The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
138
|
structure length |
138
|
Chain Sequence |
AMVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEHYHFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Protein Crystallization by Surface Entropy Reduction: Optimization of the Ser Strategy
pubmed doi rcsb |
| molecule keywords |
RHO GDP-DISSOCIATION INHIBITOR 1
|
| molecule tags |
Inhibitor
|
| source organism |
Homo sapiens
|
| total genus |
31
|
| structure length |
138
|
| sequence length |
138
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-02-23 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII, subunit A, domain 1 |
#chains in the Genus database with same CATH superfamily 1AJW A; 1RHO A; 1FSO A; 4F38 B; 1KMT A; 2JHX A; 2JHY A; 2JHZ A; 1DOA B; 2JHV A; 1QVY A; 1FT3 A; 2JHS A; 2JHW A; 1GDF A; 1FT0 A; 1DS6 B; 1FST A; 1HH4 D; 2BXW A; 2JHU A; 2JHT A; 2JI0 A; #chains in the Genus database with same CATH topology 4LN0 A; 5TAR B; 5HNP A; 5L7K A; 1FSO A; 1KMT A; 3JUA A; 5E80 A; 2JHZ A; 3L15 A; 4QI8 A; 2JHV A; 2LHS A; 5ACH A; 1FT3 A; 5DQ8 A; 4JVF B; 2VTC A; 4D7U A; 1FT0 A; 5DQE A; 4JV8 B; 1HH4 D; 5EMW A; 1AJW A; 3UAM A; 4GOK C; 2YOW A; 4MAH A; 2JHX A; 5ACF A; 5F2U A; 4ALT A; 4EIS B; 4JV6 B; 4ALC A; 1KSJ B; 4A02 A; 5FOH A; 4OY6 A; 4JVB B; 2BXW A; 4ALQ A; 2YOX A; 4RE1 A; 1RHO A; 2XWX A; 4ALR A; 5FTZ A; 1KSH B; 2JHY A; 5EMV A; 5ACG A; 3RBQ A; 3ZUD A; 2JHW A; 1GDF A; 4MAI A; 5HNO A; 4D7V A; 5AA7 A; 4OY8 A; 2BEN A; 1FST A; 2BEM A; 2JHT A; 5E8F A; 2R5O A; 5FJQ A; 4EIS A; 1KSG B; 4JHP B; 5TB5 B; 4ALE A; 3T5I A; 4F38 B; 3EJA A; 3GQQ A; 3KYS A; 3T5G B; 2YOY A; 4OY7 A; 1DOA B; 1QVY A; 4GOJ C; 5IJU A; 2JHS A; 3EII A; 5ACI A; 4FMR A; 1DS6 B; 4B5Q A; 2JHU A; 4EIR A; 4GBO A; 2YET A; 5ACJ A; 2JI0 A; 4ALS A; 5HGU A; #chains in the Genus database with same CATH homology 1AJW A; 1RHO A; 1FSO A; 4F38 B; 1KMT A; 2JHX A; 2JHY A; 2JHZ A; 1DOA B; 2JHV A; 1QVY A; 1FT3 A; 2JHS A; 2JHW A; 1GDF A; 1FT0 A; 1DS6 B; 1FST A; 1HH4 D; 2BXW A; 2JHU A; 2JHT A; 2JI0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
