFG B;  2BOJ A;  2D98 A;  2O8O A;  3AP7 A;  5BNN B;  1BK1 A;  5DUW A;  2R04 1;  5T54 A;  4EZH A;  1VBB 1;  4I01 A;  1K5M B;  1NXD 1;  1IQD C;  1W2N A;  2QE3 A;  2W5F A;  5CAZ A;  3H9A A;  3N9N A;  2RMU 1;  1NQD A;  2A70 A;  5E16 A;  3GJA A;  3C8X A;  3M3C A;  2HJI A;  4HET A;  3NNM A;  3MPB A;  1KU8 A;  4S2H A;  2ZGT A;  3WNP A;  5HXM A;  1L3J A;  1XPW A;  4WVM A;  1LHU A;  4Y5Z 0;  5C5U A;  1J3P A;  1RXF A;  3KZ4 C;  4HVR A;  4XZU G;  3MW2 A;  2I74 A;  1G9B A;  2ETE A;  3EO6 A;  4UW6 A;  1GWK A;  3M2M A;  1CZT A;  4HN1 A;  1GIC A;  2VZS A;  1B09 A;  1Q5O A;  1R08 1;  3FWE A;  1MZE A;  2XLG A;  3A7Q A;  3WQ0 A;  4AVT A;  5IVV A;  2BP6 A;  4YVS A;  1O8P A;  1GWM A;  1Y4W A;  2YU2 A;  5FFO C;  3J26 N;  1A6C A;  1UZW A;  1VBE 2;  1ZZC A;  2QQL A;  4FP3 A;  4GQ7 A;  2V5D A;  4BWO A;  1AYN 3;  2Z79 A;  1V6K A;  2NYY A;  3RYR A;  3ZOI A;  4ONU A;  4I0B A;  2D5H A;  5KHH A;  2FMD A;  4LHN A;  1FI2 A;  1QJX 3;  5JM1 A;  1NLR A;  2UYB A;  5DUU A;  5IK4 A;  3PJY A;  3PTY A;  3U10 A;  1XXR A;  1ULP A;  1F35 A;  5FPA A;  2CDO A;  2JE7 A;  2WKK A;  4JV4 A;  4LK7 A;  3AL6 A;  1ULG A;  3CLP A;  3IPV B;  4NO4 A;  5FCC A;  4HKO A;  3UBW A;  4JC3 A;  5KXB A;  1ZGR A;  5KHK A;  3NAP A;  1VMH A;  2WO1 A;  2ZOE B;  1S0G A;  4K1Y A;  1ND3 B;  4KMQ A;  2XBO 2;  3E97 A;  5FZ0 A;  2C9K A;  3ZXJ A;  5LBE A;  1LOG A;  4PIY A;  2ZHL A;  5CBL A;  3K46 A;  4GD4 A;  3VHN A;  1H1I A;  4B7E A;  1TZO A;  2C1J A;  2VNV A;  1K3I A;  3C7E A;  4AI0 A;  4C0H A;  1ZVF A;  2UUR A;  5GZE A;  1A37 A;  1F5F A;  1OUS A;  5FYI A;  3QCW A;  5JPN B;  5GLZ A;  5K8S A;  1FT9 A;  5A6Y A;  2A5Z A;  1GU3 A;  1HJF A;  4P9X A;  4EWA A;  3HR9 A;  3J7L A;  3VL9 A;  3PNA A;  1AZD A;  4HXC A;  3BKZ A;  1JYV A;  2D93 A;  4D94 A;  3V0A A;  3LEI A;  4AHW A;  2PN5 A;  5FUP A;  3KWV A;  1OKO A;  4FT8 A;  4L9B A;  3ZIX A;  5CKN A;  5LY1 A;  5BN6 E;  1JXN A;  3LOB A;  1NLS A;  4QPG C;  1W6O A;  4BQ4 A;  1KEX A;  1MEC 3;  3BIW E;  3PUS A;  3E6B A;  2D40 A;  5FY4 A;  5FY1 A;  4DY3 A;  2FDK A;  2R30 A;  3P1P A;  2UYA A;  2VZR A;  2AEN A;  3MEP A;  3A21 A;  4W4Z A;  3SLI A;  2WC2 A;  5AVP A;  2Z2S B;  1B35 B;  1O9C A;  2VMD A;  3FBM A;  3U9X A;  5FPZ A;  2TUN A;  3TN9 2;  1XJA A;  3O14 A;  4F7R A;  2JIC A;  1RMU 3;  2DUR A;  1QDC A;  1V6L A;  2CY6 A;  3ZO0 B;  3O1O A;  2OA2 A;  2FDJ A;  4FSJ A;  2LTN A;  3JD7 2;  5DG1 A;  4YG0 A;  4RD7 A;  2VJX A;  5E1R A;  1NCR A;  3GF6 A;  3PHM A;  3WNL A;  3I2J A;  1LEC A;  5JDB A;  5FYB A;  1X8E A;  2UU8 A;  1KXG A;  3FZ3 A;  5J36 A;  1DYO A;  1IHM A;  3POE A;  1GZC A;  2JG9 C;  4JDN A;  3LAG A;  3MLK A;  2YZ4 A;  2JWP A;  5CIR A;  3FMG A;  1QJX 1;  1B35 C;  3OEA A;  1RUI 1;  4YGB A;  4MGY E;  4FTB A;  1ND2 B;  1CZS A;  1WMX A;  4IEW A;  2ZZJ A;  2JDP A;  3AKR A;  5ABJ A;  4PDW B;  4YVW A;  3S7I A;  2JDM A;  1KJR A;  1A3K A;  2DBN A;  2GC2 A;  4FPY A;  4LLO A;  4BJ0 A;  4I09 A;  3OGR A;  4EE2 A;  2PAE A;  3D4K A;  3WP5 A;  1PMH X;  3SEE A;  3AMP A;  3N9P A;  1W8O A;  2VQU A;  1YXW A;  5AV7 A;  3RDH A;  1U5X A;  5A33 B;  3T0M A;  2L9L A;  5GM0 A;  2WBK A;  5DAX A;  1NX9 A;  4YW4 A;  5A32 B;  3VD3 A;  1O59 A;  3USU A;  4OHY A;  3LW1 A;  4MET A;  4FFG A;  2BQP A;  2F6B A;  2BBV A;  2JG8 B;  5C3R A;  2B05 A;  2VZO A;  4LIU A;  1EPW A;  3FHA A;  4IE0 A;  4N7U A;  1N3Q A;  2CAU A;  1CON A;  1OQD A;  1RUG 1;  1TMF 3;  2DTY A;  1W6M B;  2X53 S;  2ZKL A;  5JCT A;  3OUI A;  5JIU A;  5LB6 A;  1ND2 C;  5FZ3 A;  4ES9 A;  1NCQ B;  5JOX A;  5IQP A;  2AEZ A;  4XZP A;  3VB9 A;  3UGF A;  2R07 2;  1OKQ A;  4FPG A;  4XJ9 A;  4YW2 A;  1W6Q B;  5BNO A;  5FYH A;  2D97 A;  5F2S A;  2O14 A;  3WF4 A;  4PF1 A;  3J8F 3;  1PGL 1;  4OHX A;  2J1T A;  5KC6 A;  4ZDR A;  5FBJ A;  3VBS