3EHUA

Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1) in complex with crf
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
453
structure length
441
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND MBP
publication title Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1.
pubmed doi rcsb
source organism Escherichia coli
total genus 125
structure length 441
sequence length 453
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehuA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3ehuA03
4ESXA 4GWOA 4TLLB 2O7IA 2H9BA 3G3GA 4XTCQ 2UVJA 3O28A 1ZTYA 4KFQA 4H0WA 4KCCA 2QPQA 4YKKA 1NNKA 3MPKA 4EQ9A 4R73A 1OQHA 1OVBA 3VLVA 5DEXB 3RPWA 2HEUA 1DTGA 3H6TA 4N13A 4AB6A 2ALUA 4K3FA 1B58A 4FJPA 4ND9A 3SKPA 4E0WA 3HHFA 3I6VA 1MS7A 1MH3A 3CG3A 2ZNTA 5L9OA 1BTJA 3N94A 3MW0A 4F39A 3KFMA 2NVUB 5ICQA 1B3EA 1I6QA 4F19A 1QJMA 4C0RA 4GL0A 4HTGA 1HSJA 4F3GA 3MZ1A 3A3UA 4DE8A 5CRYA 1UQWA 1J1NA 1S7YA 1N7WA 4DXCA 4POWA 5TPAB 1MY0A 3KOSA 3N7PA 4PP0A 3GXAA 4WEDA 3PPOA 3FIRA 5TP9B 4KPTA 3TODA 2VP1A 3T9UA 3B6TA 5I58B 1VFEA 4JSOA 3O6HA 4PQJA 4Z0IA 3V5AA 2DVCA 1OLAA 3M3KA 1MY2A 4JWYA 2NOOA 1AOVA 4OYVA 2I6EA 5ELVA 3PUYE 2I4CA 3C36A 3SDFA 3ZS6A 2RC8A 1R9QA 1NMUA 2XXUA 4GFRA 2OWTA 3AQFB 1RYXA 2A5TB 5A5XB 2F36A 5I59B 4NWCA 1ANFA 3IO4A 5JEIA 4ZEFA 3TAJA 4U23A 3PU5A 3RTFB 1A7LA 1VR5A 4QFPA 4G8HA 2VGQA 3CIJA 4BDNA 3EHUA 3R7XA 4EQ7A 1XS5A 2NWJA 4XKPA 4DIGA 1BLFA 3LSWA 1SW4A 4F18A 1OIBA 3RLFE 3H6UA 4F1VA 4QFOA 1P1UA 1O64A 2X26A 1DMBA 3E4RA 4YU0A 3VLUA 2PT1A 4DCXA 4QF9A 2VD3A 2X7PA 3C34A 4NF4A 3L2JA 3IR1A 3C59A 1EU8A 3TCFA 3TQLA 4IO3A 2XXHA 5H8FA 1B4ZA 1HSLA 4EF1A 3JV9A 2DWJA 4Q30B 1N04A 1LSTA 1IXHA 5ITOA 4R2FA 1MG1A 4E0XA 2HFBA 1YPNA 4H1XA 5HBCA 3O97A 4U22A 3RNNA 5KCJB 2Y7IA 4G68C 4X9TA 3RGYA 1YTVA 3PV0E 1D9YA 3UORA 4O3BA 4GQOA 3IOVA 5I2NA 4OFJA 4YKIA 3TQWA 1IITA 2D21A 4MFIA 2OJTA 3K6XA 3HHGA 3O2AA 1NFTA 3K6WA 4OEUA 1FTMA 1XVYA 3EHTA 4FATA 2F7BA 3SEUA 2RCBA 1B0LA 4DZ1A 4O3AA 1PC3A 2YJPA 4YICA 1NL5A 1NNPA 4LZ7A 4QFKA 1AL3A 1Y1ZA 2F35A 4G8NA 4OFOA 3FVKA 4QHQA 3TPAA 5AA2B 4ZZAA 1BIYA 1N76A 3S9LC 5I84A 3VFJA 4U4XA 4I8CA 3WAEA 3B6QA 4FEBA 3D4CA 1ELJA 4U21A 1SW2A 1B7ZA 1B3HA 4N07A 1QW0A 3BFTA 3MVZA 1H3DA 4Q0CA 3WAFA 3DLNA 1QKAA 4X1BA 2DVZA 2XXRA 2FA7A 1MM7A 4G68B 3V89B 3IK6B 1JNFA 3C5TA 1IEJA 1XHYA 1B6HA 1B32A 3LBSA 3RQTA 4GXAA 3LC8A 3N26A 4BDMA 3C4MA 2H98A 1TFAA 5JTYB 5M2VA 1Y9UA 1EZ9A 2H99A 4RNSA 4I62A 5ISUA 4RPNA 2V3QA 1B46A 3QSLA 5H8HA 2Y84A 3A09A 4YB5A 2R6GE 4I9DA 4NF5A 3RY3A 4U1ZA 3MP6A 1SQYA 4U4SA 3M3LA 2KLFA 3SERA 3Q27A 5I57A 1B51A 3R26A 4IY6A 2JNDA 1EZPA 4IO5A 2DWAA 3IOLA 3N7RA 4LQ5A 4JB7A 2Z8FA 3FJ7A 2O1MA 3TTNA 3B7DA 1USYH 3K4UA 4XIGQ 4G2ZA 2NUVA 2B3BA 3TTLA 4PFTA 4RPOA 2Q2AA 2LAOA 5B7DA 1O63A 5KDTB 1M5BA 3FV1A 3VVDA 1MPDA 5DYHA 3JZJA 1NH7A 1LCTA 3O6GA 4IGTA 4R75A 4H6DA 3S4UA 2Q2CA 2V84A 4X48A 3VVFA 3G3FA 2D3IA 5DEXA 1UTBB 5I2KB 4QSCA 3S9MC 1MY1A 3EQ1A 1PB7A 3OO9A 2W7YA 3W15C 4M4GA 1F9BA 2PT2A 4PFYA 3EHSA 3TCGA 4P0IA 2V3TA 5DVFA 1MM6A 3KN8A 3UIFA 4BDLA 1NNTA 1SDXA 3OD7A 3KOTA 4RK2A 4OESA 1B5IA 3IJOB 3MZBA 4KCDA 3QYTA 1Y4CA 3OSQA 5L9MA 1L5TA 3UP9A 1ATGA 1B3GA 4U2RA 2JNCA 1WVJA 1JVXA 3AXFA 4KHZE 4ZGMA 3TELA 5CBRA 1M5DA 2VHAA 4R6KA 2PMSA 3CSGA 1PEBA 1JVYA 3MVWA 3K1PA 2XXVA 1SI0A 1MXVA 2HAVA 2ZXTA 2XX9A 5H8NA 4OTEA 1JEVA 4HCYA 3TKDA 4G4PA 4LP2B 2Y7KA 5FTHA 3P7IA 5FTIA 3ODBA 4NF8B 4QFNA 5I58A 1XOCA 3CFZA 2PVUA 3U93A 4BDRA 1MQHA 2BJJX 4LZ5A 4AQ4A 3QUFA 1MXYA 4YKPA 2CMOA 3QIMA 5AA4B 2HXWA 4OETA 2Z22A 3PMVA 5II0A 1AIVA 5BWJA 1MQDA 3THIA 2A5TA 3GZGA 2ZNUA 3Q26A 4H65A 2F34A 5I59A 4R9GA 1R6ZA 4MLQA 1VFDA 1M5CA 1I6AA 1MPCA 1M5EA 2I4BA 3FJGA 1US5A 4YMAA 1US4A 1PDAA 1VSOA 3H6VA 2GFEA 3EPEA 1MY4A 2F78A 3FATA 3MVXA 2CZLA 4LZ8A 2XXXA 1N7XA 4C1UA 4OFLA 3OELA 5LOMA 3IB1A 2O84X 5F7VA 4PFUA 1MXUA 4IB2A 4H67A 1S9TA 4FE8A 1Y20A 3O66A 4KYSA 5BUUA 3TFLA 4EDPA 1NH8A 3SEXA 2XXWA 2B3FA 1N84A 2D5WA 4DXBA 3S9EA 1P1QA 4WKMA 3T9XB 2XX7A 1FTKA 5KCJA 3ZKKA 1I6BA 1D3KA 1FQEA 2ANJA 4F29A 5AA2D 3TCHA 3DP6A 3VXCA 1A99A 2WKYA 3UK4A 2O69A 3UN6A 4THIA 2UYEA 5CMBA 3T66A 1YAEA 1LBCA 3HV1A 1EZOA 3A3CA 2P0SA 1QULA 3VLWA 1B0HA 1ZKBA 4JWOA 4OEVA 2RC7A 4GVOA 2DS9A 2OCUA 4ZEBA 1NNFA 5HM4B 5CBSA 4HJ0A 5FHOA 2XXYA 2FNCA 3G3KA 2I3VA 1Y3PA 1POY1 3DP8A 4RYAA 2F5XA 3OEKA 4WXJA 1GR2A 3IOUA 1PB9A 2AL4A 1PB8A 4JXIA 4ZECA 3CR9A 3FVNA 3UGWA 4ZEIA 2ONSA 2PBWA 1MQIA 4BDQA 3KN7A 3TTRA 1FCKA 4ELQA 4ZEKA 1I69A 4MF3A 3H4ZA 2OZZA 2QS4A 1TFDA 1YCJA 1JW4A 3RT6B 4NE4A 5ITPA 1LB9A 1P99A 1SBPA 2GH9A 2A5SA 1LAXA 1URSA 3N6TA 2V93A 2Y7RA 2F7AA 1UTHA 4QRZA 5IKBA 1TXFA 4LQ2A 4ESWA 3T22A 1DPPA 3KG2A 2ZYMA 3MAMA 3V83A 1FQAA 3I5OA 3KN3A 1IQ7A 4O3CA 1O7TA 4ERSA 3K6VA 4KR5A 2ABHA 5EYFA 2AYSA 2Z8DA 1JW5A 3RT8A 2ZMBA 2XXTA 2H4IA 2HZKA 2XX8A 4ZZEA 2Q88A 3TDJA 4LVQA 1IIWA 4GOTA 3OO8A 2B65A 3IJXB 4DLOA 1LAHE 2F7CA 1II5A 2ONKE 3T9VA 2HCAA 3U94A 3RUMA 1SW5A 3OEMA 3K1MA 5CI5A 4YMBA 4KYDA 1ZU0A 3IO6A 3QAXA 1QVSA 2XDGA 4JDFA 5KZTA 4H8IA 4ZDMA 3S2VA 3PUVE 1EH3A 3LSLA 4FECA 5L8DA 4H5GA 4MLVA 4G8MA 3PPPA 4NF4B 1H44A 1TWYA 1DOTA 1B7UA 2XD3A 3ONMA 3SEWA 4NEDA 4DLQA 5H8FB 1SVXB 4IY5A 1DPEA 3ECRA 4HS7A 4F2QA 1TT1A 3R6UA 3BFUA 3IB0A 2V25A 2F6PA 2IEEA 3Q25A 3ILTB 3C33A 3ZSFA 3FVGA 2DE4A 2Q8JA 4QFLA 4NWDA 2DE3A 2E0SA 5DVJA 4P11A 1FQDA 1FW0A 4EXLA 3CRBA 4R6HA 3CG1A 2HAUA 2QS1A 5CC2A 4XKNA 5I2NB 1B3LA 3MJNA 3USDA 3CI8A 2H25A 1RKMA 2M8CA 2XHDA 1ZMGA 4ONYA 3KGCA 5K2XA 3O6IA 5H8QB 4EXKA 1LGBC 4KD5A 3VVEA 1OLCA 3RN8A 2V3UA 3C9HA 4ISUA 3FJMA 1JW1A 3K00A 3DELB 4WEPA 3PUZE 3MWBA 3TTKA 4R72A 4OENA 4I1DA 3SESA 3IAZA 1LFIA 5EHMA 1Y1MA 3OO6A 2G29A 4GIZA 5CMKA 2Q89A 2XXQA 3L6HA 1A8FA 4AB5A 1B40A 4YAHX 2YLNA 4F1YA 2RINA 1IXCA 4G77A 2F97A 4NTLA 3C32A 3PMXA 3PUXE 1JEUA 2QS3A 1GGGA 1HSEA 1QUIA 2RKMA 3TEPA 2QJEA 5DVIA 1POTA 3KSXA 4Z7EA 5J1DA 4TLMB 2I58A 3PPQA 4POXA 2QKHA 2UYFA 4YKJA 1A8EA 1ZBMA 3KSJA 3PUWE 5H8HB 1A55A 5I56B 4LUBA 4PE5B 1FQCA 4BDOA 1U34A 3VDFA 5TPAA 4NF5B 4F1UA 1LAFE 1BP5A 3K2DA 2XXIA 2F8DA 4RJZA 5TP9A 1FTJA 1IXGA 4EF2A 5I57B 1MQGA 3TUSA 4UA8A 4XKQA 4KYEA 4R2BA 1B05A 4NF6B 3L6GA 3FV2A 4MH5A 1IXIA 1H45A 3G7WA 2O6AA 3H7MA 4OXVA 1SYHA 3FZVA 1AH5A 5CMCA 2DXRA 3T9HB 3CVGA 4GF8A 3ZKLA 1LLSA 3MQ9A 2XXPA 1SD3A 1MH4A 3H06B 3S9NC 2DWHA 3FGSA 2REJA 1LB8A 5A5XA 3E3KA 2JODA 4MBPA 1PBPA 3H03A 1D4NA 4GRKA 1M5FA 2RCAA 1FTLA 1MXXA 3MVYA 2DSFA 3QK6A 1UIVA 2REGA 4OHNA 1SI1A 4OWDA 3KBRA 5JK4A 4ZEDA 2O68A 1ZIUA 2X7QA 4HCWA 4QSDA 2DYXA 5TU0A 3Q29A 4F3BA 4XKRA 1H43A 4RA1A 2I48A 2P1SA 1Z7ME 1SW1A 3IX1A 4EUOA 4U1OA 4ELRA 2I0BA 4TOZA 1B5JA 3IB2A 3K02A 1PBQA 2OWSA 4OVJA 3TMGA 2GHBA 2IA4A 4OZ9A 4R9FA 1MXZA 3EF7A 4XXUA 5L9SA 3LR1A 5H8NB 3PPRA 3E13X 4H8JA 5FHNA 3N7SA 2QL3A 1P1OA 2VD2A 2O51A 3FXQA 3G3HA 2ZYOA 2E1SA 2HZLA 2I3WA 4R74A 3DM0A 2L27A 3IL1B 1MY3A 4RK9A 2DOJA 5AE4A 1CB6A 3PGFA 3LSFB 1GTKA 4PFWA 1B4HA 3CFXA 4P0GA 2UVGA 3TYHA 3H6WA 2Z23A 4H5FA 1WDNA 3DP4A 4QSEA 5H8SA 2I0CA 2HQ0A 2Z8EA 4F31B 1MPBA 1FQFA 4FORA 5AA2A 2FYIA 3U1OA 3BKIB 4UACA 5AA1A 3FD3A 1LFGA 1Q35A 2VOZA 1MXWA 3QUJA 2AIXA 1VE4A 2RC9A 2ZNSA 4ZE8A 4ELOA 2Y7WA 1N0TA 1OMPA 4LONB 3KJ7A 3HN0A 3IOWA 4N6PA 2Q9TA 1R9LA 1B52A 3OMBA 4GLIA 5IAIA 4G68A 4JSDA 3OENA 2UVIA 4FEDA 1P1WA 2O1LA 3MP1A 3MZ9A 1MDP1 2NXOA 2G93A 3D4GA 2O7UA 3U92A 5EHSA 4YZZA 2ONRA 3MBPA 3N6UA 5JTYA 3GBAA 4OQOA 3CSBA 4DDDA 3FXUA 3PD9A 2H5YA 2UXAA 3T93B 1P1NA 1QUJA 1XC1A 4KI0E 2QSXA 4ZS9A 3SEVA 5DT6A 4F22A 1URDA 1GV8A 1DTZA 1DSNA 2QMXA 4F3SA 5CMMA 3GBBA 5DTBA 3OXNA 1B1XA 1BKAA 2AL5A 5H8QA 2UVHA 1CE2A 1D9VA 3E9XA 4ELPA 1SYIA 1MQJA 2R9JA 2PYYA 1NKXA 1QKBA 1ZLQA 3OO7A 4X1DA 3IORA 5KDTA 3K0VA 4FAJA 3KEIA 5B70A 1Y3NA 2OBGA 4C1TA 5FHMA 1Q1KA 1XT8A 1WODA 4Q5TA 2PX1A 3C31A 2ZYNA 3UA8A 4DLDA 3MUQA 4JBZA 3VE1B 1R1NA 3LUYA 5CM6A 3M3FA 1URGA 1UTBA 5I2KA 5AA3A 2DE2A 3QXMA 1B7HA 4TQUQ 4R6YA 1A54A 3OOAA 2R71A 3W9WA 4EQBA 3K01A 1OVTA 3PPNA 1IZ1A 2OLBA 5ICTA 1B3FA 2DQVA 1UTHB 3M8UA 4M1VA 1Y4TA 3HCQA 2ESNA 4FIMA 3C35A 1N3XA 3SETA 1QUKA 3I3VA 1LFHA 4F2OA 4GXSB 3JYRA 3B6WA 2YPNA 1JETA 3EN3A 3N5LA 3OSRA 5I56A 2Y7PA 1Y3QA 4ECFA 1FTOA 4GD5A 1FQBA 2QS2A 5K2YA 3G3IA 1N3WA 2I49A 3HPIA 3K1NA 3O29A 1RYOA 4NF8A 3TZAA 1XVXA 3W9VA 3U8QA 3TTMA 4KQPA 1UIUA 4NF6A 4GL8A 2GHAA 3O9PA 3MPLA 3HSTA 5AA4A 2RF1A 3ILUB 3PD8A 4OMBA 3FASA 3IOTA 4Q8RA 2ZYKA 1USYE 4IO2A 4OERA 1KWHA 3F11A 3MC2A 2XD2A 1JQFA 4IO6A 1OQGA 3KZGA 4ZE9A 4PETA 4RY1A 4YB7A 3Q28A 4DXUA 3K6UA 4NMYA 4YB6A 2OK2A 3SEYA 1B9JA 2F6GA 5HPQA 3RTWB 3H3GA 3KJTA 4IO7A 3T96B 4IGRA 1A40A 1GVCA 1LBBA 4IO4A 1B5HA 4LATA 4JWXA 3V8XB 1LAGE 3CFLA 2GRVA 1S50A 2DXYA 3MP8A 3LSXA 1AMFA 4HW8A 1ZJLA 1MRPA 3HO7A 2THIA 1LCFA 4LF3C 1B2HA 1IUDA 4L17A 3G3JA 4BLAA 3BBRA 4F3PA 3VXBA 2P2AA 4DCYA 1Z7NE 3GLBA 3VV5A 3U72A 2QMWA 2QRYA 3FVOA 4RXLA 4LA9A 1T0KA 2DWIA 5F1QA 1B1HA 1MDQA 1H76A 2DP8A 3FXRA 3PMWA 3FUZA
