The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
HGYVESPASRAYQCKLQLNTQCGSVQYEPQSVEGLKGFPQAGPADGHIASADKSTFFELDQQTPTRWNKLNLKTGPNSFTWKLTARHSTTSWRYFITKPNWDASQPLTRASFDLTPFCQFNDGGAIPAAQVTHQCNIPADRSGSHVILAVWDIADTANAFYQAIDVNLSK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure and Binding Properties of the Serratia Marcescens Chitin-Binding Protein Cbp21
pubmed doi rcsb |
| molecule keywords |
CBP21
|
| molecule tags |
Chitin-binding protein
|
| source organism |
Serratia marcescens
|
| total genus |
53
|
| structure length |
170
|
| sequence length |
170
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2004-11-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03067 | LPMO_10 | Lytic polysaccharide mono-oxygenase, cellulose-degrading |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | chitin-binding protein cbp21 |
#chains in the Genus database with same CATH superfamily 2BEM A; 2LHS A; 4A02 A; 4ALE A; 4ALR A; 4OY7 A; 2XWX A; 2YOY A; 4GBO A; 4ALQ A; 4OY6 A; 4ALC A; 5IJU A; 3UAM A; 5FTZ A; 4ALT A; 2YOW A; 2BEN A; 5AA7 A; 5FJQ A; 4OY8 A; 2YOX A; 4ALS A; #chains in the Genus database with same CATH topology 4JVF B; 2BEM A; 4JHP B; 4LN0 A; 4GOK C; 4EIS A; 4OY7 A; 5L7K A; 1AJW A; 2YOY A; 1DOA B; 4FMR A; 5DQE A; 1FSO A; 3UAM A; 2YOW A; 1RHO A; 2BEN A; 2JHZ A; 5EMW A; 5HGU A; 2JHV A; 5HNP A; 3L15 A; 2LHS A; 5ACG A; 5ACI A; 3GQQ A; 4D7V A; 5E8F A; 4ALR A; 5ACF A; 2JHU A; 2JHW A; 4QI8 A; 4F38 B; 4GBO A; 5HNO A; 4ALQ A; 2VTC A; 2BXW A; 4OY6 A; 4GOJ C; 5DQ8 A; 1KSG B; 4B5Q A; 4MAI A; 5TB5 B; 5AA7 A; 2JI0 A; 5FJQ A; 4JV8 B; 4OY8 A; 2JHS A; 4RE1 A; 4JV6 B; 5ACH A; 5TAR B; 3JUA A; 2XWX A; 3KYS A; 3RBQ A; 5E80 A; 1KMT A; 3ZUD A; 4ALC A; 1QVY A; 2JHX A; 4JVB B; 3EJA A; 4EIS B; 2JHY A; 4ALT A; 2YET A; 5F2U A; 4EIR A; 4MAH A; 5FOH A; 5EMV A; 1DS6 B; 2R5O A; 2JHT A; 4ALS A; 4A02 A; 1FST A; 4ALE A; 1FT3 A; 3T5G B; 3T5I A; 1KSJ B; 5IJU A; 3EII A; 5FTZ A; 4D7U A; 5ACJ A; 1HH4 D; 1KSH B; 1GDF A; 2YOX A; 1FT0 A; #chains in the Genus database with same CATH homology 2BEM A; 2LHS A; 4A02 A; 4ALE A; 4ALR A; 4OY7 A; 2XWX A; 2YOY A; 4GBO A; 4ALQ A; 4OY6 A; 4ALC A; 5IJU A; 3UAM A; 5FTZ A; 4ALT A; 2YOW A; 2BEN A; 5AA7 A; 5FJQ A; 4OY8 A; 2YOX A; 4ALS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...