C;  3HBZ A;  4LBN A;  4QU2 A;  1MEC 1;  4V2W A;  1DG6 A;  3KSC A;  1LEN A;  3MID A;  5HCB A;  2JD4 A;  1FPN 1;  2HWD 2;  2ZEX A;  2PQS A;  4XAC A;  2CYF A;  3P3P A;  4RR3 B;  1F2N A;  1Q8P A;  5FZC A;  2YMZ A;  3KF3 A;  1AR6 1;  2P3J A;  4GB3 2;  4A3X A;  5FRA A;  1WZX A;  1R64 A;  2WSU A;  2JG8 C;  1W0O A;  3HPN A;  5I8T A;  1CX4 A;  4TWT A;  1HV1 A;  4XIO A;  5FZO A;  3BTZ A;  3UL2 A;  3E1F 1;  2BOI A;  1OFN A;  1US3 A;  2JDK A;  3H50 A;  3L2Y A;  4MUV A;  4UFL A;  1NCQ C;  5K4L A;  3ZSL A;  5I8Y A;  5J4X A;  3AP4 A;  4IEU A;  5L9B A;  3ZXD A;  2VVD A;  5C9A C;  1AL2 3;  1AJO A;  1VPH A;  5T5P A;  3IBM A;  4FJ3 A;  4CDU A;  1VAV A;  5SV5 A;  3SH5 A;  4RHV 3;  2WZR 2;  2YU1 A;  2GAL A;  4UBH A;  3UJO A;  1HXS 1;  4AEM A;  2DVG A;  4L92 A;  5FQ0 B;  1MS1 A;  5IVF A;  3AZY A;  4C90 A;  4XW3 A;  3WV6 A;  5I91 A;  3JUU A;  5FZB A;  3TRS B;  2IWG B;  2W9X A;  5LVZ A;  2Q30 A;  4RR3 C;  2HWC 2;  3SKJ E;  4DXS A;  1GQP A;  1IS5 A;  3APB A;  5FYT A;  1ZNP A;  5FZD A;  3T2Q A;  2QNK A;  1D4M 2;  5J7M A;  2JE9 A;  5CFD B;  3IKW A;  4GIQ A;  4YM1 A;  4I3G A;  3JQW A;  3AXY C;  3QH7 A;  2YXS A;  4NWW A;  1PK6 C;  4IET A;  5IVJ A;  2XVL A;  1J3R A;  1W3V A;  3BOW A;  3C7G A;  2RS5 3;  5FZ7 A;  2WWJ A;  1GP4 A;  4K40 A;  3ZFE B;  1NE6 A;  4IXL A;  3T2O A;  1H8V A;  3I2O A;  4DHN A;  3PVO A;  1AR9 3;  3Q8F A;  5IVB A;  2RM2 1;  5KHG A;  1QJY 3;  2VOT A;  2WFF 3;  5I0T A;  1WS4 C;  5F9T A;  1ENR A;  3UZD A;  1JHN A;  1TMF 2;  1YO8 A;  2I07 B;  4QHZ A;  4BDV B;  4WM8 B;  1ZZ6 A;  2YBK A;  1VB4 A;  4HSJ A;  1RUH 2;  1NZC A;  2WT1 A;  5D21 A;  5DDJ 2;  1N47 A;  3B69 A;  4CDQ A;  4BQ3 A;  3ZFF B;  4AGR A;  1W03 A;  2XXZ A;  2DU1 A;  4AKC A;  4CCE A;  4R6R A;  4P9L A;  2ARE A;  5CFD C;  4R8H A;  4LO6 B;  5IUQ A;  5FP7 A;  4QQL A;  1QIQ A;  5J31 A;  4CDW A;  2BBA A;  4Y20 B;  1RIR A;  4COZ A;  4R9B A;  4RS5 B;  3VDD B;  2PMW B;  4OMD A;  1UZZ A;  3E5X A;  4Q4W 3;  1IG3 A;  4KG0 A;  3HN1 A;  2NMN A;  1DLL A;  4JRL A;  3WOG A;  2XJU A;  3MHZ A;  3OPW A;  4AED A;  3R4U A;  3RDI A;  4B8E A;  4H7L A;  1RUF 1;  2VGD A;  1HJG A;  2CTV A;  3HD8 B;  3EMR A;  3NL1 A;  1PX3 A;  3WHT A;  1QQP 2;  4HON A;  5FP8 A;  4LR4 A;  1F4H A;  1GP5 A;  4Q0V A;  1W8F A;  4NRO A;  5IJR A;  4BXS V;  2OYZ A;  5A3N A;  1SPP A;  4YGC A;  3ZFF C;  5L9V A;  1LES A;  3A22 A;  3P1O A;  1OOP A;  5FYU A;  1ASJ 1;  1LHO A;  4RA0 A;  4D69 A;  4HKL A;  4Y5I A;  3VKM A;  3T0A A;  1UYX A;  1F5J A;  2A3Y A;  2GME A;  3CU7 A;  1O91 A;  5JMC A;  1UGW A;  3C7H A;  3AKT A;  3D8C A;  3T0D A;  5LZ6 A;  5FPV A;  2BGC A;  4YNI A;  4Q1P A;  5LAS A;  2OKX A;  1GOH A;  3ZX7 A;  3VDD C;  2ILM A;  3HAG A;  3WHU A;  1AYM 2;  3MW3 A;  4XJW A;  1RUD 2;  4H14 A;  4ZZ8 A;  3RZL A;  4KGQ A;  3BVC A;  3WLU A;  4WVM B;  1YFX A;  2B9V A;  4I0A A;  4PI2 A;  5LW9 A;  4Q4V 2;  1DQ6 A;  1NG0 A;  5JLV A;  5C7G A;  5A6X A;  2E32 A;  2X8K A;  4OUE A;  2D3S A;  4K7J A;  3CZJ A;  2HWE 1;  3BB6 A;  4Y3O A;  2XB6 C;  1HX6 A;  2FCU A;  4WZC A;  4OVE A;  5IK7 A;  1WWY A;  1VBA 2;  4MSV A;  4YRD A;  1PIV 3;  1U12 A;  4QGM A;  3X0U A;  3DN7 A;  1AR9 2;  4KG8 A;  3M51 A;  2G1M A;  5LU1 A;  4B1M A;  2O98 A;  1QJY 2;  4L11 A;  2WFF 2;  3H8O A;  1F31 A;  2BRT A;  2V09 A;  1S55 A;  3D82 A;  4UWD A;  4AVV A;  3J4U H;  1UKR A;  3L2H A;  3M1H A;  1BMV 2;  3LFM A;  5T55 A;  4LBJ A;  1C3K A;  3KCC A;  1S0D A;  5LAT A;  2WWS A;  2FZ2 A;  4D3W A;  5LRS A;  3USS A;  2YBP A;  1DFQ A;  3UNP A;  2ZGP A;  4QB6 A;  3MIG A;  4COV A;  5ACA 3;  1YQ6 A;  4A2U A;  5IYY A;  4DEQ A;  2HBT A;  2ADD A;  1W9S A;  3BTA A;  4WVZ A;  1W99 A;  4DHM A;  4BQW A;  1GSL A;  1RJ7 A;  2ARB A;  1OA2 A;  1R1A 2;  2DDU A;  5C5T A;  1CPN A;  3WDV A;  5DAQ A;  2R06 3;  3LIH A;  3MFC A;  3POY A;  2A71 A;  4XFA A;  4XXA A;  3SMH A;  2QJV A;  2VZP A;  3DXU A;  4OHW A;  4Q4W 2;  5FZG A;  1EAH 3;  2OZ6 A;  3PMS A;  2YC2 A;  4QQ2 A;  4HVQ A;  5GZG A;  4D7T A;  2IXL A;  1RUN A;  1JOJ A;  3ES1 A;  3FL7 A;  1POQ A;  4W8J A;  3VZL A;  4PJY A;  1C5H A;  4ZXK A;  4IV3 B;  5GLU A;  1C4R A;  3O44 A;  4LKD A;  2Q8C A;  5LA1 A;  3INA A;  1NAE A;  3P1R A;  1QJB A;  1OBN A;  4G9S B;  4XAE A;  1GR3 A;  1C8N A;  1CIY A;  3ZSK A;  2JEC A;  3WF1 A;  3V0A B;  2XVG A;  1M4W A;  3SNM A;  4CP9 A;  1XEZ A;  4FPJ A;  3KB5 A;  3LL1 A;  1J3Q A;  2MHF A;  2PAK A;  1ONA A;  3EJK A;  2BWA A;  5CG9 A;  3WF0 A;  4JKM A;  4NHM A;  1IS6 A;  3T30 A;  4LBM A;  3UKT A;  4YZ3 A;  1POV 3;  1URJ A;  1EY2 A;  1W6O B;  1QJF A;  1JYW A;  3ORJ A;  1VBD 1;  2PHR A;  5HCH A;  1ZRF A;  4R6N A;  1FOD 3;  1AVB A;  3NO8 A;  3B93 A;  2X05 A;  1YCI A;  4JQT A;  2G9G A;  4UFJ A;  4LK6 A;  3UGH A;  4BB3 A;  3TEZ A;  3ILN A;  3IAP A;  2D6N A;  4LXL A;  3WDX A;  3APA A;  1AX0 A;  2MPF A;  4IV3 C;  4S2G A;  2WAO A;  4YFZ A;  5J09 A;  1G9F A;  2GC3 A;  2VQT A;  3KF5 A;  3U75 A;  3K48 A;  1MZ5 A;  3CKH A;  4WZF A;  1T6B X;  4BK5 A;  5LEJ A;  2Q1Z B;  4IE4 A;  4QDS A;  1J58 A;  1NCR B;  2BW8 A;  3SQO A;  4QQP A;  2WO2 A;  3WCS A;  2BER A;  4C1W A;  5JI9 A;  3N36 A;  3ZMO A;  1TME 3;  3NJV A;  3AXD A;  1V9U 3;  3D6E A;  3MO4 A;  4O65 A;  5I0D A;  1C3M A;  3GBW A;  3T2P A;  3WIN E;  2X09 A;  5HPO A;  3AFG A;  2GUX A;  1OUX A;  2JB4 A;  3PUI A;  3ZKU A;  1IPK A;  2ARC A;  4JGY A;  4HZF A;  5GLT A;  1UCX A;  1ODM A;  4BK4 A;  1PGW 2;  1RUE 3;  5JSR A;  2AGS A;  3AKS A;  3JBG 3;  1XYP A;  4Q2F A;  5ACA 1;  2C6S A;  4UT5 A;  2AZ5 A;  4MGI E;  3TAY A;  1H2N A;  2Y6F A;  3LF7 A;  2PHD A;  3RMY A;  1XNC A;  1QEX A;  1Z7S 2;  2GNT A;  3S5A A;  1J84 A;  4YVW B;  5ABJ B;  3VL8 A;  4PIT A;  3OY8 A;  3H1Y A;  4RGA A;  1RVF 2;  4Z2W A;  1HN1 A;  2E51 A;  1A38 A;  2R06 1;  3ZDV A;  4FPF A;  2A7A A;  4JCK A;  2QP2 A;  1EAH 2;  3WNX A;  5A1F A;  4FPK A;  1FNZ A;  1MVQ A;  1OVP A;  4Y3B A;  2CHH A;  4LOT A;  1LCL A;  1AR7 3;  4LUK A;  3USU B;  4ES8 A;  1OFS A;  4FOV A;  4DHU A;  4XFC A;  4TYS A;  4XUR A;  1JOT A;  2HKX A;  3CQC A;  3LA2 A;  1MS0 A;  1AR8 2;  2ZZQ A;  3P8S A;  1XE7 A;  1WMF A;  2BDR A;  2JEM A;  3I7D A;  4FXK B;  5A7P A;  1S0F A;  4FTS A;  1J4T A;  3D3A A;  2V5Y A;  3MFA A;  2B46 X;  2WZ8 A;  1LU2 A;  3VDC A;  4Z8B A;  3T08 A;  1NYW A;  2PHF A;  2P34 A;  2C24 A;  2Q8D A;  2VBB A;  1WD4 A;  2DU0 A;  1CJP A;  1HW5 A;  4Q26 A;  5FWE A;  4BE3 A;  2ENR A;  4LEJ A;  5A7W A;  3CU8 A;  2WL1 A;  4JQR A;  4JRA A;  3KQR A;  4TZD A;  4PLO A;  3LA7 A;  4LTA A;  5A3W A;  1FOD 1;  2MEV 1;  3FHQ A;  4HBN A;  4XDP A;  3VZE A;  1H8T B;  4IQP A;  5KXE A;  4QXK A;  4LNV A;  3IM0 A;  3LKY A;  2XHN A;  1M26 A;  2Q8E A;  2C26 A;  2VZT A;  4QWN A;  2VC9 A;  4CUA A;  5C71 A;  1PZ7 A;  4QLI A;  1MQT A;  4HOO A;  1C1F A;  2FD8 A;  4RSU A;  1JMU B;  4CZS A;  2BVB A;  2W08 A;  5BNP B;  3OGG A;  1UGY C;  1UY1 A;  1QHD A;  2IXI A;  3K75 B;  4HLT A;  4P9I A;  4QGL A;  4DHT A;  1Y9Q A;  2J7M A;  2HWF 3;  3N3H A;  2A75 A;  1E5I A;  2G4I A;  2Q8O A;  1V9U 2;  1LKN A;  4XF4 A;  5J50 A;  3WOB A;  1UO9 A;  1FAT A;  4AVC A;  1Z0H A;  4ASM B;  3FUQ A;  1CAX B;  4XUN A;  2WDB A;  2RV9 A;  1KDK A;  3M3E A;  4W6W A;  5DQ0 A;  3S6P A;  1PX4 A;  3JB4 C;  4K21 A;  4YW6 A;  1C28 A;  1QJU 1;  1OH4 A;  1Q56 A;  1SLC A;  2GP3 A;  1FMD 2;  1UYP A;  1ULE A;  3FLR A;  3KT4 A;  4A6O A;  1W8W A;  3HQX A;  4BPZ A;  2W87 A;  1H8T C;  1WW6 A;  1WCU A;  1L7R A;  2ZHK A;  4J25 A;  4AVB A;  1W8U A;  2DBI A;  5D8A A;  1HB2 A;  2QFE A;  3MUZ 1;  1N1S A;  4W65 A;  3WQ1 A;  1NA1 C;  2RJL A;  3AYA