chains in the Genus database with same CATH superfamily
1FRPA 4ESXA 4GWOA 4TLLB 2O7IA 2H9BA 3G3GA 1EYIA 1FJ9A 4XTCQ 2UVJA 1FPFA 3O28A 2GQ1A 1ZTYA 4KFQA 2HHMA 4H0WA 4KCCA 2QPQA 4YKKA 3GYYA 1NNKA 2OX3A 3MPKA 4EQ9A 4R73A 1OQHA 1OVBA 3VLVA 5DEXB 3RPWA 2HEUA 4JVDA 3RPLA 1DTGA 3H6TA 4PFIA 4HE1A 4N13A 2QVRA 4AB6A 2ALUA 2DDKA 4K3FA 4P56A 1B58A 4FJPA 4ND9A 3SKPA 4E0WA 3HHFA 3I6VA 1MS7A 1MH3A 3CG3A 1NV7A 2ZNTA 5L9OA 1BTJA 3N94A 3MW0A 4F39A 3KFMA 2NVUB 3ROJA 1EYKA 5ICQA 1B3EA 1I6QA 4F19A 1QJMA 3SZPA 4C0RA 4OVPA 4GL0A 4HTGA 1HSJA 4F3GA 3MZ1A 3A3UA 4DE8A 5CRYA 1UQWA 1J1NA 1S7YA 1N7WA 4DXCA 4POWA 5TPAB 4XEQA 1MY0A 3KOSA 1SPIA 3N7PA 4PP0A 3GXAA 4WEDA 3PPOA 3FIRA 5TP9B 4KPTA 3TODA 2VP1A 3T9UA 3B6TA 5I58B 1VFEA 4JSOA 3O6HA 4PQJA 4Z0IA 3V5AA 2DVCA 1OLAA 3M3KA 1MY2A 4JWYA 2NOOA 1AOVA 4OYVA 1FBPA 2I6EA 5ELVA 3PUYE 2I4CA 3C36A 3SDFA 3ZS6A 2RC8A 4PFRA 5ET5A 1R9QA 5EQ8A 1NMUA 2XXUA 4GFRA 2OWTA 3AQFB 1RYXA 2A5TB 1DCUA 5A5XB 2F36A 5I59B 2FVZA 4NWCA 1ANFA 4PGPA 3IO4A 5JEIA 4ZEFA 3TAJA 4MNPA 4U23A 3PU5A 3RTFB 1A7LA 1VR5A 4QFPA 4G8HA 2VGQA 3CIJA 4BDNA 3EHUA 3R7XA 4EQ7A 1XS5A 2NWJA 4XKPA 4DIGA 1BLFA 3LSWA 1SW4A 4F18A 1OIBA 4PBQA 3RLFE 2L5VA 3H6UA 1RDXA 4QFOA 1P1UA 4F1VA 4PC9A 1O64A 2X26A 1DMBA 2FBPA 3E4RA 4YU0A 2V4CA 3VLUA 2PT1A 4DCXA 4QF9A 2VD3A 2X7PA 1KZ8A 2B4LA 5EQ7A 3C34A 4NF4A 4N6KA 3L2JA 3IR1A 3C59A 1FPDA 1EU8A 3TCFA 3TQLA 4H45A 2XXHA 4IO3A 5H8FA 1B4ZA 1HSLA 4EF1A 3JV9A 2DWJA 4Q30B 4N91A 1N04A 4NHBA 1LSTA 1IXHA 1IMAA 5ITOA 4R2FA 1MG1A 2HFBA 4E0XA 1YPNA 4H1XA 5HBCA 3O97A 5I3SA 4MX6A 4U22A 3RNNA 5KCJB 2Y7IA 4G68C 4X9TA 2WBDA 3RGYA 1YTVA 1LBWA 3PV0E 1D9YA 5IZ3B 3UORA 4O3BA 4GQOA 3NOHA 3IOVA 5I2NA 4OFJA 4YKIA 3TQWA 1IITA 2D21A 4MFIA 2OJTA 3K6XA 4I3EA 3HHGA 2ZZWA 4PAIA 3O2AA 2PCRA 1NFTA 3K6WA 4OEUA 1FTMA 2QVVA 4X04A 4MCOA 1XVYA 3EHTA 4P1LA 4FATA 2F7BA 3SEUA 2RCBA 1B0LA 4O3AA 4DZ1A 1PC3A 2XWVA 2YJPA 4YICA 1NL5A 1NNPA 4LZ7A 4N81A 4QFKA 1AL3A 1Y1ZA 1LBVA 1FBGA 2F35A 4G8NA 4PAFA 3T1BA 4OFOA 3FVKA 4QHQA 3TPAA 5AA2B 4ZZAA 1BIYA 1N76A 3S9LC 2WX9A 5I84A 3VFJA 4U4XA 4I8CA 3WAEA 3B6QA 4FEBA 3D4CA 1ELJA 4U21A 1SW2A 1FBDA 4GWZA 1B7ZA 1LBZA 1B3HA 1NUZA 4N07A 1QW0A 3BFTA 3MVZA 1H3DA 4Q0CA 3WAFA 3DLNA 1QKAA 4X1BA 2QVUA 2DVZA 2XXRA 2FA7A 1MM7A 4G68B 3V89B 3IK6B 2QFLA 5LDZA 4MEVA 1JNFA 4HE2A 3C5TA 1IEJA 1XHYA 2P3VA 1B6HA 1B32A 3LBSA 3RQTA 4GXAA 3LC8A 3N26A 4BDMA 3C4MA 2H98A 1TFAA 5JTYB 5M2VA 1Y9UA 1EZ9A 2H99A 4RNSA 4I62A 5ISUA 4RPNA 2V3QA 1B46A 3QSLA 5H8HA 2Y84A 1FBEA 3A09A 4YB5A 2R6GE 4I9DA 4NF5A 3RY3A 4U1ZA 3MP6A 1SQYA 4U4SA 5EYHA 3M3LA 2KLFA 3SERA 3Q27A 5I57A 1B51A 3R26A 4IY6A 2JNDA 1EZPA 4IO5A 2DWAA 3IOLA 4GX6A 3N7RA 4LQ5A 4JB7A 2Z8FA 3FJ7A 4XFEA 2VPOA 4H46A 2O1MA 3TTNA 2XWKA 3B7DA 2VT5A 1USYH 3K4UA 4XIGQ 4G2ZA 3E79A 2NUVA 3MSTA 2B3BA 3TTLA 1NV0A 4PFTA 4RPOA 3RYDA 2WYPA 2Q2AA 1IMEA 2LAOA 5B7DA 1O63A 2XA5A 5KDTB 1M5BA 3FV1A 4IR8A 3VVDA 2WYKA 1MPDA 5DYHA 3JZJA 1NH7A 1LCTA 3O6GA 4IGTA 3KC0A 4R75A 4H6DA 3S4UA 1FSAA 2Q2CA 2V84A 4X48A 3VVFA 1XI6A 3G3FA 2D3IA 5DEXA 1UTBB 5I2KB 4QSCA 4P47A 1MY1A 3EQ1A 1NUWA 2ZZVA 3S9MC 1PB7A 4PTKA 3OO9A 2W7YA 3W15C 4M4GA 1F9BA 2PT2A 4PFYA 3EHSA 3TCGA 4P0IA 2V3TA 5DVFA 1MM6A 3KN8A 4MNCA 3UIFA 4BDLA 1NNTA 1SDXA 2B4MA 3OD7A 3KOTA 4RK2A 4OESA 1B5IA 3IJOB 3MZBA 4KCDA 3QYTA 1Y4CA 3OSQA 5L9MA 1L5TA 3UP9A 1ATGA 1B3GA 4U2RA 2JNCA 1WVJA 2CEXA 1JVXA 3AXFA 4KHZE 4ZGMA 3TELA 5CBRA 4MIJA 1M5DA 2VHAA 4R6KA 2PMSA 3CSGA 1PEBA 1JVYA 3MVWA 3K1PA 2XXVA 1FBFA 1SI0A 1MXVA 2HAVA 2ZXTA 2XX9A 5H8NA 4OTEA 1JEVA 4HCYA 3TKDA 4G4PA 4LP2B 2Y7KA 5FTHA 3P7IA 5FTIA 3ODBA 4NF8B 4QFNA 5I58A 1XOCA 3CFZA 2PVUA 3U93A 4BDRA 4NG7A 1MQHA 2BJJX 4LZ5A 4AQ4A 3QUFA 1MXYA 4YKPA 2CMOA 4GWXA 3QIMA 5AA4B 2HXWA 4OETA 2Z22A 3PMVA 5II0A 4PDHA 1AIVA 5BWJA 1MQDA 3THIA 4OVTA 2A5TA 3GZGA 2ZNUA 3Q26A 4H65A 2F34A 5I59A 4R9GA 1R6ZA 4MLQA 5ESYA 1VFDA 1M5CA 1I6AA 1MPCA 1M5EA 2I4BA 4OVRA 3FJGA 1US5A 4YMAA 1US4A 1PDAA 1VSOA 3H6VA 2GFEA 3BIGA 3E78A 3EPEA 4PDDA 1MY4A 2F78A 4HXVA 3FATA 3MVXA 3LUZA 2CZLA 4LZ8A 2XXXA 2OWZA 4PFBA 1NI9A 1N7XA 4C1UA 4P1EA 4OFLA 3OELA 5LOMA 3IB1A 2O84X 5F7VA 4PFUA 1MXUA 4IB2A 4H67A 1S9TA 4FE8A 1Y20A 3O66A 4KYSA 5BUUA 3TFLA 4EDPA 1NH8A 2BJIA 4O7MA 3SEXA 2XXWA 2B3FA 3IFCA 1N84A 2D5WA 4DXBA 3S9EA 1P1QA 1RDYA 4WKMA 3T9XB 2XX7A 1FTKA 5KCJA 3ZKKA 1I6BA 1D3KA 1FQEA 3QMFA 2ANJA 4NQ8A 4F29A 5AA2D 3TCHA 3DP6A 3VXCA 1A99A 2WKYA 3UK4A 2O69A 3CHGA 3UN6A 4THIA 2UYEA 2HXRA 5CMBA 3T66A 1YAEA 1LBCA 3HV1A 1EZOA 3A3CA 2P0SA 4G61A 1QULA 3VLWA 1B0HA 1ZKBA 4JWOA 4OEVA 2RC7A 4GWYA 4GVOA 2DS9A 2OCUA 4ZEBA 1NNFA 5HM4B 5CBSA 4HJ0A 2Q8MA 4QBAA 5FHOA 1IMCA 2XXYA 2FNCA 3G3KA 2JJKA 1QGXA 2I3VA 1Y3PA 3RPLB 1POY1 3DP8A 4OA4A 4RYAA 2F5XA 3OEKA 3IOUA 1GR2A 4WXJA 1PB9A 2AL4A 1PB8A 4JXIA 4ZECA 3CR9A 3FVNA 3UGWA 2CZKA 4ZEIA 2ONSA 2PBWA 1MQIA 4BDQA 3KN7A 3TTRA 1FCKA 4PCDA 4ELQA 4ZEKA 1D9QA 4X8RA 4N15A 1I69A 4MF3A 3H4ZA 2OZZA 2QS4A 1TFDA 1YCJA 1JW4A 3RT6B 4NE4A 4PGNA 5ITPA 1LB9A 1P99A 3EKIA 1SBPA 1JP4A 2GH9A 2A5SA 1LAXA 1URSA 3N6TA 2V93A 2Y7RA 2F7AA 1K9YA 1UTHA 4QRZA 1BK4A 5IKBA 1TXFA 2XXKA 4LQ2A 4ESWA 4MMPA 3T22A 1DPPA 4GWWA 3KG2A 2ZYMA 3MAMA 1FBCA 3V83A 1FQAA 3I5OA 3KN3A 4N8GA 1IQ7A 2FIXA 4O3CA 1O7TA 4ERSA 3K6VA 4KR5A 2ABHA 5EYFA 2AYSA 1NV4A 5EQ9A 2Z8DA 1NV2A 1JW5A 5FBPA 3RT8A 5ET7A 5ET8A 5EYGA 2ZMBA 2XXTA 2H4IA 2HZKA 2XX8A 4ZZEA 2Q88A 3TDJA 4LVQA 1IIWA 2F3BA 4GOTA 3OO8A 2B65A 3IJXB 4DLOA 1LAHE 2F7CA 1II5A 1FBHA 2ONKE 3T9VA 2HCAA 4JVCA 3D1RA 3U94A 3RUMA 1SW5A 3OEMA 3K1MA 1FJ6A 5CI5A 3KBZA 4JVIA 4YMBA 4KYDA 2WBBA 1ZU0A 3IO6A 3QAXA 1QVSA 1NV5A 2XDGA 4JDFA 5KZTA 4H8IA 4ZDMA 3S2VA 3PUVE 3PTYA 1EH3A 3LSLA 4FECA 5L8DA 4H5GA 1DK4A 4MLVA 4G8MA 3PPPA 4NF4B 1H44A 1TWYA 1DOTA 1B7UA 2XD3A 3ONMA 3SEWA 4NEDA 4DLQA 5H8FB 1SVXB 4IY5A 4XF5A 1NUYA 5DW8A 1DPEA 3ECRA 4HS7A 4F2QA 1K9ZA 1TT1A 3R6UA 3BFUA 3IB0A 2V25A 2F6PA 2IEEA 3Q25A 4MJOA 3ILTB 3C33A 3ZSFA 3FVGA 2DE4A 2Q8JA 4QFLA 4NWDA 2DE3A 2E0SA 5ET6A 2P3NA 5DVJA 4P11A 1FQDA 1FW0A 4EXLA 3CRBA 4R6HA 3CG1A 2HAUA 2QS1A 4NAPA 4XKNA 5CC2A 1B3LA 5I2NB 3MJNA 3USDA 3CI8A 3BIHA 3T0JA 2H25A 1RKMA 2M8CA 2XHDA 1ZMGA 4ONYA 2MKZA 3KGCA 5K2XA 3O6IA 5H8QB 4EXKA 1LGBC 4KD5A 3VVEA 1LEVA 1OLCA 3RN8A 2V3UA 2R8TA 2HPGA 3C9HA 1IMFA 4ISUA 3FJMA 1JW1A 3K00A 3DELB 4WEPA 3PUZE 1YYZA 3MWBA 3TTKA 4MHFA 4R72A 4OENA 3ISPA 4I1DA 3SESA 3IAZA 1NV1A 1LFIA 4N8YA 5EHMA 1Y1MA 4OANA 3OO6A 2G29A 4GIZA 5CMKA 2Q89A 2XXQA 3L6HA 1A8FA 4AB5A 1B40A 4YAHX 2YLNA 4F1YA 2RINA 4O8MA 1IXCA 4G77A 2F97A 4NTLA 3C32A 3PMXA 3PUXE 1JEUA 2QS3A 1GGGA 4KXPA 1HSEA 1QUIA 2RKMA 3TEPA 2QJEA 5DVIA 1POTA 3KSXA 4Z7EA 2VPNA 2FIEA 5J1DA 4TLMB 2I58A 3PPQA 5LTCA 4POXA 3MYUA 2QKHA 5I5PA 2UYFA 4YKJA 1FPGA 1A8EA 4O7IA 1ZBMA 1RDZA 3KSJA 4GX3A 3PUWE 5H8HB 1A55A 5I56B 4LUBA 4PE5B 1FQCA 4BDOA 1U34A 3VDFA 5TPAA 4NF5B 4F1UA 1LAFE 1BP5A 3K2DA 2XXIA 4N4UA 2F8DA 4RJZA 5TP9A 1FTJA 1IXGA 4EF2A 5I57B 1MQGA 3TUSA 2KR0A 4UA8A 4XKQA 4KYEA 4R2BA 1B05A 4NF6B 1VDWA 3FV2A 3L6GA 4MH5A 1IXIA 1H45A 5A5LA 3G7WA 2O6AA 3H7MA 1YZ0A 4OXVA 1SYHA 3FZVA 1AH5A 2FHYA 5CMCA 3B50A 2DXRA 4N17A 3T9HB 3CVGA 4GF8A 3ZKLA 1LLSA 3MQ9A 2XXPA 1SD3A 1MH4A 3H06B 3S9NC 2DWHA 3FGSA 2REJA 1LB8A 5A5XA 1NUXA 3E3KA 2JODA 4MBPA 1PBPA 3H03A 1D4NA 4GRKA 1M5FA 4OVQA 2RCAA 1FTLA 1MXXA 3MVYA 2DSFA 3QK6A 1UIVA 2REGA 4OHNA 1SI1A 4OWDA 3KBRA 5JK4A 4ZEDA 2O68A 1ZIUA 2X7QA 4HCWA 4QSDA 4NN3A 2DYXA 5TU0A 3Q29A 4F3BA 4PBHA 4XKRA 4PF8A 1H43A 4RA1A 2I48A 2P1SA 4GBWA 1Z7ME 1SW1A 2XWOA 3IX1A 4EUOA 4U1OA 4ELRA 2I0BA 2Q74A 4TOZA 1B5JA 3IB2A 3K02A 1PBQA 2OWSA 4OVJA 3TMGA 2GHBA 2IA4A 4OZ9A 4R9FA 4P8BA 4GWSA 1MXZA 1NV6A 3EF7A 4XXUA 5L9SA 3LR1A 5H8NB 3A29A 3PPRA 5IZ3A 3E13X 4H8JA 5FHNA 3N7SA 2QL3A 1P1OA 2VD2A 2O51A 3FXQA 3G3HA 2ZYOA 2E1SA 2HZLA 5IGAA 2I3WA 4R74A 3DM0A 2L27A 3IL1B 1MY3A 4RK9A 2DOJA 5AE4A 1CB6A 3PGFA 3LSFB 1GTKA 4PFWA 1B4HA 3CFXA 4P0GA 4NGUA 2UVGA 3TYHA 4DI4B 5J16A 4MNIA 3H6WA 2Z23A 4H5FA 1WDNA 3DP4A 4QSEA 5H8SA 2I0CA 2HQ0A 2Z8EA 4F31B 1MPBA 1FQFA 4FORA 5AA2A 2FYIA 2Y5KA 3U1OA 4MAGA 3BKIB 4UACA 5AA1A 3FD3A 1LFGA 1Q35A 2VOZA 1MXWA 3QUJA 4P3LA 2AIXA 1VE4A 1LBYA 2RC9A 2ZNSA 3LV0A 1FPEA 4ZE8A 4ELOA 2Y7WA 1N0TA 1OMPA 