The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
106
|
structure length |
106
|
Chain Sequence |
MGSMAHSDGIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution structure and mutational analysis of pituitary adenylate cyclase-activating polypeptide binding to the extracellular domain of PAC1-RS.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
source organism |
Homo sapiens
|
molecule keywords |
Pituitary adenylate cyclase-activating polypeptide type I re
|
total genus |
9
|
structure length |
106
|
sequence length |
106
|
ec nomenclature | |
pdb deposition date | 2007-03-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02793 | HRM | Hormone receptor domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Hormone receptor fold | GPCR, family 2, extracellular hormone receptor domain |
#chains in the Genus database with same CATH superfamily 4ERS A; 3N7R A; 2QKH A; 3AQF B; 4HJ0 A; 2JOD A; 4ZGM A; 3N7P A; 3EHS A; 4DLQ A; 1U34 A; 3IOL A; 3L2J A; 4LF3 C; 2JNC A; 2L27 A; 3H3G A; 3C5T A; 3EHT A; 3C4M A; 2XDG A; 4DLO A; 3EHU A; 3N7S A; 2JND A; 5II0 A; 3C59 A; #chains in the Genus database with same CATH topology 4ERS A; 3N7R A; 2QKH A; 3AQF B; 4HJ0 A; 2JOD A; 4ZGM A; 3N7P A; 3EHS A; 4DLQ A; 1U34 A; 3IOL A; 3L2J A; 4LF3 C; 2JNC A; 2L27 A; 3H3G A; 3C5T A; 3EHT A; 3C4M A; 2XDG A; 4DLO A; 3EHU A; 3N7S A; 2JND A; 5II0 A; 3C59 A; #chains in the Genus database with same CATH homology 4ERS A; 3N7R A; 2QKH A; 3AQF B; 4HJ0 A; 2JOD A; 4ZGM A; 3N7P A; 3EHS A; 4DLQ A; 1U34 A; 3IOL A; 3L2J A; 4LF3 C; 2JNC A; 2L27 A; 3H3G A; 3C5T A; 3EHT A; 3C4M A; 2XDG A; 4DLO A; 3EHU A; 3N7S A; 2JND A; 5II0 A; 3C59 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...