A;  2VW0 A;  2O8Q A;  5BNP C;  4R4X A;  1W8N A;  4XQD A;  4HKC A;  5LHO A;  2XWJ B;  4F3J A;  4BQX A;  5J37 A;  3MIT A;  1DU3 D;  4JTN A;  4WV8 A;  3DYP A;  4QM8 A;  3VBU B;  4JTO A;  3KV9 A;  4V1P A;  3FE5 A;  2WT2 A;  5C70 A;  4DIQ A;  2FDH A;  1RHI 1;  1AR7 2;  2VMG A;  4GAZ A;  2RR1 1;  3MIB A;  2J1U A;  2ZMN A;  3Q8C A;  4OLL A;  1VBC 3;  4BHP A;  1H9W A;  1LED A;  4H3W A;  5FP3 A;  2QQN A;  2RS1 3;  5FZF A;  5EXA A;  2JIJ A;  4AGG A;  3M50 A;  1H9P A;  1CJD A;  3KHB A;  3VZG A;  1OPO A;  3U07 A;  4TLF A;  2Y60 A;  2UY9 A;  4DB5 A;  5IWF A;  4U36 A;  2VCC A;  4CDQ B;  2AYH A;  4FPC A;  2XOM A;  2IUW A;  1TP8 A;  5FPB A;  5LEK A;  2FBE A;  4DPN A;  2R04 3;  3NKG A;  4JX0 A;  2OUJ A;  1W2O A;  4OZO A;  4Z2A A;  4P02 B;  2XML A;  4MQ0 A;  1JZ3 A;  2ZAB A;  1JU3 A;  2WA4 A;  4IV1 A;  2RMU 3;  3VBU C;  3VD9 A;  4CDW B;  1XE8 A;  3T2T A;  3B9C A;  4ISQ A;  3UET A;  2PLV 3;  4ZU5 A;  1JS9 A;  2VXJ A;  5LA2 A;  1PO2 2;  5DAP A;  4CCK A;  3WW4 A;  5L7O C;  5I8S A;  5ISL A;  1WCK A;  3ACG A;  4AQ6 A;  4D7Y A;  1DZR A;  1O5L A;  5FY5 A;  4AED B;  4R6Q A;  2Y38 A;  2ZGU A;  4E27 A;  1UY0 A;  4EWD A;  3LB9 A;  3VBH C;  5FMC A;  2ES3 A;  3CHX A;  1YIF A;  4RL7 A;  3HQR A;  1DQ4 A;  1AX1 A;  1QXP A;  4OFG A;  1BYH A;  1X9P A;  3MPP G;  2XL9 A;  2HWF 1;  3AX4 A;  3AZZ A;  3BCW A;  5F1R A;  4B4Q A;  1Y9M A;  2YYO A;  2O8P A;  3IQU A;  1L7Q A;  2GU9 A;  2BYV E;  1OOP B;  1NE4 A;  3BU0 A;  4FBF A;  1HRV 1;  5DAB A;  4R9D A;  3ZXG A;  5FZL A;  2B39 A;  1EUU A;  1G8W A;  1ZBA 1;  4N53 A;  3BUC A;  3LQC A;  5GLW A;  5GLV A;  2ZGN A;  3E5Q A;  3ZYP A;  5FP4 A;  3I8T A;  3AYC A;  3T1L A;  1YQ2 A;  2VCM A;  3E5U A;  3OOX A;  3HNB M;  4YZ5 A;  1CN1 A;  2JJ6 A;  5TSW A;  4PLM A;  1F15 A;  1D0G A;  3B7M A;  1I1E A;  1H2K A;  1D0H A;  1YC6 1;  5FZ8 A;  4WOG A;  4XE9 A;  2VY0 A;  3GZT B;  4CCN A;  3TEX A;  4XBL A;  3SP5 A;  4JGZ A;  4AI1 A;  4GWI A;  3ZR5 A;  5FPU A;  2QQP A;  1ZRI A;  1CAU A;  2WNV B;  1PM4 A;  3ZXE A;  3O1V A;  4UOJ A;  4R52 A;  2YHJ A;  4KWU A;  4A7K A;  4MAD A;  1O4Z A;  4MHU A;  2UWA A;  4BME A;  2XGX A;  4E4D X;  3BOD A;  5CVR A;  3S5Q A;  4RGK A;  1C3H A;  1S0C A;  2RS1 2;  1VBC 1;  2F4L A;  1QXJ A;  1HB3 A;  2DWR A;  3B01 A;  3C7F A;  3KM5 A;  3KT7 A;  3THT A;  1V00 A;  2VEC A;  2HEW F;  4JKK A;  2VMH A;  2W94 A;  3AKQ A;  5IFT A;  4CEW B;  2JB8 A;  3RQ0 A;  2VBP A;  3VZM A;  1C3N A;  3FFQ A;  4AQT A;  2EXI A;  4IE5 A;  2VME A;  1GWL A;  4XCB A;  3WG3 A;  4Y33 A;  1UNB A;  5HBA A;  4IEV A;  1ZRE A;  1VBB 2;  2C1F A;  2JX9 A;  2DCT A;  4CUG A;  1EV1 2;  1R09 1;  1BXH A;  2WRA A;  5GKA C;  2WNV C;  5GZD A;  4DEV A;  3J7N A;  4XCA A;  2ZEW A;  1RYY A;  1LOF A;  3QD6 A;  4N43 A;  4DX0 A;  4AAX A;  1EPZ A;  5FLI A;  1LB2 A;  5HCF A;  3PUH A;  5DN2 A;  4DS0 A;  4Q4X 2;  2PLV 1;  3RZJ A;  1NQJ A;  1JTZ X;  1NXM A;  1GOG A;  1QOT A;  2I2S A;  3SEP A;  1GV9 A;  4QKN A;  2ZKN A;  4YZ2 A;  2XQX A;  2LRP A;  4GXL A;  2P4E A;  1IKQ A;  4QKD A;  5LA9 A;  4BLJ A;  4G3Y C;  4DXR A;  2WQ4 A;  1SQ4 A;  5EJZ B;  4CEW C;  1ZZB A;  1SLA A;  2PA7 A;  3D0S A;  4P08 A;  3LZZ A;  1R08 2;  1KQR A;  4CEY B;  2Y0I A;  5LA0 A;  4AAP A;  4FFH A;  4Y22 B;  3ZFG C;  1UOG A;  4CUB A;  4LBQ D;  3VDB A;  3DCQ A;  3OCP A;  2NU5 A;  5BNN C;  5GZC A;  4CP9 B;  4J6S A;  2VMF A;  3I2I A;  3IMN A;  4EJR A;  5A6Q A;  1IOA A;  5T52 A;  2BJS A;  1K5M C;  2GAU A;  4E9K A;  2K0G A;  5HV0 A;  4UXA A;  5E88 A;  5JAX A;  3WNN A;  4QB2 A;  1U0A A;  3VD7 A;  2X5I B;  4NMI A;  3ENR A;  1RJ8 A;  3M4F A;  3AJZ A;  1RUI 3;  4QXB A;  3GNE A;  4K8F A;  1LHN A;  3AMQ A;  4DQA A;  5J48 A;  2P5B A;  3ITQ A;  4E2Q A;  3B94 A;  3CJI A;  2DVB A;  3KS7 A;  1SCS A;  2WIN B;  2VCB