4LONB 3KJ7A 3B8BA 1G0IA 3HN0A 1LBXA 3IOWA 4N6PA 2Q9TA 1R9LA 1B52A 3OMBA 4GLIA 5IAIA 4G68A 4FBPA 4P9KA 2WEFA 4JSDA 3OENA 2UVIA 4FEDA 1P1WA 2O1LA 3MP1A 3MZ9A 4DI3D 1MDP1 2NXOA 2G93A 3D4GA 2O7UA 5IZZA 3U92A 5EHSA 3IFAA 4YZZA 1INPA 1DBZA 4PE3A 2ONRA 3MBPA 5T3JA 3N6UA 4UABA 5JTYA 3GBAA 4QXDA 4OQOA 1FTAA 3CSBA 4DDDA 3FXUA 3PD9A 2H5YA 2UXAA 4AS4A 1KA1A 3T93B 1P1NA 1QUJA 1XC1A 4KI0E 2QSXA 4ZS9A 3SEVA 5DT6A 4F22A 1URDA 1GV8A 1DTZA 1KA0A 1DSNA 2QMXA 5I7IA 4F3SA 5CMMA 3GBBA 2Y5LA 5DTBA 3OXNA 1B1XA 1BKAA 2AL5A 5H8QA 1IMDA 2UVHA 1CE2A 1D9VA 3E9XA 4ELPA 1SYIA 1MQJA 2R9JA 2PYYA 1NKXA 1FPLA 1QKBA 1ZLQA 3OO7A 4X1DA 3IORA 5KDTA 3K0VA 4FAJA 3KEIA 5B70A 1Y3NA 2OBGA 4C1TA 5FHMA 1Q1KA 1XT8A 1WODA 1EYJA 4Q5TA 2PX1A 3C31A 2ZYNA 3UA8A 4DLDA 3MUQA 1G0HA 4JBZA 3VE1B 4HE0A 1R1NA 3KC1A 3LUYA 5CM6A 3M3FA 1IMBA 1URGA 1UTBA 5I2KA 5AA3A 2DE2A 3QXMA 1B7HA 4NF0A 4PAKA 4TQUQ 4R6YA 1A54A 1FPIA 3OOAA 2R71A 3W9WA 4EQBA 3K01A 1OVTA 3PPNA 1IZ1A 2OLBA 5ICTA 1B3FA 2DQVA 1UTHB 3M8UA 4M1VA 1Y4TA 3HCQA 4AS5A 2ESNA 4FIMA 3C35A 4OVSA 1N3XA 3SETA 3HFUA 1QUKA 5IM2A 3I3VA 1LFHA 2PFYA 1CNQA 4F2OA 4GXSB 3JYRA 3B6WA 2YPNA 1JETA 3EN3A 3N5LA 1YXIA 3OSRA 5I56A 4N6DA 2Y7PA 1Y3QA 4ECFA 4NX1A 1FTOA 4GD5A 1FQBA 2QS2A 5K2YA 3G3IA 1N3WA 2I49A 3HPIA 3K1NA 3O29A 1RYOA 4NF8A 3TZAA 1XVXA 3W9VA 3U8QA 2ZZXA 5F24A 3TTMA 4KQPA 1UIUA 4NF6A 1Q9DA 4GL8A 3FXBA 2GHAA 3O9PA 3MPLA 3HSTA 5AA4A 2RF1A 3ILUB 4PF6A 3PD8A 4I40A 4OMBA 3FASA 2F3DA 3IOTA 4Q8RA 2ZYKA 1USYE 4IO2A 4OERA 1KWHA 3F11A 1FPKA 2XD2A 1JQFA 3MC2A 4IO6A 4O94A 1OQGA 2PFZA 3KZGA 1AWBA 4ZE9A 4PETA 4RY1A 4YB7A 3Q28A 4DXUA 3K6UA 4NMYA 4YB6A 2OK2A 3SEYA 4I3YA 1B9JA 2F6GA 5HPQA 3RTWB 3H3GA 3KJTA 4IO7A 3T96B 2XWIA 4IGRA 1A40A 1GVCA 1FPJA 1LBBA 4IO4A 1B5HA 2CZIA 4LATA 2KQZA 4JWXA 3V8XB 2CZHA 1LAGE 3CFLA 2GRVA 1S50A 2DXYA 4GWUA 3MP8A 1FPBA 4GX4A 3LSXA 1AMFA 4HW8A 1ZJLA 1MRPA 3HO7A 2THIA 1LCFA 4LF3C 1B2HA 1IUDA 4L17A 3G3JA 4BLAA 3BBRA 4F3PA 5EQAA 3VXBA 2P2AA 4DCYA 1Z7NE 3GLBA 3VV5A 3U72A 5IZ1A 2QMWA 2QRYA 3FVOA 2CEYA 4RXLA 1NV3A 4LA9A 3FBPA 4GBVA 2DWIA 1T0KA 5F1QA 1B1HA 1MDQA 1H76A 2DP8A 3FXRA 3PMWA 4LN5A 3U65A 3FUZA
chains in the Genus database with same CATH topology
4ESXA 4GWOA 4TLLB 2O7IA 2H9BA 3G3GA 4XTCQ 2UVJA 3O28A 1ZTYA 4KFQA 4H0WA 4KCCA 2QPQA 4YKKA 1NNKA 3MPKA 4EQ9A 4R73A 1OQHA 1OVBA 3VLVA 5DEXB 3RPWA 2HEUA 1DTGA 3H6TA 4N13A 4AB6A 2ALUA 4K3FA 1B58A 4FJPA 4ND9A 3SKPA 4E0WA 3HHFA 3I6VA 1MS7A 1MH3A 3CG3A 2ZNTA 5L9OA 1BTJA 3N94A 3MW0A 4F39A 3KFMA 2NVUB 5ICQA 1B3EA 1I6QA 4F19A 1QJMA 4C0RA 4GL0A 4HTGA 1HSJA 4F3GA 3MZ1A 3A3UA 4DE8A 5CRYA 1UQWA 1J1NA 1S7YA 1N7WA 4DXCA 4POWA 5TPAB 1MY0A 3KOSA 3N7PA 4PP0A 3GXAA 4WEDA 3PPOA 3FIRA 5TP9B 4KPTA 3TODA 2VP1A 3T9UA 3B6TA 5I58B 1VFEA 4JSOA 3O6HA 4PQJA 4Z0IA 3V5AA 2DVCA 1OLAA 3M3KA 1MY2A 4JWYA 2NOOA 1AOVA 4OYVA 2I6EA 5ELVA 3PUYE 2I4CA 3C36A 3SDFA 3ZS6A 2RC8A 1R9QA 1NMUA 2XXUA 4GFRA 2OWTA 3AQFB 1RYXA 2A5TB 5A5XB 2F36A 5I59B 4NWCA 1ANFA 3IO4A 5JEIA 4ZEFA 3TAJA 4U23A 3PU5A 3RTFB 1A7LA 1VR5A 4QFPA 4G8HA 2VGQA 3CIJA 4BDNA 3EHUA 3R7XA 4EQ7A 1XS5A 2NWJA 4XKPA 4DIGA 1BLFA 3LSWA 1SW4A 4F18A 1OIBA 3RLFE 3H6UA 4F1VA 4QFOA 1P1UA 1O64A 2X26A 1DMBA 3E4RA 4YU0A 3VLUA 2PT1A 4DCXA 4QF9A 2VD3A 2X7PA 3C34A 4NF4A 3L2JA 3IR1A 3C59A 1EU8A 3TCFA 3TQLA 4IO3A 2XXHA 5H8FA 1B4ZA 1HSLA 4EF1A 3JV9A 2DWJA 4Q30B 1N04A 1LSTA 1IXHA 5ITOA 4R2FA 1MG1A 4E0XA 2HFBA 1YPNA 4H1XA 5HBCA 3O97A 4U22A 3RNNA 5KCJB 2Y7IA 4G68C 4X9TA 3RGYA 1YTVA 3PV0E 1D9YA 3UORA 4O3BA 4GQOA 3IOVA 5I2NA 4OFJA 4YKIA 3TQWA 1IITA 2D21A 4MFIA 2OJTA 3K6XA 3HHGA 3O2AA 1NFTA 3K6WA 4OEUA 1FTMA 1XVYA 3EHTA 4FATA 2F7BA 3SEUA 2RCBA 1B0LA 4DZ1A 4O3AA 1PC3A 2YJPA 4YICA 1NL5A 1NNPA 4LZ7A 4QFKA 1AL3A 1Y1ZA 2F35A 4G8NA 4OFOA 3FVKA 4QHQA 3TPAA 5AA2B 4ZZAA 1BIYA 1N76A 3S9LC 5I84A 3VFJA 4U4XA 4I8CA 3WAEA 3B6QA 4FEBA 3D4CA 1ELJA 4U21A 1SW2A 1B7ZA 1B3HA 4N07A 1QW0A 3BFTA 3MVZA 1H3DA 4Q0CA 3WAFA 3DLNA 1QKAA 4X1BA 2DVZA 2XXRA 2FA7A 1MM7A 4G68B 3V89B 3IK6B 1JNFA 3C5TA 1IEJA 1XHYA 1B6HA 1B32A 3LBSA 3RQTA 4GXAA 3LC8A 3N26A 4BDMA 3C4MA 2H98A 1TFAA 5JTYB 5M2VA 1Y9UA 1EZ9A 2H99A 4RNSA 4I62A 5ISUA 4RPNA 2V3QA 1B46A 3QSLA 5H8HA 2Y84A 3A09A 4YB5A 2R6GE 4I9DA 4NF5A 3RY3A 4U1ZA 3MP6A 1SQYA 4U4SA 3M3LA 2KLFA 3SERA 3Q27A 5I57A 1B51A 3R26A 4IY6A 2JNDA 1EZPA 4IO5A 2DWAA 3IOLA 3N7RA 4LQ5A 4JB7A 2Z8FA 3FJ7A 2O1MA 3TTNA 3B7DA 1USYH 3K4UA 4XIGQ 4G2ZA 2NUVA 2B3BA 3TTLA 4PFTA 4RPOA 2Q2AA 2LAOA 5B7DA 1O63A 5KDTB 1M5BA 3FV1A 3VVDA 1MPDA 5DYHA 3JZJA 1NH7A 1LCTA 3O6GA 4IGTA 4R75A 4H6DA 3S4UA 2Q2CA 2V84A 4X48A 3VVFA 3G3FA 2D3IA 5DEXA 1UTBB 5I2KB 4QSCA 3S9MC 1MY1A 3EQ1A 1PB7A 3OO9A 2W7YA 3W15C 4M4GA 1F9BA 2PT2A 4PFYA 3EHSA 3TCGA 4P0IA 2V3TA 5DVFA 1MM6A 3KN8A 3UIFA 4BDLA 1NNTA 1SDXA 3OD7A 3KOTA 4RK2A 4OESA 1B5IA 3IJOB 3MZBA 4KCDA 3QYTA 1Y4CA 3OSQA 5L9MA 1L5TA 3UP9A 1ATGA 1B3GA 4U2RA 2JNCA 1WVJA 1JVXA 3AXFA 4KHZE 4ZGMA 3TELA 5CBRA 1M5DA 2VHAA 4R6KA 2PMSA 3CSGA 1PEBA 1JVYA 3MVWA 3K1PA 2XXVA 1SI0A 1MXVA 2HAVA 2ZXTA 2XX9A 5H8NA 4OTEA 1JEVA 4HCYA 3TKDA 4G4PA 4LP2B 2Y7KA 5FTHA 3P7IA 5FTIA 3ODBA 4NF8B 4QFNA 5I58A 1XOCA 3CFZA 2PVUA 3U93A 4BDRA 1MQHA 2BJJX 4LZ5A 4AQ4A 3QUFA 1MXYA 4YKPA 2CMOA 3QIMA 5AA4B 2HXWA 4OETA 2Z22A 3PMVA 5II0A 1AIVA 5BWJA 1MQDA 3THIA 2A5TA 3GZGA 2ZNUA 3Q26A 4H65A 2F34A 5I59A 4R9GA 1R6ZA 4MLQA 1VFDA 1M5CA 1I6AA 1MPCA 1M5EA 2I4BA 3FJGA 1US5A 4YMAA 1US4A 1PDAA 1VSOA 3H6VA 2GFEA 3EPEA 1MY4A 2F78A 3FATA 3MVXA 2CZLA 4LZ8A 2XXXA 1N7XA 4C1UA 4OFLA 3OELA 5LOMA 3IB1A 2O84X 5F7VA 4PFUA 1MXUA 4IB2A 4H67A 1S9TA 4FE8A 1Y20A 3O66A 4KYSA 5BUUA 3TFLA 4EDPA 1NH8A 3SEXA 2XXWA 2B3FA 1N84A 2D5WA 4DXBA 3S9EA 1P1QA 4WKMA 3T9XB 2XX7A 1FTKA 5KCJA 3ZKKA 1I6BA 1D3KA 1FQEA 2ANJA 4F29A 5AA2D 3TCHA 3DP6A 3VXCA 1A99A 2WKYA 3UK4A 2O69A 3UN6A 4THIA 2UYEA 5CMBA 3T66A 1YAEA 1LBCA 3HV1A 1EZOA 3A3CA 2P0SA 1QULA 3VLWA 1B0HA 1ZKBA 4JWOA 4OEVA 2RC7A 4GVOA 2DS9A 2OCUA 4ZEBA 1NNFA 5HM4B 5CBSA 4HJ0A 5FHOA 2XXYA 2FNCA 3G3KA 2I3VA 1Y3PA 1POY1 3DP8A 4RYAA 2F5XA 3OEKA 4WXJA 1GR2A 3IOUA 1PB9A 2AL4A 1PB8A 4JXIA 4ZECA 3CR9A 3FVNA 3UGWA 4ZEIA 2ONSA 2PBWA 1MQIA 4BDQA 3KN7A 3TTRA 1FCKA 4ELQA 4ZEKA 1I69A 4MF3A 3H4ZA 2OZZA 2QS4A 1TFDA 1YCJA 1JW4A 3RT6B 4NE4A 5ITPA 1LB9A 1P99A 1SBPA 2GH9A 2A5SA 1LAXA 1URSA 3N6TA 2V93A 2Y7RA 2F7AA 1UTHA 4QRZA 5IKBA 1TXFA 4LQ2A 4ESWA 3T22A 1DPPA 3KG2A 2ZYMA 3MAMA 3V83A 1FQAA 3I5OA 3KN3A 1IQ7A 4O3CA 1O7TA 4ERSA 3K6VA 4KR5A 2ABHA 5EYFA 2AYSA 2Z8DA 1JW5A 3RT8A 2ZMBA 2XXTA 2H4IA 2HZKA 2XX8A 4ZZEA 2Q88A 3TDJA 4LVQA 1IIWA 4GOTA 3OO8A 2B65A 3IJXB 4DLOA 1LAHE 2F7CA 1II5A 2ONKE 3T9VA 2HCAA 3U94A 3RUMA 1SW5A 3OEMA 3K1MA 5CI5A 4YMBA 4KYDA 1ZU0A 3IO6A 3QAXA 1QVSA 2XDGA 4JDFA 5KZTA 4H8IA 4ZDMA 3S2VA 3PUVE 1EH3A 3LSLA 4FECA 5L8DA 4H5GA 4MLVA 4G8MA 3PPPA 4NF4B 1H44A 1TWYA 1DOTA 1B7UA 2XD3A 3ONMA 3SEWA 4NEDA 4DLQA 5H8FB 1SVXB 4IY5A 1DPEA 3ECRA 4HS7A 4F2QA 1TT1A 3R6UA 3BFUA 3IB0A 2V25A 2F6PA 2IEEA 3Q25A 3ILTB 3C33A 3ZSFA 3FVGA 2DE4A 2Q8JA 4QFLA 4NWDA 2DE3A 2E0SA 5DVJA 4P11A 1FQDA 1FW0A 4EXLA 3CRBA 4R6HA 3CG1A 2HAUA 2QS1A 5CC2A 4XKNA 5I2NB 1B3LA 3MJNA 3USDA 3CI8A 2H25A 1RKMA 2M8CA 2XHDA 1ZMGA 4ONYA 3KGCA 5K2XA 3O6IA 5H8QB 4EXKA 1LGBC 4KD5A 3VVEA 1OLCA 3RN8A 2V3UA 3C9HA 4ISUA 3FJMA 1JW1A 3K00A 3DELB 4WEPA 3PUZE 3MWBA 3TTKA 4R72A 4OENA 4I1DA 3SESA 3IAZA 1LFIA 5EHMA 1Y1MA 3OO6A 2G29A 4GIZA 5CMKA 2Q89A 2XXQA 3L6HA 1A8FA 4AB5A 1B40A 4YAHX 2YLNA 4F1YA 2RINA 1IXCA 4G77A 2F97A 4NTLA 3C32A 3PMXA 3PUXE 1JEUA 2QS3A 1GGGA 1HSEA 1QUIA 2RKMA 3TEPA 2QJEA 5DVIA 1POTA 3KSXA 4Z7EA 5J1DA 4TLMB 2I58A 3PPQA 4POXA 2QKHA 2UYFA 4YKJA 1A8EA 1ZBMA 3KSJA 3PUWE 5H8HB 1A55A 5I56B 4LUBA 4PE5B 1FQCA 4BDOA 1U34A 3VDFA 5TPAA 4NF5B 4F1UA 1LAFE 1BP5A 3K2DA 2XXIA 2F8DA 4RJZA 5TP9A 1FTJA 1IXGA 4EF2A 5I57B 1MQGA 3TUSA 4UA8A 4XKQA 4KYEA 4R2BA 1B05A 4NF6B 3L6GA 3FV2A 4MH5A 1IXIA 1H45A 3G7WA 2O6AA 3H7MA 4OXVA 1SYHA 3FZVA 1AH5A 5CMCA 2DXRA 3T9HB 3CVGA 4GF8A 3ZKLA 1LLSA 3MQ9A 2XXPA 1SD3A 1MH4A 3H06B 3S9NC 2DWHA 3FGSA 2REJA 1LB8A 5A5XA 3E3KA 2JODA 4MBPA 1PBPA 3H03A 1D4NA 4GRKA 1M5FA 2RCAA 1FTLA 1MXXA 3MVYA 2DSFA 3QK6A 1UIVA 2REGA 4OHNA 1SI1A 4OWDA 3KBRA 5JK4A 4ZEDA 2O68A 1ZIUA 2X7QA 4HCWA 4QSDA 2DYXA 5TU0A 3Q29A 4F3BA 4XKRA 1H43A 4RA1A 2I48A 2P1SA 1Z7ME 1SW1A 3IX1A 4EUOA 4U1OA 4ELRA 2I0BA 4TOZA 1B5JA 3IB2A 3K02A 1PBQA 2OWSA 4OVJA 3TMGA 2GHBA 2IA4A 4OZ9A 4R9FA 1MXZA 3EF7A 4XXUA 5L9SA 3LR1A 5H8NB 3PPRA 3E13X 4H8JA 5FHNA 3N7SA 2QL3A 1P1OA 2VD2A 2O51A 3FXQA 3G3HA 2ZYOA 2E1SA 2HZLA 2I3WA 4R74A 3DM0A 2L27A 3IL1B 1MY3A 4RK9A 2DOJA 