A;  3TBD A;  1HLC A;  3R0R A;  3I59 A;  5HV4 A;  4QPI A;  1Y43 B;  5A1L A;  5EIY B;  3WDU A;  4CEY C;  3ZHE B;  3F2Z A;  5LBC A;  1D7P M;  1XXN A;  2WSV A;  4G4F A;  3RVH A;  4J1X A;  5JIA A;  2V73 A;  4UW4 A;  2XG3 A;  1A8D A;  2WYF A;  2XLF A;  1UU4 A;  4HPK B;  4BIO A;  5FZM A;  4NIH A;  3WDW A;  1CR7 A;  1ZA7 A;  4F8A A;  5ANN A;  3IMM A;  4XIK A;  3MI8 A;  2X5I C;  2ET7 A;  2NPM A;  3UKN A;  3TB0 A;  4CDX A;  1TG7 A;  1RUG 3;  4Q8K A;  4R9A A;  2A6Y A;  1UW8 A;  4GWM A;  2IC1 A;  3PU8 A;  1RL3 A;  2OZJ A;  1CIW A;  4FP2 A;  1FV2 A;  2R1D A;  2WUH A;  1GBG A;  1BK0 A;  4LIV A;  4TLG A;  1O5U A;  1GZW A;  4MVT A;  4IGP A;  4QAW A;  5FZ6 A;  1AXY A;  2DVA A;  5J3U A;  2ET1 A;  1UX7 A;  2VUJ A;  2W0X A;  2ZGO A;  3AMN A;  1UYY A;  1QY4 A;  4XFH A;  2OPK A;  3J7H A;  2CDP A;  1SHW B;  2J1A A;  3OY8 B;  3QOP A;  1ND3 C;  5BTV A;  1JHJ A;  3OD4 A;  1Q8V A;  5T5O A;  1FPN 3;  4HT1 T;  5AVA A;  1EUT A;  1FAY A;  4HKW A;  1PNG A;  4IHL A;  2EIB A;  1AR6 3;  4I3P A;  4AEJ A;  5C8W A;  3VBR A;  1COV 1;  1PVX A;  4FTE A;  1UOB A;  4WBB A;  5KC5 A;  1MVE A;  1Y9G A;  5G05 L;  1YIP A;  2UWC A;  2VG9 A;  1JZ2 A;  1VMF A;  2AR6 A;  1WGP A;  2EA7 A;  3MLJ A;  4KNC A;  3VBO A;  1CAV A;  3MDP A;  5F7U A;  1YQ5 A;  3NVC A;  3VHR A;  4XOG A;  1KS5 A;  1LHV A;  1OQ1 A;  4NE9 A;  4B1L A;  3ZN6 B;  5CKQ A;  2W39 A;  3OF1 A;  4QPY A;  1E5R A;  1QMJ A;  3AZW A;  3BYW A;  4KWL A;  5DXD A;  4PIU A;  4XAA A;  3N7L A;  5F3G A;  4P00 B;  1AYN 2;  4WM7 B;  5FY7 A;  3R50 A;  1HXS 3;  3GXU A;  3PL0 A;  4XQW A;  5FK8 A;  5A7W B;  3VBF A;  1PNF A;  1W9Y A;  2SBA A;  2QDN A;  1QJX 2;  2WN2 A;  1ZA4 A;  1RUI 2;  4KWK A;  4QT6 A;  3LLY A;  3TN9 1;  4XBQ A;  1DYK A;  1CES A;  2VCA A;  4L97 A;  4DAT A;  3MIE A;  3LDK A;  5DZF A;  1Q8S A;  4XBN A;  1XYN A;  3BI3 A;  1GNH A;  1W39 A;  3MZH A;  1QNW A;  3BPS A;  1YJL A;  2AUY A;  5L73 A;  5LCW L;  3QAC A;  1T6G C;  2A6W A;  1MQT B;  2EIG A;  4N9H A;  5FXW A;  4E4Z A;  2QQI A;  4UAP A;  2GSY A;  5K0U A;  3ZSE A;  3LPG A;  2D44 A;  1MS8 A;  3RJR A;  2HWB 1;  2XLA A;  2DCJ A;  3I2K A;  5FZI A;  4WM7 C;  4JAA A;  2BPA 2;  1PMJ X;  1C1L A;  3P1Q A;  2JDN A;  2Y6G A;  5LWB A;  3MV1 1;  2RM2 3;  2WQZ C;  3VHO A;  2BR9 A;  1I5Z A;  5K7P A;  1UPS A;  1GLH A;  3B3Q E;  1SDD B;  4LO8 A;  4FVV A;  2WNU B;  5C8C A;  1RUG 2;  3EQE A;  4I2O A;  3MHR A;  5ANQ A;  1SFP A;  2ZEY A;  5M0T A;  2OT7 A;  1PMI A;  3BOP A;  3JU9 A;  3MV0 1;  3A4U A;  2IXJ A;  4Q0Q A;  2IVI B;  2GC0 A;  4O61 A;  3B9I A;  4M3C A;  4Y5T A;  4FR3 A;  4ZY9 A;  4PDW C;  2NZ9 A;  5D8A B;  1G9C A;  1ZGS A;  1WW7 A;  1Q43 A;  2E63 A;  2YV8 A;  1PGL 2;  1W8Z A;  2PYT A;  3IN9 A;  5H9R A;  2V4A A;  2OPW A;  1PXD A;  1OLR A;  3AVR A;  1MEC 2;  1CAW B;  2EID A;  4YW7 A;  1OF3 A;  1FPN 2;  5FY8 A;  2XJT A;  4PIF A;  2ZML A;  2Y6L A;  5IFP A;  3O0W A;  1ZRC A;  1AR6 2;  1C57 A;  3S30 A;  4IDZ A;  1RMU 2;  3POF A;  3URF A;  3C2U A;  3U1X A;  1A4O A;  2R0F A;  1XYO A;  4ZU4 A;  2WNU C;  2RVA A;  2Y26 A;  3KT1 A;  3R4S A;  5HI0 A;  1RUF 3;  3PDQ A;  4GJZ A;  3V0B A;  2DFC A;  1HRI 3;  4KQ7 A;  4ISR A;  4ZQ0 A;  2OUH A;  4UF0 A;  2VOV A;  3GGL A;  3Q8E A;  1H4H A;  4LPL A;  5A7S A;  4B7K A;  1WS5 A;  4YW5 A;  5FZ4 A;  3I3E A;  4CVU A;  5F37 A;  5CYY A;  1ASJ 3;  3I3Q A;  2J1V A;  1A78 A;  1HXS 2;  4ET7 A;  1DHK B;  4FPL A;  4Y5S A;  3ZM8 A;  4D6S A;  3H3Z A;  4NUB A;  4IV1 B;  1PZ8 A;  4BU2 A;  5FWJ A;  4CE8 A;  4JHZ A;  3RSJ A;  3LEK A;  3UYJ A;  4Q4Y 3;  1V6N A;  4PHZ A;  1X9T A;  3ILR A;  4LMF A;  3QH6 A;  5FO8 B;  3LGR A;  4ZZ5 A;  3AP9 A;  3VDA A;  4UYB A;  4WVW A;  3PUQ A;  2HWE 3;  5FJH A;  3POB A;  2YRO A;  1RC6 A;  3DPR A;  2WZR 1;  1YI9 A;  1YWK A;  5EYX A;  5EP9 A;  2E53 A;  4F83 A;  4GH4 B;  2RM2 2;  1NY7 2;  1AX2 A;  3NQH A;  5IAX A;  3RZZ A;  1HDK A;  1JYI A;  1U5Z A;  2GUE A;  1WMD A;  1PVC 1;  3ZMN A;  2BVV A;  1UMH A;  4N53 B;  3AMH A;  4XJU A;  4Z1V A;  4DY5 A;  3J9S A;  2QQJ A;  1YQC A;  1BCX A;  5BYN A;  1IPS A;  1OLQ A;  1OD3 A;  1D4M 1;  4IEA A;  3SMM A;  4NPM A;  1O6U A;  4BM8 A;  3LIG A;  3HQU A;  3J8F 2;  4MXW B;  1RTV A;  4CCC A;  1RUC 1;  4LJH A;  2H0B A;  2RS3 3;  4XTP A;  3EXU A;  1GZ9 A;  2A3W A;  5F32 A;  2P2K A;  3H0O A;  4AFD A;  3WUC A;  1W6P A;  3ZFE C;  4FFF A;  4EYU A;  4GH4 C;  1H0B A;  1GNY A;  4LKE A;  5AC9 3;  4PLN A;  2CNA A;  5A3M A;  4BYY A;  1RUO A;  1RUF 2;  2WNE A;  4ORF A;  4FAH A;  4ZS3 A;  3DEM A;  2YGM A;  4E2S A;  4LO7 A;  2Y64 A;  3WQ7 A;  2B8M A;  2CWS A;  3UAL A;  1HRI 1;  2WS9 1;  4WM8 C;  4CYD A;  2ZJC A;  1LJ7 A;  4QXC A;  1H1M A;  3LE0 A;  4X8P A;  5FO9 B;  4RQP A;  1P8J A;  4DHQ A;  1AL2 2;  2VM9 A;  1AXK A;  5F5Q A;  1QOS A;  5CFC B;  2W92 A;  4AFC A;  4RHV 2;  2OXB A;  3LA3 A;  4YM2 A;  1F4A A;  5IAV A;  3UGG A;  3EFZ A;  1VBO A;  2PHX A;  5C3S A;  3RGB A;  1DQ5 A;  2N7G A;  3N9L A;  1MZ6 A;  5A1A A;  1OA3 A;  3RFR A;  4K1Z A;  4AEK A;  3TEW A;  3ES4 A;  1VBP A;  3KQ4 B;  4RS5 C;  1VBD 3;  1DYP A;  2E31 A;  3CBN A;  4KBB A;  4N43 B;  1QU0 A;  5CIS A;  5JXJ A;  3SPR A;  1YYN A;  2A73 B;  2HYX A;  3HIF A;  4PIK A;  1W28 A;  1PO1 3;  2QQK A;  5FAX A;  4M3C E;  4Q4Y 1;  1UH1 A;  3ZPO A;  3OBZ A;  1G6N A;  1HN0 A;  4OZX A;  3UJQ A;  4EN8 B;  3VZK A;  5C4W A;  1BVV A;  5FO7 B;  5J51 A;  4MZU A;  5FY0 A;  2P3I A;  2HWE 2;  3OYW A;  4IEY A;  4Z07 A;  2Q5T A;  1IQA A;  5DG2 A;  4AR2 A;  2W47 A;  4J1W A;  5CFC C;  2RE9 A;  2RS5 2;  1G9D A;  3AQG A;  2E26 A;  4YVS B;  2VTF A;  4IES A;  3ABZ A;  1RUJ 1;  3GZA A;  3BPZ A;  1HQN A;  1VAK A;  5DPN A;  4DHP A;  3WR0 A;  1N1Y A;  1S2K A;  4QX8 A;  1W0N A;  2NUO A;  3SCG A;  4BOW A;  4LUM A;  1DCS A;  4D7S A;  2C1N A;  1R1Z A;  2WO7 A;  3J7M A;  1PHM A;  3P6B A;  2WII B;  4M00 A;  4Q4V 1;  2PXJ A;  1F9K A;  1D4V B;  1DGR N;  1UOJ A;  4MLO A;  3I4R A;  1BQP A;  1U5I A;  2P17 A;  3V64 A;  3ZYJ B;  3WEZ A;  4XHB A;  3R51 A;  3AB0 A;  5F5C A;  3TNP B;  4ASL A;  4AI8 A;  1TE1 B;  1JOD A;  3I59 B;  4NHY A;  2K46 A;  1VBA 1;  2RS3 1;  4QX2 A;  2WR9 A;  4QPI B;  4B3N A;  4FQ4 A;  3TNQ A;  4OHZ A;  3RPQ A;  3ECQ A;  2IXH A;  5FOJ B;  3B00 A;  3NAP B;  4A4A A;  3K77 A;  1J83 A;  3OSD A;  4YVS C;  4AXO A;  2JDH A;  2JDU A;  1JOP A;  2QQM A;  4UFK A;  5AC9 1;  4Z92 B;  2DTW A;  1V6I A;  1VP6 A;  4KH9 A;  3GYD A;  3T0B A;  1LNS A;  1ENX A;  4A6S A;  4IE7 A;  4Q29 A;  2D5F A;  4CDX B;  2QVS B;  1AHS A;  5FJK A;  5JZG A;  1JZ8 A;  2YUE A;  1SBD A;  3RWK X;  3NKT A;  4AFB A;  2NM1 A;  2ADE A;  2V4V A;  3I97 A;  3TOW A;  2BGP A;  5I93 A;  3UES A;  3BTX A;  3ZYB A;  3QBQ A;  1REE A;  2VR4 A;  2VNR A;  3NAP C;  3WVJ A;  3AP6 A;  1N3O A;  1QKQ A;  3W5N A;  3LLZ A;  4ZU7 A;  1JN2 P;  3ZSM A;  1IS4 A;  4P9W A;  5KBF A;  4X6Q B;  2MEV 3;  3FUO A;  5FZE A;  1PO1 1;  2DUO A;  3NJZ A;  4CU9 A;  1EP0 A;  2EAK A;  4FCA A;  4P5H A;  5F39 A;  3VBR B;  1CQ9 A;  4Y4R A;  1UZV A;  4PCR A;  3AKP A;  1SLI A;  2G9F A;  4D8M A;  3SCH A;  4M0H A;  3VBO B;  1LOC A;  5CKM A;  4HK9 A;  4DUV A;  1I5P A;  4DHR A;  1UYZ A;  1FV3 A;  3I54 A;  1U5Y A;  4FL5 A;  1PIV 2;  3OJB A;  1JOB A;  4PT6 A;  3O12 A;  4CXY A;  1XSQ A;  4M3C F;  4XUQ A;  2CWM A;  1JI6 A;  4COU A;  1OQE A;  5A3O A;  4BQ2 A;  4HVO A;  3W20 A;  1J59 A;  2ZAC A;  3OBA A;  5HXV A;  2LRO A;  3SIS A;  3HT1 A;  3IQJ A;  1QJU 3;  3VBF B;  3ETQ A;  1O3Q A;  2WAB A;  4OHV A;  4Y1X A;  3IDB B;  3MBW A;  2TBV A;  4W50 A;  2ZCW A;  2ZX4 A;  3NV1 A;  4ZON A;  3IPV A;  3ZDS