5AE4A 1CB6A 3PGFA 3LSFB 1GTKA 4PFWA 1B4HA 3CFXA 4P0GA 2UVGA 3TYHA 3H6WA 2Z23A 4H5FA 1WDNA 3DP4A 4QSEA 5H8SA 2I0CA 2HQ0A 2Z8EA 4F31B 1MPBA 1FQFA 4FORA 5AA2A 2FYIA 3U1OA 3BKIB 4UACA 5AA1A 3FD3A 1LFGA 1Q35A 2VOZA 1MXWA 3QUJA 2AIXA 1VE4A 2RC9A 2ZNSA 4ZE8A 4ELOA 2Y7WA 1N0TA 1OMPA 4LONB 3KJ7A 3HN0A 3IOWA 4N6PA 2Q9TA 1R9LA 1B52A 3OMBA 4GLIA 5IAIA 4G68A 4JSDA 3OENA 2UVIA 4FEDA 1P1WA 2O1LA 3MP1A 3MZ9A 1MDP1 2NXOA 2G93A 3D4GA 2O7UA 3U92A 5EHSA 4YZZA 2ONRA 3MBPA 3N6UA 5JTYA 3GBAA 4OQOA 3CSBA 4DDDA 3FXUA 3PD9A 2H5YA 2UXAA 3T93B 1P1NA 1QUJA 1XC1A 4KI0E 2QSXA 4ZS9A 3SEVA 5DT6A 4F22A 1URDA 1GV8A 1DTZA 1DSNA 2QMXA 4F3SA 5CMMA 3GBBA 5DTBA 3OXNA 1B1XA 1BKAA 2AL5A 5H8QA 2UVHA 1CE2A 1D9VA 3E9XA 4ELPA 1SYIA 1MQJA 2R9JA 2PYYA 1NKXA 1QKBA 1ZLQA 3OO7A 4X1DA 3IORA 5KDTA 3K0VA 4FAJA 3KEIA 5B70A 1Y3NA 2OBGA 4C1TA 5FHMA 1Q1KA 1XT8A 1WODA 4Q5TA 2PX1A 3C31A 2ZYNA 3UA8A 4DLDA 3MUQA 4JBZA 3VE1B 1R1NA 3LUYA 5CM6A 3M3FA 1URGA 1UTBA 5I2KA 5AA3A 2DE2A 3QXMA 1B7HA 4TQUQ 4R6YA 1A54A 3OOAA 2R71A 3W9WA 4EQBA 3K01A 1OVTA 3PPNA 1IZ1A 2OLBA 5ICTA 1B3FA 2DQVA 1UTHB 3M8UA 4M1VA 1Y4TA 3HCQA 2ESNA 4FIMA 3C35A 1N3XA 3SETA 1QUKA 3I3VA 1LFHA 4F2OA 4GXSB 3JYRA 3B6WA 2YPNA 1JETA 3EN3A 3N5LA 3OSRA 5I56A 2Y7PA 1Y3QA 4ECFA 1FTOA 4GD5A 1FQBA 2QS2A 5K2YA 3G3IA 1N3WA 2I49A 3HPIA 3K1NA 3O29A 1RYOA 4NF8A 3TZAA 1XVXA 3W9VA 3U8QA 3TTMA 4KQPA 1UIUA 4NF6A 4GL8A 2GHAA 3O9PA 3MPLA 3HSTA 5AA4A 2RF1A 3ILUB 3PD8A 4OMBA 3FASA 3IOTA 4Q8RA 2ZYKA 1USYE 4IO2A 4OERA 1KWHA 3F11A 3MC2A 2XD2A 1JQFA 4IO6A 1OQGA 3KZGA 4ZE9A 4PETA 4RY1A 4YB7A 3Q28A 4DXUA 3K6UA 4NMYA 4YB6A 2OK2A 3SEYA 1B9JA 2F6GA 5HPQA 3RTWB 3H3GA 3KJTA 4IO7A 3T96B 4IGRA 1A40A 1GVCA 1LBBA 4IO4A 1B5HA 4LATA 4JWXA 3V8XB 1LAGE 3CFLA 2GRVA 1S50A 2DXYA 3MP8A 3LSXA 1AMFA 4HW8A 1ZJLA 1MRPA 3HO7A 2THIA 1LCFA 4LF3C 1B2HA 1IUDA 4L17A 3G3JA 4BLAA 3BBRA 4F3PA 3VXBA 2P2AA 4DCYA 1Z7NE 3GLBA 3VV5A 3U72A 2QMWA 2QRYA 3FVOA 4RXLA 4LA9A 1T0KA 2DWIA 5F1QA 1B1HA 1MDQA 1H76A 2DP8A 3FXRA 3PMWA 3FUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESX A;  4GWO A;  4TLL B;  2O7I A;  2H9B A;  3G3G A;  4XTC Q;  2UVJ A;  3O28 A;  1ZTY A;  4KFQ A;  4H0W A;  4KCC A;  2QPQ A;  4YKK A;  1NNK A;  3MPK A;  4EQ9 A;  4R73 A;  1OQH A;  1OVB A;  3VLV A;  5DEX B;  3RPW A;  2HEU A;  1DTG A;  3H6T A;  4N13 A;  4AB6 A;  2ALU A;  4K3F A;  1B58 A;  4FJP A;  4ND9 A;  3SKP A;  4E0W A;  3HHF A;  3I6V A;  1MS7 A;  1MH3 A;  3CG3 A;  2ZNT A;  5L9O A;  1BTJ A;  3N94 A;  3MW0 A;  4F39 A;  3KFM A;  2NVU B;  5ICQ A;  1B3E A;  1I6Q A;  4F19 A;  1QJM A;  4C0R A;  4GL0 A;  4HTG A;  1HSJ A;  4F3G A;  3MZ1 A;  3A3U A;  4DE8 A;  5CRY A;  1UQW A;  1J1N A;  1S7Y A;  1N7W A;  4DXC A;  4POW A;  5TPA B;  1MY0 A;  3KOS A;  3N7P A;  4PP0 A;  3GXA A;  4WED A;  3PPO A;  3FIR A;  5TP9 B;  4KPT A;  3TOD A;  2VP1 A;  3T9U A;  3B6T A;  5I58 B;  1VFE A;  4JSO A;  3O6H A;  4PQJ A;  4Z0I A;  3V5A A;  2DVC A;  1OLA A;  3M3K A;  1MY2 A;  4JWY A;  2NOO A;  1AOV A;  4OYV A;  2I6E A;  5ELV A;  3PUY E;  2I4C A;  3C36 A;  3SDF A;  3ZS6 A;  2RC8 A;  1R9Q A;  1NMU A;  2XXU A;  4GFR A;  2OWT A;  3AQF B;  1RYX A;  2A5T B;  5A5X B;  2F36 A;  5I59 B;  4NWC A;  1ANF A;  3IO4 A;  5JEI A;  4ZEF A;  3TAJ A;  4U23 A;  3PU5 A;  3RTF B;  1A7L A;  1VR5 A;  4QFP A;  4G8H A;  2VGQ A;  3CIJ A;  4BDN A;  3EHU A;  3R7X A;  4EQ7 A;  1XS5 A;  2NWJ A;  4XKP A;  4DIG A;  1BLF A;  3LSW A;  1SW4 A;  4F18 A;  1OIB A;  3RLF E;  3H6U A;  4F1V A;  4QFO A;  1P1U A;  1O64 A;  2X26 A;  1DMB A;  3E4R A;  4YU0 A;  3VLU A;  2PT1 A;  4DCX A;  4QF9 A;  2VD3 A;  2X7P A;  3C34 A;  4NF4 A;  3L2J A;  3IR1 A;  3C59 A;  1EU8 A;  3TCF A;  3TQL A;  4IO3 A;  2XXH A;  5H8F A;  1B4Z A;  1HSL A;  4EF1 A;  3JV9 A;  2DWJ A;  4Q30 B;  1N04 A;  1LST A;  1IXH A;  5ITO A;  4R2F A;  1MG1 A;  4E0X A;  2HFB A;  1YPN A;  4H1X A;  5HBC A;  3O97 A;  4U22 A;  3RNN A;  5KCJ B;  2Y7I A;  4G68 C;  4X9T A;  3RGY A;  1YTV A;  3PV0 E;  1D9Y A;  3UOR A;  4O3B A;  4GQO A;  3IOV A;  5I2N A;  4OFJ A;  4YKI A;  3TQW A;  1IIT A;  2D21 A;  4MFI A;  2OJT A;  3K6X A;  3HHG A;  3O2A A;  1NFT A;  3K6W A;  4OEU A;  1FTM A;  1XVY A;  3EHT A;  4FAT A;  2F7B A;  3SEU A;  2RCB A;  1B0L A;  4DZ1 A;  4O3A A;  1PC3 A;  2YJP A;  4YIC A;  1NL5 A;  1NNP A;  4LZ7 A;  4QFK A;  1AL3 A;  1Y1Z A;  2F35 A;  4G8N A;  4OFO A;  3FVK A;  4QHQ A;  3TPA A;  5AA2 B;  4ZZA A;  1BIY A;  1N76 A;  3S9L C;  5I84 A;  3VFJ A;  4U4X A;  4I8C A;  3WAE A;  3B6Q A;  4FEB A;  3D4C A;  1ELJ A;  4U21 A;  1SW2 A;  1B7Z A;  1B3H A;  4N07 A;  1QW0 A;  3BFT A;  3MVZ A;  1H3D A;  4Q0C A;  3WAF A;  3DLN A;  1QKA A;  4X1B A;  2DVZ A;  2XXR A;  2FA7 A;  1MM7 A;  4G68 B;  3V89 B;  3IK6 B;  1JNF A;  3C5T A;  1IEJ A;  1XHY A;  1B6H A;  1B32 A;  3LBS A;  3RQT A;  4GXA A;  3LC8 A;  3N26 A;  4BDM A;  3C4M A;  2H98 A;  1TFA A;  5JTY B;  5M2V A;  1Y9U A;  1EZ9 A;  2H99 A;  4RNS A;  4I62 A;  5ISU A;  4RPN A;  2V3Q A;  1B46 A;  3QSL A;  5H8H A;  2Y84 A;  3A09 A;  4YB5 A;  2R6G E;  4I9D A;  4NF5 A;  3RY3 A;  4U1Z A;  3MP6 A;  1SQY A;  4U4S A;  3M3L A;  2KLF A;  3SER A;  3Q27 A;  5I57 A;  1B51 A;  3R26 A;  4IY6 A;  2JND A;  1EZP A;  4IO5 A;  2DWA A;  3IOL A;  3N7R A;  4LQ5 A;  4JB7 A;  2Z8F A;  3FJ7 A;  2O1M A;  3TTN A;  3B7D A;  1USY H;  3K4U A;  4XIG Q;  4G2Z A;  2NUV A;  2B3B A;  3TTL A;  4PFT A;  4RPO A;  2Q2A A;  2LAO A;  5B7D A;  1O63 A;  5KDT B;  1M5B A;  3FV1 A;  3VVD A;  1MPD A;  5DYH A;  3JZJ A;  1NH7 A;  1LCT A;  3O6G A;  4IGT A;  4R75 A;  4H6D A;  3S4U A;  2Q2C A;  2V84 A;  4X48 A;  3VVF A;  3G3F A;  2D3I A;  5DEX A;  1UTB B;  5I2K B;  4QSC A;  3S9M C;  1MY1 A;  3EQ1 A;  1PB7 A;  3OO9 A;  2W7Y A;  3W15 C;  4M4G A;  1F9B A;  2PT2 A;  4PFY A;  3EHS A;  3TCG A;  4P0I A;  2V3T A;  5DVF A;  1MM6 A;  3KN8 A;  3UIF A;  4BDL A;  1NNT A;  1SDX A;  3OD7 A;  3KOT A;  4RK2 A;  4OES A;  1B5I A;  3IJO B;  3MZB A;  4KCD A;  3QYT A;  1Y4C A;  3OSQ A;  5L9M A;  1L5T A;  3UP9 A;  1ATG A;  1B3G A;  4U2R A;  2JNC A;  1WVJ A;  1JVX A;  3AXF A;  4KHZ E;  4ZGM A;  3TEL A;  5CBR A;  1M5D A;  2VHA A;  4R6K A;  2PMS A;  3CSG A;  1PEB A;  1JVY A;  3MVW A;  3K1P A;  2XXV A;  1SI0 A;  1MXV A;  2HAV A;  2ZXT A;  2XX9 A;  5H8N A;  4OTE A;  1JEV A;  4HCY A;  3TKD A;  4G4P A;  4LP2 B;  2Y7K A;  5FTH A;  3P7I A;  5FTI A;  3ODB A;  4NF8 B;  4QFN A;  5I58 A;  1XOC A;  3CFZ A;  2PVU A;  3U93 A;  4BDR A;  1MQH A;  2BJJ X;  4LZ5 A;  4AQ4 A;  3QUF A;  1MXY A;  4YKP A;  2CMO A;  3QIM A;  5AA4 B;  2HXW A;  4OET A;  2Z22 A;  3PMV A;  5II0 A;  1AIV A;  5BWJ A;  1MQD A;  3THI A;  2A5T A;  3GZG A;  2ZNU A;  3Q26 A;  4H65 A;  2F34 A;  5I59 A;  4R9G A;  1R6Z A;  4MLQ A;  1VFD A;  1M5C A;  1I6A A;  1MPC A;  1M5E A;  2I4B A;  3FJG A;  1US5 A;  4YMA A;  1US4 A;  1PDA A;  1VSO A;  3H6V A;  2GFE A;  3EPE A;  1MY4 A;  2F78 A;  3FAT A;  3MVX A;  2CZL A;  4LZ8 A;  2XXX A;  1N7X A;  4C1U A;  4OFL A;  3OEL A;  5LOM A;  3IB1 A;  2O84 X;  5F7V A;  4PFU A;  1MXU A;  4IB2 A;  4H67 A;  1S9T A;  4FE8 A;  1Y20 A;  3O66 A;  4KYS A;  5BUU A;  3TFL A;  4EDP A;  1NH8 A;  3SEX A;  2XXW A;  2B3F A;  1N84 A;  2D5W A;  4DXB A;  3S9E A;  1P1Q A;  4WKM A;  3T9X B;  2XX7 A;  1FTK A;  5KCJ A;  3ZKK A;  1I6B A;  1D3K A;  1FQE A;  2ANJ A;  4F29 A;  5AA2 D;  3TCH A;  3DP6 A;  3VXC A;  1A99 A;  2WKY A;  3UK4 A;  2O69 A;  3UN6 A;  4THI A;  2UYE A;  5CMB A;  3T66 A;  1YAE A;  1LBC A;  3HV1 A;  1EZO A;  3A3C A;  2P0S A;  1QUL A;  3VLW A;  1B0H A;  1ZKB A;  4JWO A;  4OEV A;  2RC7 A;  4GVO A;  2DS9 A;  2OCU A;  4ZEB A;  1NNF A;  5HM4 B;  5CBS A;  4HJ0 A;  5FHO A;  2XXY A;  2FNC A;  3G3K A;  2I3V A;  1Y3P A;  1POY 1;  3DP8 A;  4RYA A;  2F5X A;  3OEK A;  4WXJ A;  1GR2 A;  3IOU A;  1PB9 A;  2AL4 A;  1PB8 A;  4JXI A;  4ZEC A;  3CR9 A;  3FVN A;  3UGW A;  4ZEI A;  2ONS A;  2PBW A;  1MQI A;  4BDQ A;  3KN7 A;  3TTR A;  1FCK A;  4ELQ A;  4ZEK A;  1I69 A;  4MF3 A;  3H4Z A;  2OZZ A;  2QS4 A;  1TFD A;  1YCJ A;  1JW4 A;  3RT6 B;  4NE4 A;  5ITP A;  1LB9 A;  1P99 A;  1SBP A;  2GH9 A;  2A5S A;  1LAX A;  1URS A;  3N6T A;  2V93 A;  2Y7R A;  2F7A A;  1UTH A;  4QRZ A;  5IKB A;  1TXF A;  4LQ2 A;  4ESW A;  3T22 A;  1DPP A;  3KG2 A;  2ZYM A;  3MAM A;  3V83 A;  1FQA A;  3I5O A;  3KN3 A;  1IQ7 A;  4O3C A;  1O7T A;  4ERS A;  3K6V A;  4KR5 A;  2ABH A;  5EYF A;  2AYS A;  2Z8D A;  1JW5 A;  3RT8 A;  2ZMB A;  2XXT A;  2H4I A;  2HZK A;  2XX8 A;  4ZZE A;  2Q88 A;  3TDJ A;  4LVQ A;  1IIW