A;  5A3T A;  2E7T A;  3AYE A;  5ACA 2;  4EQV A;  1DDL A;  1OUW A;  4B4R A;  2PAM A;  3VUO A;  4TN7 A;  2R49 A;  3ZYR A;  4KGG A;  3G7D A;  4QPG A;  5FUN A;  3WD5 A;  4P14 A;  4CU6 A;  1UX6 A;  4OUL A;  3N4M A;  4BIS A;  5KHJ A;  2YGL A;  4YW1 A;  4OI1 A;  4Y24 A;  1H2M A;  2R06 2;  4P5Y A;  1W04 A;  1LOA A;  1NCR C;  3X29 B;  1XNT A;  1RIN A;  1RHI 3;  1O8S A;  2ARA A;  1DGR A;  1RIT A;  2ZGM A;  5JXI A;  1G9A A;  2RR1 3;  3UT0 A;  3KMH A;  1JYT A;  1W2A X;  3NKX A;  3FFZ A;  3FC0 A;  4FPE A;  5F5I A;  1MS4 A;  4Q27 A;  4CA9 A;  4M01 A;  1O3T A;  1IG0 A;  1OLM A;  3MIH A;  3FLP A;  3ON7 A;  5A70 A;  1PGW 1;  2EAL A;  2FMY A;  1VE0 A;  1XND A;  1UL9 A;  2OQ6 A;  4GZ9 A;  2YC4 A;  3AJY A;  2PTM A;  1Z7S 1;  5APA A;  1BZW A;  1AUY A;  2WQ8 A;  3NST A;  2O0O A;  3NV3 A;  4M3C B;  3IZO A;  3T0L A;  2JG9 A;  5ABJ C;  4YVW C;  5BNO B;  3I3M A;  1ACC A;  2FHR A;  3POW A;  1B35 A;  3IDA A;  4XTM A;  3KV4 A;  3VGI A;  1BEV 3;  5H9Q A;  2Y6J A;  1C8M 1;  2XH6 A;  3BTY A;  1O3R A;  1YFW A;  3GM8 A;  1FOD 2;  3KVB A;  1GYK A;  1BBT 1;  3MUY 1;  3CZU A;  1WUV A;  3CF6 E;  1T2X A;  4LHL A;  4AKB A;  1Q8O A;  4GMP 1;  1AR8 1;  1DGL A;  3PIJ A;  3V0B B;  5FZO B;  4FFI A;  3THD A;  3WG1 A;  4AFA A;  4DOU A;  1E5S A;  3N9M A;  4NHL A;  2WFP A;  1NKG A;  1VB2 A;  1KIT A;  3I2D A;  4B4P A;  1JZ6 A;  3H1M A;  2NQY A;  5KHI A;  1TME 2;  3HBK A;  5E6H A;  5BNO C;  4Y32 A;  4CDU B;  1HRV 3;  3WG4 A;  3M3I A;  2JIG A;  2F17 A;  1QJU 2;  1ND2 A;  1ZBA 3;  3SMN A;  1GUI A;  2YY1 A;  1WD3 A;  4AGV A;  4FOY A;  3RNS A;  4BH9 A;  5AFB A;  1RUE 2;  1ULD A;  3JBG 2;  2PHL A;  4CRQ A;  3C7O A;  3P1I A;  1DQ0 A;  3BIE A;  3VY6 A;  1W8T A;  3PTR B;  3OD0 A;  2CU5 A;  4MXV A;  3VBS A;  1TVG A;  3ETP A;  4AG4 A;  3O1U A;  2D3R A;  1GZT A;  2W1W A;  4AVS A;  1DQ1 A;  5FZ1 A;  4O46 A;  2JXA A;  2W1Q A;  2YPD A;  2XVK A;  3HNM A;  5A33 A;  1JYN A;  4MGQ A;  3O0V A;  4LBQ A;  4EZ4 A;  3IT8 A;  4N8M A;  4CXX A;  1WS5 C;  4JHT A;  4TXW A;  3LFI A;  2BEO A;  2JG8 A;  3ATG A;  1RHI 2;  4CDU C;  2RR1 2;  1O9E A;  2QCS B;  4BIF A;  4YYO A;  3I2F A;  4LQR A;  2VZU A;  4CP1 A; 
#chains in the Genus database with same CATH homology
 5IHR A;  3HN3 A;  2VCB A;  1OF4 A;  5EIY B;  4M4R A;  2R7E B;  3F2Z A;  1D7P M;  1JZ4 A;  2W9X A;  5JMO A;  3SKJ E;  4DXS A;  4D0Q A;  1WKY A;  1GQP A;  3NNG A;  1UXX X;  2WZE A;  2X10 A;  3T2Q A;  4A3Z A;  4ZXE A;  3AC0 A;  3CDZ B;  1TG7 A;  3OGV A;  3LPF A;  2ORZ A;  2WUH A;  3C7G A;  4QAW A;  3VD4 A;  2YG0 A;  4L0P A;  4XUT A;  3T2O A;  1UX7 A;  4ARY A;  3K4Z A;  1UYY A;  4GWJ A;  2VOT A;  3J7H A;  2CDP A;  4CUC A;  1SHW B;  2J1A A;  1UZ0 A;  1JHJ A;  4BDV B;  2JE8 A;  3HEI A;  3NRU A;  1EUT A;  2W3J A;  4FI9 A;  2EIB A;  4PQQ A;  2RJ2 A;  5G05 L;  1JZ2 A;  2QQO A;  5F7U A;  3OG2 A;  1UY3 A;  2BBA A;  4JKL A;  3WSO A;  2ZXQ A;  4P00 B;  4OMD A;  4KI5 M;  4QX3 A;  3GXU A;  2WN2 A;  2WYS A;  1PX3 A;  1F4H A;  2VCA A;  1US2 A;  5IJR A;  4RYD A;  4BXS V;  3WF2 A;  1MPX A;  3A22 A;  3I2G A;  1CZV A;  5LCW L;  3T0A A;  1UYX A;  1NUK A;  3C7H A;  2QQI A;  4UAP A;  3BGA A;  3T0D A;  3WQB A;  5FUI A;  3LPG A;  2VL4 A;  2OKX A;  1GOH A;  4A45 A;  2C4X A;  2DCJ A;  3I2K A;  4ZZ8 A;  1PMJ X;  2Y6G A;  1UMI A;  3MV1 1;  2B9V A;  2JD9 A;  1SDD B;  1XNA A;  5C7G A;  2EIE A;  3BN6 A;  2E32 A;  4MGS A;  1XC6 A;  4UI9 L;  2ZEY A;  4OUE A;  4CU7 A;  2EIC A;  3MV0 1;  3CZJ A;  2QBX A;  1K12 A;  1UXZ A;  3FN9 A;  3DEC A;  4ZY9 A;  3HNY M;  3X0U A;  4DUW A;  2E33 A;  5JUV A;  2KD7 A;  4ARX A;  2EID A;  4MO3 M;  1OF3 A;  2YB7 A;  4HG6 B;  2W91 A;  2Y6L A;  1JU4 A;  5IFP A;  3UNP A;  2YFZ A;  4QB6 A;  3EYP A;  4LKS A;  4DEQ A;  2RVA A;  1W9S A;  1K45 A;  5G04 L;  1H6X A;  1W99 A;  3T09 A;  2DDU A;  4IUG A;  3GGL A;  4LPL A;  3A23 A;  2VZP A;  3I3E A;  4CVU A;  3OGS A;  5CYY A;  2YC2 A;  2J1V A;  2WO3 A;  3FL7 A;  3CIH A;  4W8J A;  4ET7 A;  3ZM8 A;  1DP0 A;  3III A;  5LA1 A;  1NAE A;  4JHZ A;  3LEK A;  4XUP A;  1CIY A;  4QDQ A;  3WF1 A;  4QDR A;  2J1S A;  2VZ1 A;  1JZ5 A;  1CX1 A;  3WF0 A;  4ZZ5 A;  4JKM A;  3VDA A;  4QX0 A;  2DCK A;  4E8C A;  4XVH A;  4TTG A;  3K4A A;  1UY4 A;  3OB8 A;  1JYW A;  2X05 A;  5B4N A;  3NQH A;  1KGY A;  3IAP A;  2W46 A;  1UMH A;  2WAO A;  2VQT A;  3CQO A;  3EB7 A;  2QQJ A;  3CKH A;  4BK5 A;  1OD3 A;  4QDS A;  3NJX A;  2WO2 A;  2BER A;  1K42 A;  2LS6 A;  3NJV A;  3DYM A;  3MO4 A;  4LHS A;  5I0D A;  3U37 A;  2Y6K A;  3T2P A;  5HPO A;  2X09 A;  1UWW A;  2B4K A;  3PUI A;  5JR2 A;  4BK4 A;  1GNY A;  4QB1 A;  2Y64 A;  1J84 A;  2BZD A;  3LE0 A;  1HN1 A;  3I3D A;  3IAQ A;  1P8J A;  2VM9 A;  2W92 A;  4CU8 A;  5EJ1 B;  3OEB A;  3SKV A;  4E8D A;  4DXT A;  1F4A A;  3DYO A;  3LEG A;  5A1A A;  1W9W A;  4XUR A;  5J1X A;  2V72 A;  2E31 A;  3HJR A;  5JXJ A;  4QPW A;  2HYX A;  3WNK A;  2QQK A;  3D3A A;  1JYX A;  2WZ8 A;  3VDC A;  3T08 A;  3W5M A;  5B4X A;  2WAA A;  3ACF A;  2JDA A;  2W47 A;  2E26 A;  3FHQ A;  2VTF A;  3ABZ A;  4OYU A;  2W1S A;  1SG3 A;  2W1U A;  5DPN A;  2XHN A;  2C26 A;  2VZT A;  2VC9 A;  3GDB A;  4CUA A;  1W0N A;  5C71 A;  3ACH A;  2VMC A;  1IQD C;  2W5F A;  1UY1 A;  3P6B A;  3K75 B;  2W95 A;  2J7M A;  2BGO A;  3C8X A;  3WEZ A;  2YFU A;  3WNP A;  5HXM A;  1XPW A;  4XUN A;  2WDB A;  4QX2 A;  2RV9 A;  5DQ0 A;  1PX4 A;  4XZU G;  3ECQ A;  5LA0 A;  1OH4 A;  4A4A A;  3WNO A;  4A6O A;  3K77 A;  1J83 A;  4A42 A;  2W87 A;  1WCQ A;  1CZT A;  2VZS A;  1L7R A;  2QQM A;  3A7Q A;  3CMG A;  3JXS A;  1O8P A;  3MUZ 1;  2QQL A;  3T0B A;  3K4D A;  2V5D A;  1LNS A;  1GMM A;  1BHG A;  1W8N A;  1JZ8 A;  3DYP A;  2V4V A;  3I97 A;  4A44 A;  2BGP A;  5C70 A;  4QX1 A;  1DLC A;  3UES A;  1OT5 A;  2J1U A;  3WF3 A;  1ULP A;  2QQN A;  2VR4 A;  2CDO A;  3I2H A;  3W5N A;  4A41 A;  2VZV A;  4DUX A;  2WO1 A;  2VCC A;  4KMQ A;  4CU9 A;  2C9K A;  2XOM A;  3K46 A;  4JX0 A;  3HOB A;  4OZO A;  4Z2A A;  4D8M A;  1K3I A;  1W9T A;  3C7E A;  4P02 B;  1JZ3 A;  1JU3 A;  4DUV A;  1I5P A;  1UYZ A;  3VD9 A;  1GU3 A;  4PT6 A;  3UET A;  1JYV A;  3I3B A;  5LA2 A;  4XUQ A;  1JI6 A;  3LEI A;  3ACG A;  4YPJ A;  3OBA A;  2VZQ A;  3WNM A;  1UY0 A;  2WAB A;  3MBW A;  2ORX A;  4W50 A;  1KEX A;  2Z4F A;  2VZR A;  4W4Z A;  1L7Q A;  3A21 A;  4CU6 A;  2LW8 A;  2VMD A;  2J1E A;  4M4P A;  3THC A;  1EUU A;  4P5Y A;  3LQC A;  5JXH A;  1XNT A;  2JKX A;  1UY2 A;  4OMC A;  2VJX A;  1YQ2 A;  1O8S A;  5DMY A;  3HNB M;  5JXI A;  2ZEZ A;  3WNL A;  3I2J A;  5JXG A;  1JZ7 A;  4GZ9 A;  1DYO A;  2VO5 A;  4GWI A;  2YC4 A;  4UOJ A;  4KWU A;  3IB3 A;  2WQ8 A;  3OEA A;  4MAD A;  1CZS A;  3IDA A;  1GOF A;  3C7F A;  1H6Y A;  2Y6J A;  4JKK A;  4XUO A;  2W94 A;  3GM8 A;  4BJ0 A;  5IFT A;  3OGR A;  1PMH X;  3MUY 1;  3CZU A;  2XON A;  3SEE A;  1T2X A;  1W8O A;  2VME A;  2VQU A;  2Y6H A;  2L9L A;  2WBK A;  1NX9 A;  3THD A;  1O59 A;  3VD3 A;  2VZO A;  1NKG A;  3FHA A;  4DEV A;  5IYY A;  2ZEW A;  1RYY A;  1JZ6 A;  4AAX A;  2VZ3 A;  3PUH A;  5DN2 A;  1GOG A;  3SEP A;  2XQX A;  2Y8K A;  2J22 A;  3WF4 A;  4DXR A;  4PF1 A;  1GUI A;  5EJZ B;  2J1T A;  4P08 A;  3C7O A;  3P1I A;  4MOA A;  3VD5 A;  4CUB A;  3VDB A;  2ZEX A;  2PQS A;  1TVG A;  3ETP A;  2VMF A;  4AG4 A;  3I2I A;  2W1W A;  1ULO A;  2HLE A;  4RN5 A;  1R64 A;  2W1Q A;  3HPN A;  3HNM A;  1JYN A;  3WNN A;  4MGQ A;  4QB2 A;  3VD7 A;  3E1F 1;  4TXW A;  5CZK A;  1US3 A;  2J1R A;  2WN3 A;  3I2F A;  4LQR A;  2ID4 A;  2VZU A;  3ACI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...