A;  4GOT A;  3OO8 A;  2B65 A;  3IJX B;  4DLO A;  1LAH E;  2F7C A;  1II5 A;  2ONK E;  3T9V A;  2HCA A;  3U94 A;  3RUM A;  1SW5 A;  3OEM A;  3K1M A;  5CI5 A;  4YMB A;  4KYD A;  1ZU0 A;  3IO6 A;  3QAX A;  1QVS A;  2XDG A;  4JDF A;  5KZT A;  4H8I A;  4ZDM A;  3S2V A;  3PUV E;  1EH3 A;  3LSL A;  4FEC A;  5L8D A;  4H5G A;  4MLV A;  4G8M A;  3PPP A;  4NF4 B;  1H44 A;  1TWY A;  1DOT A;  1B7U A;  2XD3 A;  3ONM A;  3SEW A;  4NED A;  4DLQ A;  5H8F B;  1SVX B;  4IY5 A;  1DPE A;  3ECR A;  4HS7 A;  4F2Q A;  1TT1 A;  3R6U A;  3BFU A;  3IB0 A;  2V25 A;  2F6P A;  2IEE A;  3Q25 A;  3ILT B;  3C33 A;  3ZSF A;  3FVG A;  2DE4 A;  2Q8J A;  4QFL A;  4NWD A;  2DE3 A;  2E0S A;  5DVJ A;  4P11 A;  1FQD A;  1FW0 A;  4EXL A;  3CRB A;  4R6H A;  3CG1 A;  2HAU A;  2QS1 A;  5CC2 A;  4XKN A;  5I2N B;  1B3L A;  3MJN A;  3USD A;  3CI8 A;  2H25 A;  1RKM A;  2M8C A;  2XHD A;  1ZMG A;  4ONY A;  3KGC A;  5K2X A;  3O6I A;  5H8Q B;  4EXK A;  1LGB C;  4KD5 A;  3VVE A;  1OLC A;  3RN8 A;  2V3U A;  3C9H A;  4ISU A;  3FJM A;  1JW1 A;  3K00 A;  3DEL B;  4WEP A;  3PUZ E;  3MWB A;  3TTK A;  4R72 A;  4OEN A;  4I1D A;  3SES A;  3IAZ A;  1LFI A;  5EHM A;  1Y1M A;  3OO6 A;  2G29 A;  4GIZ A;  5CMK A;  2Q89 A;  2XXQ A;  3L6H A;  1A8F A;  4AB5 A;  1B40 A;  4YAH X;  2YLN A;  4F1Y A;  2RIN A;  1IXC A;  4G77 A;  2F97 A;  4NTL A;  3C32 A;  3PMX A;  3PUX E;  1JEU A;  2QS3 A;  1GGG A;  1HSE A;  1QUI A;  2RKM A;  3TEP A;  2QJE A;  5DVI A;  1POT A;  3KSX A;  4Z7E A;  5J1D A;  4TLM B;  2I58 A;  3PPQ A;  4POX A;  2QKH A;  2UYF A;  4YKJ A;  1A8E A;  1ZBM A;  3KSJ A;  3PUW E;  5H8H B;  1A55 A;  5I56 B;  4LUB A;  4PE5 B;  1FQC A;  4BDO A;  1U34 A;  3VDF A;  5TPA A;  4NF5 B;  4F1U A;  1LAF E;  1BP5 A;  3K2D A;  2XXI A;  2F8D A;  4RJZ A;  5TP9 A;  1FTJ A;  1IXG A;  4EF2 A;  5I57 B;  1MQG A;  3TUS A;  4UA8 A;  4XKQ A;  4KYE A;  4R2B A;  1B05 A;  4NF6 B;  3L6G A;  3FV2 A;  4MH5 A;  1IXI A;  1H45 A;  3G7W A;  2O6A A;  3H7M A;  4OXV A;  1SYH A;  3FZV A;  1AH5 A;  5CMC A;  2DXR A;  3T9H B;  3CVG A;  4GF8 A;  3ZKL A;  1LLS A;  3MQ9 A;  2XXP A;  1SD3 A;  1MH4 A;  3H06 B;  3S9N C;  2DWH A;  3FGS A;  2REJ A;  1LB8 A;  5A5X A;  3E3K A;  2JOD A;  4MBP A;  1PBP A;  3H03 A;  1D4N A;  4GRK A;  1M5F A;  2RCA A;  1FTL A;  1MXX A;  3MVY A;  2DSF A;  3QK6 A;  1UIV A;  2REG A;  4OHN A;  1SI1 A;  4OWD A;  3KBR A;  5JK4 A;  4ZED A;  2O68 A;  1ZIU A;  2X7Q A;  4HCW A;  4QSD A;  2DYX A;  5TU0 A;  3Q29 A;  4F3B A;  4XKR A;  1H43 A;  4RA1 A;  2I48 A;  2P1S A;  1Z7M E;  1SW1 A;  3IX1 A;  4EUO A;  4U1O A;  4ELR A;  2I0B A;  4TOZ A;  1B5J A;  3IB2 A;  3K02 A;  1PBQ A;  2OWS A;  4OVJ A;  3TMG A;  2GHB A;  2IA4 A;  4OZ9 A;  4R9F A;  1MXZ A;  3EF7 A;  4XXU A;  5L9S A;  3LR1 A;  5H8N B;  3PPR A;  3E13 X;  4H8J A;  5FHN A;  3N7S A;  2QL3 A;  1P1O A;  2VD2 A;  2O51 A;  3FXQ A;  3G3H A;  2ZYO A;  2E1S A;  2HZL A;  2I3W A;  4R74 A;  3DM0 A;  2L27 A;  3IL1 B;  1MY3 A;  4RK9 A;  2DOJ A;  5AE4 A;  1CB6 A;  3PGF A;  3LSF B;  1GTK A;  4PFW A;  1B4H A;  3CFX A;  4P0G A;  2UVG A;  3TYH A;  3H6W A;  2Z23 A;  4H5F A;  1WDN A;  3DP4 A;  4QSE A;  5H8S A;  2I0C A;  2HQ0 A;  2Z8E A;  4F31 B;  1MPB A;  1FQF A;  4FOR A;  5AA2 A;  2FYI A;  3U1O A;  3BKI B;  4UAC A;  5AA1 A;  3FD3 A;  1LFG A;  1Q35 A;  2VOZ A;  1MXW A;  3QUJ A;  2AIX A;  1VE4 A;  2RC9 A;  2ZNS A;  4ZE8 A;  4ELO A;  2Y7W A;  1N0T A;  1OMP A;  4LON B;  3KJ7 A;  3HN0 A;  3IOW A;  4N6P A;  2Q9T A;  1R9L A;  1B52 A;  3OMB A;  4GLI A;  5IAI A;  4G68 A;  4JSD A;  3OEN A;  2UVI A;  4FED A;  1P1W A;  2O1L A;  3MP1 A;  3MZ9 A;  1MDP 1;  2NXO A;  2G93 A;  3D4G A;  2O7U A;  3U92 A;  5EHS A;  4YZZ A;  2ONR A;  3MBP A;  3N6U A;  5JTY A;  3GBA A;  4OQO A;  3CSB A;  4DDD A;  3FXU A;  3PD9 A;  2H5Y A;  2UXA A;  3T93 B;  1P1N A;  1QUJ A;  1XC1 A;  4KI0 E;  2QSX A;  4ZS9 A;  3SEV A;  5DT6 A;  4F22 A;  1URD A;  1GV8 A;  1DTZ A;  1DSN A;  2QMX A;  4F3S A;  5CMM A;  3GBB A;  5DTB A;  3OXN A;  1B1X A;  1BKA A;  2AL5 A;  5H8Q A;  2UVH A;  1CE2 A;  1D9V A;  3E9X A;  4ELP A;  1SYI A;  1MQJ A;  2R9J A;  2PYY A;  1NKX A;  1QKB A;  1ZLQ A;  3OO7 A;  4X1D A;  3IOR A;  5KDT A;  3K0V A;  4FAJ A;  3KEI A;  5B70 A;  1Y3N A;  2OBG A;  4C1T A;  5FHM A;  1Q1K A;  1XT8 A;  1WOD A;  4Q5T A;  2PX1 A;  3C31 A;  2ZYN A;  3UA8 A;  4DLD A;  3MUQ A;  4JBZ A;  3VE1 B;  1R1N A;  3LUY A;  5CM6 A;  3M3F A;  1URG A;  1UTB A;  5I2K A;  5AA3 A;  2DE2 A;  3QXM A;  1B7H A;  4TQU Q;  4R6Y A;  1A54 A;  3OOA A;  2R71 A;  3W9W A;  4EQB A;  3K01 A;  1OVT A;  3PPN A;  1IZ1 A;  2OLB A;  5ICT A;  1B3F A;  2DQV A;  1UTH B;  3M8U A;  4M1V A;  1Y4T A;  3HCQ A;  2ESN A;  4FIM A;  3C35 A;  1N3X A;  3SET A;  1QUK A;  3I3V A;  1LFH A;  4F2O A;  4GXS B;  3JYR A;  3B6W A;  2YPN A;  1JET A;  3EN3 A;  3N5L A;  3OSR A;  5I56 A;  2Y7P A;  1Y3Q A;  4ECF A;  1FTO A;  4GD5 A;  1FQB A;  2QS2 A;  5K2Y A;  3G3I A;  1N3W A;  2I49 A;  3HPI A;  3K1N A;  3O29 A;  1RYO A;  4NF8 A;  3TZA A;  1XVX A;  3W9V A;  3U8Q A;  3TTM A;  4KQP A;  1UIU A;  4NF6 A;  4GL8 A;  2GHA A;  3O9P A;  3MPL A;  3HST A;  5AA4 A;  2RF1 A;  3ILU B;  3PD8 A;  4OMB A;  3FAS A;  3IOT A;  4Q8R A;  2ZYK A;  1USY E;  4IO2 A;  4OER A;  1KWH A;  3F11 A;  3MC2 A;  2XD2 A;  1JQF A;  4IO6 A;  1OQG A;  3KZG A;  4ZE9 A;  4PET A;  4RY1 A;  4YB7 A;  3Q28 A;  4DXU A;  3K6U A;  4NMY A;  4YB6 A;  2OK2 A;  3SEY A;  1B9J A;  2F6G A;  5HPQ A;  3RTW B;  3H3G A;  3KJT A;  4IO7 A;  3T96 B;  4IGR A;  1A40 A;  1GVC A;  1LBB A;  4IO4 A;  1B5H A;  4LAT A;  4JWX A;  3V8X B;  1LAG E;  3CFL A;  2GRV A;  1S50 A;  2DXY A;  3MP8 A;  3LSX A;  1AMF A;  4HW8 A;  1ZJL A;  1MRP A;  3HO7 A;  2THI A;  1LCF A;  4LF3 C;  1B2H A;  1IUD A;  4L17 A;  3G3J A;  4BLA A;  3BBR A;  4F3P A;  3VXB A;  2P2A A;  4DCY A;  1Z7N E;  3GLB A;  3VV5 A;  3U72 A;  2QMW A;  2QRY A;  3FVO A;  4RXL A;  4LA9 A;  1T0K A;  2DWI A;  5F1Q A;  1B1H A;  1MDQ A;  1H76 A;  2DP8 A;  3FXR A;  3PMW A;  3FUZ A; 
#chains in the Genus database with same CATH topology
 1FRP A;  4ESX A;  4GWO A;  4TLL B;  2O7I A;  2H9B A;  3G3G A;  1EYI A;  1FJ9 A;  4XTC Q;  2UVJ A;  1FPF A;  3O28 A;  2GQ1 A;  1ZTY A;  4KFQ A;  2HHM A;  4H0W A;  4KCC A;  2QPQ A;  4YKK A;  3GYY A;  1NNK A;  2OX3 A;  3MPK A;  4EQ9 A;  4R73 A;  1OQH A;  1OVB A;  3VLV A;  5DEX B;  3RPW A;  2HEU A;  4JVD A;  3RPL A;  1DTG A;  3H6T A;  4PFI A;  4HE1 A;  4N13 A;  2QVR A;  4AB6 A;  2ALU A;  2DDK A;  4K3F A;  4P56 A;  1B58 A;  4FJP A;  4ND9 A;  3SKP A;  4E0W A;  3HHF A;  3I6V A;  1MS7 A;  1MH3 A;  3CG3 A;  1NV7 A;  2ZNT A;  5L9O A;  1BTJ A;  3N94 A;  3MW0 A;  4F39 A;  3KFM A;  2NVU B;  3ROJ A;  1EYK A;  5ICQ A;  1B3E A;  1I6Q A;  4F19 A;  1QJM A;  3SZP A;  4C0R A;  4OVP A;  4GL0 A;  4HTG A;  1HSJ A;  4F3G A;  3MZ1 A;  3A3U A;  4DE8 A;  5CRY A;  1UQW A;  1J1N A;  1S7Y A;  1N7W A;  4DXC A;  4POW A;  5TPA B;  4XEQ A;  1MY0 A;  3KOS A;  1SPI A;  3N7P A;  4PP0 A;  3GXA A;  4WED A;  3PPO A;  3FIR A;  5TP9 B;  4KPT A;  3TOD A;  2VP1 A;  3T9U A;  3B6T A;  5I58 B;  1VFE A;  4JSO A;  3O6H A;  4PQJ A;  4Z0I A;  3V5A A;  2DVC A;  1OLA A;  3M3K A;  1MY2 A;  4JWY A;  2NOO A;  1AOV A;  4OYV A;  1FBP A;  2I6E A;  5ELV A;  3PUY E;  2I4C A;  3C36 A;  3SDF A;  3ZS6 A;  2RC8 A;  4PFR A;  5ET5 A;  1R9Q A;  5EQ8 A;  1NMU A;  2XXU A;  4GFR A;  2OWT A;  3AQF B;  1RYX A;  2A5T B;  1DCU A;  5A5X B;  2F36 A;  5I59 B;  2FVZ A;  4NWC A;  1ANF A;  4PGP A;  3IO4 A;  5JEI A;  4ZEF A;  3TAJ A;  4MNP A;  4U23 A;  3PU5 A;  3RTF B;  1A7L A;  1VR5 A;  4QFP A;  4G8H A;  2VGQ A;  3CIJ A;  4BDN A;  3EHU A;  3R7X A;  4EQ7 A;  1XS5 A;  2NWJ A;  4XKP A;  4DIG A;  1BLF A;  3LSW A;  1SW4 A;  4F18 A;  1OIB A;  4PBQ A;  3RLF E;  2L5V A;  3H6U A;  1RDX A;  4QFO A;  1P1U A;  4F1V A;  4PC9 A;  1O64 A;  2X26 A;  1DMB A;  2FBP A;  3E4R A;  4YU0 A;  2V4C A;  3VLU A;  2PT1 A;  4DCX A;  4QF9 A;  2VD3 A;  2X7P A;  1KZ8 A;  2B4L A;  5EQ7 A;  3C34 A;  4NF4 A;  4N6K A;  3L2J A;  3IR1 A;  3C59 A;  1FPD A;  1EU8 A;  3TCF A;  3TQL A;  4H45 A;  2XXH A;  4IO3 A;  5H8F A;  1B4Z A;  1HSL A;  4EF1 A;  3JV9 A;  2DWJ A;  4Q30 B;  4N91 A;  1N04 A;  4NHB A;  1LST A;  1IXH A;  1IMA A;  5ITO A;  4R2F A;  1MG1 A;  2HFB A;  4E0X A;  1YPN A;  4H1X A;  5HBC A;  3O97 A;  5I3S A;  4MX6 A;  4U22 A;  3RNN A;  5KCJ B;  2Y7I A;  4G68 C;  4X9T A;  2WBD A;  3RGY A;  1YTV A;  1LBW A;  3PV0 E;  1D9Y A;  5IZ3 B;  3UOR A;  4O3B A;  4GQO A;  3NOH A;  3IOV A;  5I2N A;  4OFJ A;  4YKI A;  3TQW A;  1IIT A;  2D21 A;  4MFI A;  2OJT A;  3K6X A;  4I3E A;  3HHG A;  2ZZW A;  4PAI A;  3O2A A;  2PCR A;  1NFT A;  3K6W A;  4OEU A;  1FTM A;  2QVV A;  4X04 A;  4MCO A;  1XVY A;  3EHT A;  4P1L A;  4FAT A;  2F7B A;  3SEU A;  2RCB A;  1B0L A;  4O3A A;  4DZ1 A;  1PC3 A;  2XWV A;  2YJP A;  4YIC A;  1NL5 A;  1NNP A;  4LZ7 A;  4N81 A;  4QFK A;  1AL3 A;  1Y1Z A;  1LBV A;  1FBG A;  2F35 A;  4G8N A;  4PAF A;  3T1B A;  4OFO A;  3FVK A;  4QHQ A;  3TPA A;  5AA2 B;  4ZZA A;  1BIY A;  1N76 A;  3S9L C;  2WX9 A;  5I84 A;  3VFJ A;  4U4X A;  4I8C A;  3WAE A;  3B6Q A;  4FEB A;  3D4C A;  1ELJ A;  4U21 A;  1SW2 A;  1FBD A;  4GWZ A;  1B7Z A;  1LBZ A;  1B3H A;  1NUZ A;  4N07 A;  1QW0 A;  3BFT A;  3MVZ A;  1H3D A;  4Q0C A;  3WAF A;  3DLN A;  1QKA A;  4X1B A;  2QVU A;  2DVZ A;  2XXR A;  2FA7 A;  1MM7 A;  4G68 B;  3V89 B;  3IK6 B;  2QFL A;  5LDZ A;  4MEV A;  1JNF A;  4HE2 A;  3C5T A;  1IEJ A;  1XHY A;  2P3V A;  1B6H A;  1B32 A;  3LBS A;  3RQT A;  4GXA A;  3LC8 A;  3N26 A;  4BDM A;  3C4M A;  2H98 A;  1TFA A;  5JTY B;  5M2V A;  1Y9U A;  1EZ9 A;  2H99 A;  4RNS A;  4I62 A;  5ISU A;  4RPN A;  2V3Q A;  1B46 A;  3QSL A;  5H8H A;  2Y84 A;  1FBE A;  3A09 A;  4YB5 A;  2R6G E;  4I9D A;  4NF5 A;  3RY3 A;  4U1Z A;  3MP6 A;  1SQY A;  4U4S A;  5EYH A;  3M3L A;  2KLF A;  3SER A;  3Q27 A;  5I57 A;  1B51 A;  3R26 A;  4IY6 A;  2JND A;  1EZP A;  4IO5 A;  2DWA A;  3IOL A;  4GX6 A;  3N7R A;  4LQ5 A;  4JB7 A;  2Z8F A;  3FJ7 A;  4XFE A;  2VPO A;  4H46 A;  2O1M A;  3TTN A;  2XWK A;  3B7D A;  2VT5 A;  1USY H;  3K4U A;  4XIG Q;  4G2Z A;  3E79 A;  2NUV A;  3MST A;  2B3B A;  3TTL A;  1NV0 A;  4PFT A;  4RPO A;  3RYD A;  2WYP A;  2Q2A A;  1IME A;  2LAO A;  5B7D A;  1O63 A;  2XA5 A;  5KDT B;  1M5B A;  3FV1 A;  4IR8 A;  3VVD A;  2WYK A;  1MPD A;  5DYH A;  3JZJ A;  1NH7 A;  1LCT A;  3O6G A;  4IGT A;  3KC0 A;  4R75 A;  4H6D A;  3S4U A;  1FSA A;  2Q2C A;  2V84 A;  4X48 A;  3VVF A;  1XI6 A;  3G3F A;  2D3I A;  5DEX A;  1UTB B;  5I2K B;  4QSC A;  4P47 A;  1MY1 A;  3EQ1 A;  1NUW A;  2ZZV A;  3S9M C;  1PB7 A;  4PTK A;  3OO9 A;  2W7Y A;  3W15 C;  4M4G A;  1F9B A;  2PT2 A;  4PFY A;  3EHS A;  3TCG A;  4P0I A;  2V3T A;  5DVF A;  1MM6 A;  3KN8 A;  4MNC A;  3UIF A;  4BDL A;  1NNT A;  1SDX A;  2B4M A;  3OD7 A;  3KOT A;  4RK2 A;  4OES A;  1B5I A;  3IJO B;  3MZB A;  4KCD A;  3QYT A;  1Y4C A;  3OSQ A;  5L9M A;  1L5T A;  3UP9 A;  1ATG A;  1B3G A;  4U2R A;  2JNC A;  1WVJ A;  2CEX A;  1JVX A;  3AXF A;  4KHZ E;  4ZGM A;  3TEL A;  5CBR A;  4MIJ A;  1M5D A;  2VHA A;  4R6K A;  2PMS A;  3CSG A;  1PEB A;  1JVY A;  3MVW A;  3K1P A;  2XXV A;  1FBF A;  1SI0 A;  1MXV A;  2HAV A;  2ZXT A;  2XX9 A;  5H8N A;  4OTE A;  1JEV A;  4HCY A;  3TKD A;  4G4P A;  4LP2 B;  2Y7K A;  5FTH A;  3P7I A;  5FTI A;  3ODB A;  4NF8 B;  4QFN A;  5I58 A;  1XOC A;  3CFZ A;  2PVU A;  3U93 A;  4BDR A;  4NG7 A;  1MQH A;  2BJJ X;  4LZ5 A;  4AQ4 A;  3QUF A;  1MXY A;  4YKP A;  2CMO A;  4GWX A;  3QIM A;  5AA4 B;  2HXW A;  4OET A;  2Z22 A;  3PMV A;  5II0 A;  4PDH A;  1AIV A;  5BWJ A;  1MQD A;  3THI A;  4OVT A;  2A5T A;  3GZG A;  2ZNU A;  3Q26 A;  4H65 A;  2F34 A;  5I59 A;  4R9G A;  1R6Z A;  4MLQ A;  5ESY A;  1VFD A;  1M5C A;  1I6A A;  1MPC A;  1M5E A;  2I4B A;  4OVR A;  3FJG A;  1US5 A;  4YMA A;  1US4 A;  1PDA A;  1VSO A;  3H6V A;  2GFE A;  3BIG A;  3E78 A;  3EPE A;  4PDD A;  1MY4 A;  2F78 A;  4HXV A;  3FAT A;  3MVX A;  3LUZ A;  2CZL A;  4LZ8 A;  2XXX A;  2OWZ A;  4PFB A;  1NI9 A;  1N7X A;  4C1U A;  4P1E A;  4OFL A;  3OEL A;  5LOM A;  3IB1 A;  2O84 X;  5F7V A;  4PFU A;  1MXU A;  4IB2 A;  4H67 A;  1S9T A;  4FE8 A;  1Y20 A;  3O66 A;  4KYS A;  5BUU A;  3TFL A;  4EDP A;  1NH8 A;  2BJI A;  4O7M A;  3SEX A;  2XXW A;  2B3F A;  3IFC A;  1N84 A;  2D5W A;  4DXB A;  3S9E A;  1P1Q A;  1RDY A;  4WKM A;  3T9X B;  2XX7 A;  1FTK A;  5KCJ A;  3ZKK A;  1I6B A;  1D3K A;  1FQE A;  3QMF A;  2ANJ A;  4NQ8 A;  4F29 A;  5AA2 D;  3TCH A;  3DP6 A;  3VXC A;  1A99 A;  2WKY A;  3UK4 A;  2O69 A;  3CHG A;  3UN6 A;  4THI A;  2UYE A;  2HXR A;  5CMB A;  3T66 A;  1YAE A;  1LBC A;  3HV1 A;  1EZO A;  3A3C A;  2P0S A;  4G61 A;  1QUL A;  3VLW A;  1B0H A;  1ZKB A;  4JWO A;  4OEV A;  2RC7 A;  4GWY A;  4GVO A;  2DS9 A;  2OCU A;  4ZEB A;  1NNF A;  5HM4 B;  5CBS A;  4HJ0 A;  2Q8M A;  4QBA A;  5FHO A;  1IMC A;  2XXY A;  2FNC A;  3G3K A;  2JJK A;  1QGX A;  2I3V A;  1Y3P A;  3RPL B;  1POY 1;  3DP8 A;  4OA4 A;  4RYA A;  2F5X A;  3OEK A;  3IOU A;  1GR2 A;  4WXJ A;  1PB9 A;  2AL4 A;  1PB8 A;  4JXI A;  4ZEC A;  3CR9 A;  3FVN A;  3UGW A;  2CZK A;  4ZEI A;  2ONS A;  2PBW A;  1MQI A;  4BDQ A;  3KN7 A;  3TTR A;  1FCK A;  4PCD A;  4ELQ A;  4ZEK A;  1D9Q A;  4X8R A;  4N15 A;  1I69 A;  4MF3 A;  3H4Z A;  2OZZ A;  2QS4 A;  1TFD A;  1YCJ A;  1JW4 A;  3RT6 B;  4NE4 A;  4PGN A;  5ITP A;  1LB9 A;  1P99 A;  3EKI A;  1SBP A;  1JP4 A;  2GH9 A;  2A5S A;  1LAX A;  1URS A;  3N6T A;  2V93 A;  2Y7R A;  2F7A A;  1K9Y A;  1UTH A;  4QRZ A;  1BK4 A;  5IKB A;  1TXF A;  2XXK A;  4LQ2 A;  4ESW A;  4MMP A;  3T22 A;  1DPP A;  4GWW A;  3KG2 A;  2ZYM A;  3MAM A;  1FBC A;  3V83 A;  1FQA A;  3I5O A;  3KN3 A;  4N8G A;  1IQ7 A;  2FIX A;  4O3C A;  1O7T A;  4ERS A;  3K6V A;  4KR5 A;  2ABH A;  5EYF A;  2AYS A;  1NV4 A;  5EQ9 A;  2Z8D A;  1NV2 A;  1JW5 A;  5FBP A;  3RT8 A;  5ET7 A;  5ET8 A;  5EYG A;  2ZMB A;  2XXT A;  2H4I A;  2HZK A;  2XX8 A;  4ZZE A;  2Q88 A;  3TDJ A;  4LVQ A;  1IIW A;  2F3B A;  4GOT A;  3OO8 A;  2B65 A;  3IJX B;  4DLO A;  1LAH E;  2F7C A;  1II5 A;  1FBH A;  2ONK E;  3T9V A;  2HCA A;  4JVC A;  3D1R A;  3U94 A;  3RUM A;  1SW5 A;  3OEM A;  3K1M A;  1FJ6 A;  5CI5 A;  3KBZ A;  4JVI A;  4YMB A;  4KYD A;  2WBB A;  1ZU0 A;  3IO6 A;  3QAX A;  1QVS A;  1NV5 A;  2XDG A;  4JDF A;  5KZT A;  4H8I A;  4ZDM A;  3S2V A;  3PUV E;  3PTY A;  1EH3 A;  3LSL A;  4FEC A;  5L8D A;  4H5G A;  1DK4 A;  4MLV A;  4G8M A;  3PPP A;  4NF4 B;  1H44 A;  1TWY A;  1DOT A;  1B7U A;  2XD3 A;  3ONM A;  3SEW A;  4NED A;  4DLQ A;  5H8F B;  1SVX B;  4IY5 A;  4XF5 A;  1NUY A;  5DW8 A;  1DPE A;  3ECR A;  4HS7 A;  4F2Q A;  1K9Z A;  1TT1 A;  3R6U A;  3BFU A;  3IB0 A;  2V25 A;  2F6P A;  2IEE A;  3Q25 A;  4MJO A;  3ILT B;  3C33 A;  3ZSF A;  3FVG A;  2DE4 A;  2Q8J A;  4QFL A;  4NWD A;  2DE3 A;  2E0S A;  5ET6 A;  2P3N A;  5DVJ A;  4P11 A;  1FQD A;  1FW0 A;  4EXL A;  3CRB A;  4R6H A;  3CG1 A;  2HAU A;  2QS1 A;  4NAP A;  4XKN A;  5CC2 A;  1B3L A;  5I2N B;  3MJN A;  3USD A;  3CI8 A;  3BIH A;  3T0J A;  2H25 A;  1RKM A;  2M8C A;  2XHD A;  1ZMG A;  4ONY A;  2MKZ A;  3KGC A;  5K2X A;  3O6I A;  5H8Q B;  4EXK A;  1LGB C;  4KD5 A;  3VVE A;  1LEV A;  1OLC A;  3RN8 A;  2V3U A;  2R8T A;  2HPG A;  3C9H A;  1IMF A;  4ISU A;  3FJM A;  1JW1 A;  3K00 A;  3DEL B;  4WEP A;  3PUZ E;  1YYZ A;  3MWB A;  3TTK A;  4MHF A;  4R72 A;  4OEN A;  3ISP A;  4I1D A;  3SES A;  3IAZ A;  1NV1 A;  1LFI A;  4N8Y A;  5EHM A;  1Y1M A;  4OAN A;  3OO6 A;  2G29 A;  4GIZ A;  5CMK A;  2Q89 A;  2XXQ A;  3L6H A;  1A8F A;  4AB5 A;  1B40 A;  4YAH X;  2YLN A;  4F1Y A;  2RIN A;  4O8M A;  1IXC A;  4G77 A;  2F97 A;  4NTL A;  3C32 A;  3PMX A;  3PUX E;  1JEU A;  2QS3 A;  1GGG A;  4KXP A;  1HSE A;  1QUI A;  2RKM A;  3TEP A;  2QJE A;  5DVI A;  1POT A;  3KSX A;  4Z7E A;  2VPN A;  2FIE A;  5J1D A;  4TLM B;  2I58 A;  3PPQ A;  5LTC A;  4POX A;  3MYU A;  2QKH A;  5I5P A;  2UYF A;  4YKJ A;  1FPG A;  1A8E A;  4O7I A;  1ZBM A;  1RDZ A;  3KSJ A;  4GX3 A;  3PUW E;  5H8H B;  1A55 A;  5I56 B;  4LUB A;  4PE5 B;  1FQC A;  4BDO A;  1U34 A;  3VDF A;  5TPA A;  4NF5 B;  4F1U A;  1LAF E;  1BP5 A;  3K2D A;  2XXI A;  4N4U A;  2F8D A;  4RJZ A;  5TP9 A;  1FTJ A;  1IXG A;  4EF2 A;  5I57 B;  1MQG A;  3TUS A;  2KR0 A;  4UA8 A;  4XKQ A;  4KYE A;  4R2B A;  1B05 A;  4NF6 B;  1VDW A;  3FV2 A;  3L6G A;  4MH5 A;  1IXI A;  1H45 A;  5A5L A;  3G7W A;  2O6A A;  3H7M A;  1YZ0 A;  4OXV A;  1SYH A;  3FZV A;  1AH5 A;  2FHY A;  5CMC A;  3B50 A;  2DXR A;  4N17 A;  3T9H B;  3CVG A;  4GF8 A;  3ZKL A;  1LLS A;  3MQ9 A;  2XXP A;  1SD3 A;  1MH4 A;  3H06 B;  3S9N C;  2DWH A;  3FGS A;  2REJ A;  1LB8 A;  5A5X A;  1NUX A;  3E3K A;  2JOD A;  4MBP A;  1PBP A;  3H03 A;  1D4N A;  4GRK A;  1M5F A;  4OVQ A;  2RCA A;  1FTL A;  1MXX A;  3MVY A;  2DSF A;  3QK6 A;  1UIV A;  2REG A;  4OHN A;  1SI1 A;  4OWD A;  3KBR A;  5JK4 A;  4ZED A;  2O68 A;  1ZIU A;  2X7Q A;  4HCW A;  4QSD A;  4NN3 A;  2DYX A;  5TU0 A;  3Q29 A;  4F3B A;  4PBH A;  4XKR A;  4PF8 A;  1H43 A;  4RA1 A;  2I48 A;  2P1S A;  4GBW A;  1Z7M E;  1SW1 A;  2XWO A;  3IX1 A;  4EUO A;  4U1O A;  4ELR A;  2I0B A;  2Q74 A;  4TOZ A;  1B5J A;  3IB2 A;  3K02 A;  1PBQ A;  2OWS A;  4OVJ A;  3TMG A;  2GHB A;  2IA4 A;  4OZ9 A;  4R9F A;  4P8B A;  4GWS A;  1MXZ A;  1NV6 A;  3EF7 A;  4XXU A;  5L9S A;  3LR1 A;  5H8N B;  3A29 A;  3PPR A;  5IZ3 A;  3E13 X;  4H8J A;  5FHN A;  3N7S A;  2QL3 A;  1P1O A;  2VD2 A;  2O51 A;  3FXQ A;  3G3H A;  2ZYO A;  2E1S A;  2HZL A;  5IGA A;  2I3W A;  4R74 A;  3DM0 A;  2L27 A;  3IL1 B;  1MY3 A;  4RK9 A;  2DOJ A;  5AE4 A;  1CB6 A;  3PGF A;  3LSF B;  1GTK A;  4PFW A;  1B4H A;  3CFX A;  4P0G A;  4NGU A;  2UVG A;  3TYH A;  4DI4 B;  5J16 A;  4MNI A;  3H6W A;  2Z23 A;  4H5F A;  1WDN A;  3DP4 A;  4QSE A;  5H8S A;  2I0C A;  2HQ0 A;  2Z8E A;  4F31 B;  1MPB A;  1FQF A;  4FOR A;  5AA2 A;  2FYI A;  2Y5K A;  3U1O A;  4MAG A;  3BKI B;  4UAC A;  5AA1 A;  3FD3 A;  1LFG A;  1Q35 A;  2VOZ A;  1MXW A;  3QUJ A;  4P3L A;  2AIX A;  1VE4 A;  1LBY A;  2RC9 A;  2ZNS A;  3LV0 A;  1FPE A;  4ZE8 A;  4ELO A;  2Y7W A;  1N0T A;  1OMP A;  4LON B;  3KJ7 A;  3B8B A;  1G0I A;  3HN0 A;  1LBX A;  3IOW A;  4N6P A;  2Q9T A;  1R9L A;  1B52 A;  3OMB A;  4GLI A;  5IAI A;  4G68 A;  4FBP A;  4P9K A;  2WEF A;  4JSD A;  3OEN A;  2UVI A;  4FED A;  1P1W A;  2O1L A;  3MP1 A;  3MZ9 A;  4DI3 D;  1MDP 1;  2NXO A;  2G93 A;  3D4G A;  2O7U A;  5IZZ A;  3U92 A;  5EHS A;  3IFA A;  4YZZ A;  1INP A;  1DBZ A;  4PE3 A;  2ONR A;  3MBP A;  5T3J A;  3N6U A;  4UAB A;  5JTY A;  3GBA A;  4QXD A;  4OQO A;  1FTA A;  3CSB A;  4DDD A;  3FXU A;  3PD9 A;  2H5Y A;  2UXA A;  4AS4 A;  1KA1 A;  3T93 B;  1P1N A;  1QUJ A;  1XC1 A;  4KI0 E;  2QSX A;  4ZS9 A;  3SEV A;  5DT6 A;  4F22 A;  1URD A;  1GV8 A;  1DTZ A;  1KA0 A;  1DSN A;  2QMX A;  5I7I A;  4F3S A;  5CMM A;  3GBB A;  2Y5L A;  5DTB A;  3OXN A;  1B1X A;  1BKA A;  2AL5 A;  5H8Q A;  1IMD A;  2UVH A;  1CE2 A;  1D9V A;  3E9X A;  4ELP A;  1SYI A;  1MQJ A;  2R9J A;  2PYY A;  1NKX A;  1FPL A;  1QKB A;  1ZLQ A;  3OO7 A;  4X1D A;  3IOR A;  5KDT A;  3K0V A;  4FAJ A;  3KEI A;  5B70 A;  1Y3N A;  2OBG A;  4C1T A;  5FHM A;  1Q1K A;  1XT8 A;  1WOD A;  1EYJ A;  4Q5T A;  2PX1 A;  3C31 A;  2ZYN A;  3UA8 A;  4DLD A;  3MUQ A;  1G0H A;  4JBZ A;  3VE1 B;  4HE0 A;  1R1N A;  3KC1 A;  3LUY A;  5CM6 A;  3M3F A;  1IMB A;  1URG A;  1UTB A;  5I2K A;  5AA3 A;  2DE2 A;  3QXM A;  1B7H A;  4NF0 A;  4PAK A;  4TQU Q;  4R6Y A;  1A54 A;  1FPI A;  3OOA A;  2R71 A;  3W9W A;  4EQB A;  3K01 A;  1OVT A;  3PPN A;  1IZ1 A;  2OLB A;  5ICT A;  1B3F A;  2DQV A;  1UTH B;  3M8U A;  4M1V A;  1Y4T A;  3HCQ A;  4AS5 A;  2ESN A;  4FIM A;  3C35 A;  4OVS A;  1N3X A;  3SET A;  3HFU A;  1QUK A;  5IM2 A;  3I3V A;  1LFH A;  2PFY A;  1CNQ A;  4F2O A;  4GXS B;  3JYR A;  3B6W A;  2YPN A;  1JET A;  3EN3 A;  3N5L A;  1YXI A;  3OSR A;  5I56 A;  4N6D A;  2Y7P A;  1Y3Q A;  4ECF A;  4NX1 A;  1FTO A;  4GD5 A;  1FQB A;  2QS2 A;  5K2Y A;  3G3I A;  1N3W A;  2I49 A;  3HPI A;  3K1N A;  3O29 A;  1RYO A;  4NF8 A;  3TZA A;  1XVX A;  3W9V A;  3U8Q A;  2ZZX A;  5F24 A;  3TTM A;  4KQP A;  1UIU A;  4NF6 A;  1Q9D A;  4GL8 A;  3FXB A;  2GHA A;  3O9P A;  3MPL A;  3HST A;  5AA4 A;  2RF1 A;  3ILU B;  4PF6 A;  3PD8 A;  4I40 A;  4OMB A;  3FAS A;  2F3D A;  3IOT A;  4Q8R A;  2ZYK A;  1USY E;  4IO2 A;  4OER A;  1KWH A;  3F11 A;  1FPK A;  2XD2 A;  1JQF A;  3MC2 A;  4IO6 A;  4O94 A;  1OQG A;  2PFZ A;  3KZG A;  1AWB A;  4ZE9 A;  4PET A;  4RY1 A;  4YB7 A;  3Q28 A;  4DXU A;  3K6U A;  4NMY A;  4YB6 A;  2OK2 A;  3SEY A;  4I3Y A;  1B9J A;  2F6G A;  5HPQ A;  3RTW B;  3H3G A;  3KJT A;  4IO7 A;  3T96 B;  2XWI A;  4IGR A;  1A40 A;  1GVC A;  1FPJ A;  1LBB A;  4IO4 A;  1B5H A;  2CZI A;  4LAT A;  2KQZ A;  4JWX A;  3V8X B;  2CZH A;  1LAG E;  3CFL A;  2GRV A;  1S50 A;  2DXY A;  4GWU A;  3MP8 A;  1FPB A;  4GX4 A;  3LSX A;  1AMF A;  4HW8 A;  1ZJL A;  1MRP A;  3HO7 A;  2THI A;  1LCF A;  4LF3 C;  1B2H A;  1IUD A;  4L17 A;  3G3J A;  4BLA A;  3BBR A;  4F3P A;  5EQA A;  3VXB A;  2P2A A;  4DCY A;  1Z7N E;  3GLB A;  3VV5 A;  3U72 A;  5IZ1 A;  2QMW A;  2QRY A;  3FVO A;  2CEY A;  4RXL A;  1NV3 A;  4LA9 A;  3FBP A;  4GBV A;  2DWI A;  1T0K A;  5F1Q A;  1B1H A;  1MDQ A;  1H76 A;  2DP8 A;  3FXR A;  3PMW A;  4LN5 A;  3U65 A;  3FUZ A; 
#chains in the Genus database with same CATH homology
 4ESX A;  4GWO A;  4TLL B;  2O7I A;  2H9B A;  3G3G A;  4XTC Q;  2UVJ A;  3O28 A;  1ZTY A;  4KFQ A;  4H0W A;  4KCC A;  2QPQ A;  4YKK A;  1NNK A;  3MPK A;  4EQ9 A;  4R73 A;  1OQH A;  1OVB A;  3VLV A;  5DEX B;  3RPW A;  2HEU A;  1DTG A;  3H6T A;  4N13 A;  4AB6 A;  2ALU A;  4K3F A;  1B58 A;  4FJP A;  4ND9 A;  3SKP A;  4E0W A;  3HHF A;  3I6V A;  1MS7 A;  1MH3 A;  3CG3 A;  2ZNT A;  5L9O A;  1BTJ A;  3N94 A;  3MW0 A;  4F39 A;  3KFM A;  2NVU B;  5ICQ A;  1B3E A;  1I6Q A;  4F19 A;  1QJM A;  4C0R A;  4GL0 A;  4HTG A;  1HSJ A;  4F3G A;  3MZ1 A;  3A3U A;  4DE8 A;  5CRY A;  1UQW A;  1J1N A;  1S7Y A;  1N7W A;  4DXC A;  4POW A;  5TPA B;  1MY0 A;  3KOS A;  3N7P A;  4PP0 A;  3GXA A;  4WED A;  3PPO A;  3FIR A;  5TP9 B;  4KPT A;  3TOD A;  2VP1 A;  3T9U A;  3B6T A;  5I58 B;  1VFE A;  4JSO A;  3O6H A;  4PQJ A;  4Z0I A;  3V5A A;  2DVC A;  1OLA A;  3M3K A;  1MY2 A;  4JWY A;  2NOO A;  1AOV A;  4OYV A;  2I6E A;  5ELV A;  3PUY E;  2I4C A;  3C36 A;  3SDF A;  3ZS6 A;  2RC8 A;  1R9Q A;  1NMU A;  2XXU A;  4GFR A;  2OWT A;  3AQF B;  1RYX A;  2A5T B;  5A5X B;  2F36 A;  5I59 B;  4NWC A;  1ANF A;  3IO4 A;  5JEI A;  4ZEF A;  3TAJ A;  4U23 A;  3PU5 A;  3RTF B;  1A7L A;  1VR5 A;  4QFP A;  4G8H A;  2VGQ A;  3CIJ A;  4BDN A;  3EHU A;  3R7X A;  4EQ7 A;  1XS5 A;  2NWJ A;  4XKP A;  4DIG A;  1BLF A;  3LSW A;  1SW4 A;  4F18 A;  1OIB A;  3RLF E;  3H6U A;  4F1V A;  4QFO A;  1P1U A;  1O64 A;  2X26 A;  1DMB A;  3E4R A;  4YU0 A;  3VLU A;  2PT1 A;  4DCX A;  4QF9 A;  2VD3 A;  2X7P A;  3C34 A;  4NF4 A;  3L2J A;  3IR1 A;  3C59 A;  1EU8 A;  3TCF A;  3TQL A;  4IO3 A;  2XXH A;  5H8F A;  1B4Z A;  1HSL A;  4EF1 A;  3JV9 A;  2DWJ A;  4Q30 B;  1N04 A;  1LST A;  1IXH A;  5ITO A;  4R2F A;  1MG1 A;  4E0X A;  2HFB A;  1YPN A;  4H1X A;  5HBC A;  3O97 A;  4U22 A;  3RNN A;  5KCJ B;  2Y7I A;  4G68 C;  4X9T A;  3RGY A;  1YTV A;  3PV0 E;  1D9Y A;  3UOR A;  4O3B A;  4GQO A;  3IOV A;  5I2N A;  4OFJ A;  4YKI A;  3TQW A;  1IIT A;  2D21 A;  4MFI A;  2OJT A;  3K6X A;  3HHG A;  3O2A A;  1NFT A;  3K6W A;  4OEU A;  1FTM A;  1XVY A;  3EHT A;  4FAT A;  2F7B A;  3SEU A;  2RCB A;  1B0L A;  4DZ1 A;  4O3A A;  1PC3 A;  2YJP A;  4YIC A;  1NL5 A;  1NNP A;  4LZ7 A;  4QFK A;  1AL3 A;  1Y1Z A;  2F35 A;  4G8N A;  4OFO A;  3FVK A;  4QHQ A;  3TPA A;  5AA2 B;  4ZZA A;  1BIY A;  1N76 A;  3S9L C;  5I84 A;  3VFJ A;  4U4X A;  4I8C A;  3WAE A;  3B6Q A;  4FEB A;  3D4C A;  1ELJ A;  4U21 A;  1SW2 A;  1B7Z A;  1B3H A;  4N07 A;  1QW0 A;  3BFT A;  3MVZ A;  1H3D A;  4Q0C A;  3WAF A;  3DLN A;  1QKA A;  4X1B A;  2DVZ A;  2XXR A;  2FA7 A;  1MM7 A;  4G68 B;  3V89 B;  3IK6 B;  1JNF A;  3C5T A;  1IEJ A;  1XHY A;  1B6H A;  1B32 A;  3LBS A;  3RQT A;  4GXA A;  3LC8 A;  3N26 A;  4BDM A;  3C4M A;  2H98 A;  1TFA A;  5JTY B;  5M2V A;  1Y9U A;  1EZ9 A;  2H99 A;  4RNS A;  4I62 A;  5ISU A;  4RPN A;  2V3Q A;  1B46 A;  3QSL A;  5H8H A;  2Y84 A;  3A09 A;  4YB5 A;  2R6G E;  4I9D A;  4NF5 A;  3RY3 A;  4U1Z A;  3MP6 A;  1SQY A;  4U4S A;  3M3L A;  2KLF A;  3SER A;  3Q27 A;  5I57 A;  1B51 A;  3R26 A;  4IY6 A;  2JND A;  1EZP A;  4IO5 A;  2DWA A;  3IOL A;  3N7R A;  4LQ5 A;  4JB7 A;  2Z8F A;  3FJ7 A;  2O1M A;  3TTN A;  3B7D A;  1USY H;  3K4U A;  4XIG Q;  4G2Z A;  2NUV A;  2B3B A;  3TTL A;  4PFT A;  4RPO A;  2Q2A A;  2LAO A;  5B7D A;  1O63 A;  5KDT B;  1M5B A;  3FV1 A;  3VVD A;  1MPD A;  5DYH A;  3JZJ A;  1NH7 A;  1LCT A;  3O6G A;  4IGT A;  4R75 A;  4H6D A;  3S4U A;  2Q2C A;  2V84 A;  4X48 A;  3VVF A;  3G3F A;  2D3I A;  5DEX A;  1UTB B;  5I2K B;  4QSC A;  3S9M C;  1MY1 A;  3EQ1 A;  1PB7 A;  3OO9 A;  2W7Y A;  3W15 C;  4M4G A;  1F9B A;  2PT2 A;  4PFY A;  3EHS A;  3TCG A;  4P0I A;  2V3T A;  5DVF A;  1MM6 A;  3KN8 A;  3UIF A;  4BDL A;  1NNT A;  1SDX A;  3OD7 A;  3KOT A;  4RK2 A;  4OES A;  1B5I A;  3IJO B;  3MZB A;  4KCD A;  3QYT A;  1Y4C A;  3OSQ A;  5L9M A;  1L5T A;  3UP9 A;  1ATG A;  1B3G A;  4U2R A;  2JNC A;  1WVJ A;  1JVX A;  3AXF A;  4KHZ E;  4ZGM A;  3TEL A;  5CBR A;  1M5D A;  2VHA A;  4R6K A;  2PMS A;  3CSG A;  1PEB A;  1JVY A;  3MVW A;  3K1P A;  2XXV A;  1SI0 A;  1MXV A;  2HAV A;  2ZXT A;  2XX9 A;  5H8N A;  4OTE A;  1JEV A;  4HCY A;  3TKD A;  4G4P A;  4LP2 B;  2Y7K A;  5FTH A;  3P7I A;  5FTI A;  3ODB A;  4NF8 B;  4QFN A;  5I58 A;  1XOC A;  3CFZ A;  2PVU A;  3U93 A;  4BDR A;  1MQH A;  2BJJ X;  4LZ5 A;  4AQ4 A;  3QUF A;  1MXY A;  4YKP A;  2CMO A;  3QIM A;  5AA4 B;  2HXW A;  4OET A;  2Z22 A;  3PMV A;  5II0 A;  1AIV A;  5BWJ A;  1MQD A;  3THI A;  2A5T A;  3GZG A;  2ZNU A;  3Q26 A;  4H65 A;  2F34 A;  5I59 A;  4R9G A;  1R6Z A;  4MLQ A;  1VFD A;  1M5C A;  1I6A A;  1MPC A;  1M5E A;  2I4B A;  3FJG A;  1US5 A;  4YMA A;  1US4 A;  1PDA A;  1VSO A;  3H6V A;  2GFE A;  3EPE A;  1MY4 A;  2F78 A;  3FAT A;  3MVX A;  2CZL A;  4LZ8 A;  2XXX A;  1N7X A;  4C1U A;  4OFL A;  3OEL A;  5LOM A;  3IB1 A;  2O84 X;  5F7V A;  4PFU A;  1MXU A;  4IB2 A;  4H67 A;  1S9T A;  4FE8 A;  1Y20 A;  3O66 A;  4KYS A;  5BUU A;  3TFL A;  4EDP A;  1NH8 A;  3SEX A;  2XXW A;  2B3F A;  1N84 A;  2D5W A;  4DXB A;  3S9E A;  1P1Q A;  4WKM A;  3T9X B;  2XX7 A;  1FTK A;  5KCJ A;  3ZKK A;  1I6B A;  1D3K A;  1FQE A;  2ANJ A;  4F29 A;  5AA2 D;  3TCH A;  3DP6 A;  3VXC A;  1A99 A;  2WKY A;  3UK4 A;  2O69 A;  3UN6 A;  4THI A;  2UYE A;  5CMB A;  3T66 A;  1YAE A;  1LBC A;  3HV1 A;  1EZO A;  3A3C A;  2P0S A;  1QUL A;  3VLW A;  1B0H A;  1ZKB A;  4JWO A;  4OEV A;  2RC7 A;  4GVO A;  2DS9 A;  2OCU A;  4ZEB A;  1NNF A;  5HM4 B;  5CBS A;  4HJ0 A;  5FHO A;  2XXY A;  2FNC A;  3G3K A;  2I3V A;  1Y3P A;  1POY 1;  3DP8 A;  4RYA A;  2F5X A;  3OEK A;  4WXJ A;  1GR2 A;  3IOU A;  1PB9 A;  2AL4 A;  1PB8 A;  4JXI A;  4ZEC A;  3CR9 A;  3FVN A;  3UGW A;  4ZEI A;  2ONS A;  2PBW A;  1MQI A;  4BDQ A;  3KN7 A;  3TTR A;  1FCK A;  4ELQ A;  4ZEK A;  1I69 A;  4MF3 A;  3H4Z A;  2OZZ A;  2QS4 A;  1TFD A;  1YCJ A;  1JW4 A;  3RT6 B;  4NE4 A;  5ITP A;  1LB9 A;  1P99 A;  1SBP A;  2GH9 A;  2A5S A;  1LAX A;  1URS A;  3N6T A;  2V93 A;  2Y7R A;  2F7A A;  1UTH A;  4QRZ A;  5IKB A;  1TXF A;  4LQ2 A;  4ESW A;  3T22 A;  1DPP A;  3KG2 A;  2ZYM A;  3MAM A;  3V83 A;  1FQA A;  3I5O A;  3KN3 A;  1IQ7 A;  4O3C A;  1O7T A;  4ERS A;  3K6V A;  4KR5 A;  2ABH A;  5EYF A;  2AYS A;  2Z8D A;  1JW5 A;  3RT8 A;  2ZMB A;  2XXT A;  2H4I A;  2HZK A;  2XX8 A;  4ZZE A;  2Q88 A;  3TDJ A;  4LVQ A;  1IIW A;  4GOT A;  3OO8 A;  2B65 A;  3IJX B;  4DLO A;  1LAH E;  2F7C A;  1II5 A;  2ONK E;  3T9V A;  2HCA A;  3U94 A;  3RUM A;  1SW5 A;  3OEM A;  3K1M A;  5CI5 A;  4YMB A;  4KYD A;  1ZU0 A;  3IO6 A;  3QAX A;  1QVS A;  2XDG A;  4JDF A;  5KZT A;  4H8I A;  4ZDM A;  3S2V A;  3PUV E;  1EH3 A;  3LSL A;  4FEC A;  5L8D A;  4H5G A;  4MLV A;  4G8M A;  3PPP A;  4NF4 B;  1H44 A;  1TWY A;  1DOT A;  1B7U A;  2XD3 A;  3ONM A;  3SEW A;  4NED A;  4DLQ A;  5H8F B;  1SVX B;  4IY5 A;  1DPE A;  3ECR A;  4HS7 A;  4F2Q A;  1TT1 A;  3R6U A;  3BFU A;  3IB0 A;  2V25 A;  2F6P A;  2IEE A;  3Q25 A;  3ILT B;  3C33 A;  3ZSF A;  3FVG A;  2DE4 A;  2Q8J A;  4QFL A;  4NWD A;  2DE3 A;  2E0S A;  5DVJ A;  4P11 A;  1FQD A;  1FW0 A;  4EXL A;  3CRB A;  4R6H A;  3CG1 A;  2HAU A;  2QS1 A;  5CC2 A;  4XKN A;  5I2N B;  1B3L A;  3MJN A;  3USD A;  3CI8 A;  2H25 A;  1RKM A;  2M8C A;  2XHD A;  1ZMG A;  4ONY A;  3KGC A;  5K2X A;  3O6I A;  5H8Q B;  4EXK A;  1LGB C;  4KD5 A;  3VVE A;  1OLC A;  3RN8 A;  2V3U A;  3C9H A;  4ISU A;  3FJM A;  1JW1 A;  3K00 A;  3DEL B;  4WEP A;  3PUZ E;  3MWB A;  3TTK A;  4R72 A;  4OEN A;  4I1D A;  3SES A;  3IAZ A;  1LFI A;  5EHM A;  1Y1M A;  3OO6 A;  2G29 A;  4GIZ A;  5CMK A;  2Q89 A;  2XXQ A;  3L6H A;  1A8F A;  4AB5 A;  1B40 A;  4YAH X;  2YLN A;  4F1Y A;  2RIN A;  1IXC A;  4G77 A;  2F97 A;  4NTL A;  3C32 A;  3PMX A;  3PUX E;  1JEU A;  2QS3 A;  1GGG A;  1HSE A;  1QUI A;  2RKM A;  3TEP A;  2QJE A;  5DVI A;  1POT A;  3KSX A;  4Z7E A;  5J1D A;  4TLM B;  2I58 A;  3PPQ A;  4POX A;  2QKH A;  2UYF A;  4YKJ A;  1A8E A;  1ZBM A;  3KSJ A;  3PUW E;  5H8H B;  1A55 A;  5I56 B;  4LUB A;  4PE5 B;  1FQC A;  4BDO A;  1U34 A;  3VDF A;  5TPA A;  4NF5 B;  4F1U A;  1LAF E;  1BP5 A;  3K2D A;  2XXI A;  2F8D A;  4RJZ A;  5TP9 A;  1FTJ A;  1IXG A;  4EF2 A;  5I57 B;  1MQG A;  3TUS A;  4UA8 A;  4XKQ A;  4KYE A;  4R2B A;  1B05 A;  4NF6 B;  3L6G A;  3FV2 A;  4MH5 A;  1IXI A;  1H45 A;  3G7W A;  2O6A A;  3H7M A;  4OXV A;  1SYH A;  3FZV A;  1AH5 A;  5CMC A;  2DXR A;  3T9H B;  3CVG A;  4GF8 A;  3ZKL A;  1LLS A;  3MQ9 A;  2XXP A;  1SD3 A;  1MH4 A;  3H06 B;  3S9N C;  2DWH A;  3FGS A;  2REJ A;  1LB8 A;  5A5X A;  3E3K A;  2JOD A;  4MBP A;  1PBP A;  3H03 A;  1D4N A;  4GRK A;  1M5F A;  2RCA A;  1FTL A;  1MXX A;  3MVY A;  2DSF A;  3QK6 A;  1UIV A;  2REG A;  4OHN A;  1SI1 A;  4OWD A;  3KBR A;  5JK4 A;  4ZED A;  2O68 A;  1ZIU A;  2X7Q A;  4HCW A;  4QSD A;  2DYX A;  5TU0 A;  3Q29 A;  4F3B A;  4XKR A;  1H43 A;  4RA1 A;  2I48 A;  2P1S A;  1Z7M E;  1SW1 A;  3IX1 A;  4EUO A;  4U1O A;  4ELR A;  2I0B A;  4TOZ A;  1B5J A;  3IB2 A;  3K02 A;  1PBQ A;  2OWS A;  4OVJ A;  3TMG A;  2GHB A;  2IA4 A;  4OZ9 A;  4R9F A;  1MXZ A;  3EF7 A;  4XXU A;  5L9S A;  3LR1 A;  5H8N B;  3PPR A;  3E13 X;  4H8J A;  5FHN A;  3N7S A;  2QL3 A;  1P1O A;  2VD2 A;  2O51 A;  3FXQ A;  3G3H A;  2ZYO A;  2E1S A;  2HZL A;  2I3W A;  4R74 A;  3DM0 A;  2L27 A;  3IL1 B;  1MY3 A;  4RK9 A;  2DOJ A;  5AE4 A;  1CB6 A;  3PGF A;  3LSF B;  1GTK A;  4PFW A;  1B4H A;  3CFX A;  4P0G A;  2UVG A;  3TYH A;  3H6W A;  2Z23 A;  4H5F A;  1WDN A;  3DP4 A;  4QSE A;  5H8S A;  2I0C A;  2HQ0 A;  2Z8E A;  4F31 B;  1MPB A;  1FQF A;  4FOR A;  5AA2 A;  2FYI A;  3U1O A;  3BKI B;  4UAC A;  5AA1 A;  3FD3 A;  1LFG A;  1Q35 A;  2VOZ A;  1MXW A;  3QUJ A;  2AIX A;  1VE4 A;  2RC9 A;  2ZNS A;  4ZE8 A;  4ELO A;  2Y7W A;  1N0T A;  1OMP A;  4LON B;  3KJ7 A;  3HN0 A;  3IOW A;  4N6P A;  2Q9T A;  1R9L A;  1B52 A;  3OMB A;  4GLI A;  5IAI A;  4G68 A;  4JSD A;  3OEN A;  2UVI A;  4FED A;  1P1W A;  2O1L A;  3MP1 A;  3MZ9 A;  1MDP 1;  2NXO A;  2G93 A;  3D4G A;  2O7U A;  3U92 A;  5EHS A;  4YZZ A;  2ONR A;  3MBP A;  3N6U A;  5JTY A;  3GBA A;  4OQO A;  3CSB A;  4DDD A;  3FXU A;  3PD9 A;  2H5Y A;  2UXA A;  3T93 B;  1P1N A;  1QUJ A;  1XC1 A;  4KI0 E;  2QSX A;  4ZS9 A;  3SEV A;  5DT6 A;  4F22 A;  1URD A;  1GV8 A;  1DTZ A;  1DSN A;  2QMX A;  4F3S A;  5CMM A;  3GBB A;  5DTB A;  3OXN A;  1B1X A;  1BKA A;  2AL5 A;  5H8Q A;  2UVH A;  1CE2 A;  1D9V A;  3E9X A;  4ELP A;  1SYI A;  1MQJ A;  2R9J A;  2PYY A;  1NKX A;  1QKB A;  1ZLQ A;  3OO7 A;  4X1D A;  3IOR A;  5KDT A;  3K0V A;  4FAJ A;  3KEI A;  5B70 A;  1Y3N A;  2OBG A;  4C1T A;  5FHM A;  1Q1K A;  1XT8 A;  1WOD A;  4Q5T A;  2PX1 A;  3C31 A;  2ZYN A;  3UA8 A;  4DLD A;  3MUQ A;  4JBZ A;  3VE1 B;  1R1N A;  3LUY A;  5CM6 A;  3M3F A;  1URG A;  1UTB A;  5I2K A;  5AA3 A;  2DE2 A;  3QXM A;  1B7H A;  4TQU Q;  4R6Y A;  1A54 A;  3OOA A;  2R71 A;  3W9W A;  4EQB A;  3K01 A;  1OVT A;  3PPN A;  1IZ1 A;  2OLB A;  5ICT A;  1B3F A;  2DQV A;  1UTH B;  3M8U A;  4M1V A;  1Y4T A;  3HCQ A;  2ESN A;  4FIM A;  3C35 A;  1N3X A;  3SET A;  1QUK A;  3I3V A;  1LFH A;  4F2O A;  4GXS B;  3JYR A;  3B6W A;  2YPN A;  1JET A;  3EN3 A;  3N5L A;  3OSR A;  5I56 A;  2Y7P A;  1Y3Q A;  4ECF A;  1FTO A;  4GD5 A;  1FQB A;  2QS2 A;  5K2Y A;  3G3I A;  1N3W A;  2I49 A;  3HPI A;  3K1N A;  3O29 A;  1RYO A;  4NF8 A;  3TZA A;  1XVX A;  3W9V A;  3U8Q A;  3TTM A;  4KQP A;  1UIU A;  4NF6 A;  4GL8 A;  2GHA A;  3O9P A;  3MPL A;  3HST A;  5AA4 A;  2RF1 A;  3ILU B;  3PD8 A;  4OMB A;  3FAS A;  3IOT A;  4Q8R A;  2ZYK A;  1USY E;  4IO2 A;  4OER A;  1KWH A;  3F11 A;  3MC2 A;  2XD2 A;  1JQF A;  4IO6 A;  1OQG A;  3KZG A;  4ZE9 A;  4PET A;  4RY1 A;  4YB7 A;  3Q28 A;  4DXU A;  3K6U A;  4NMY A;  4YB6 A;  2OK2 A;  3SEY A;  1B9J A;  2F6G A;  5HPQ A;  3RTW B;  3H3G A;  3KJT A;  4IO7 A;  3T96 B;  4IGR A;  1A40 A;  1GVC A;  1LBB A;  4IO4 A;  1B5H A;  4LAT A;  4JWX A;  3V8X B;  1LAG E;  3CFL A;  2GRV A;  1S50 A;  2DXY A;  3MP8 A;  3LSX A;  1AMF A;  4HW8 A;  1ZJL A;  1MRP A;  3HO7 A;  2THI A;  1LCF A;  4LF3 C;  1B2H A;  1IUD A;  4L17 A;  3G3J A;  4BLA A;  3BBR A;  4F3P A;  3VXB A;  2P2A A;  4DCY A;  1Z7N E;  3GLB A;  3VV5 A;  3U72 A;  2QMW A;  2QRY A;  3FVO A;  4RXL A;  4LA9 A;  1T0K A;  2DWI A;  5F1Q A;  1B1H A;  1MDQ A;  1H76 A;  2DP8 A;  3FXR A;  3PMW A;  3FUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...