3EHSA

Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1)
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFSLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fusion protein of CRFR1 extracellular domain and MBP
publication title Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 131
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehsA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehsA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3ehsA03
4F1UA 3TODA 1JQFA 3OO8A 4ZZAA 4U1ZA 5AE4A 4ERSA 3H7MA 5LOMA 2QS4A 1RKMA 4RK9A 3N26A 2UVGA 3EF7A 2RC8A 5I59A 3CG1A 2Z8FA 4LUBA 1FTLA 5H8QA 2Y7IA 3K6VA 4U23A 4WEDA 3MVZA 5L9MA 4KPTA 4X1BA 4MLQA 2O1MA 1PEBA 4F2QA 3ILUB 2UVHA 2HAUA 3FD3A 3FJGA 2XX7A 4F2OA 4G68A 5ISUA 2H98A 3G3IA 1MXXA 2V3UA 3SEYA 3UORA 5JEIA 4KYSA 3S2VA 1Y9UA 4ZZEA 3TQWA 2PYYA 1URSA 2Z23A 5K2XA 5F1QA 3U72A 4MBPA 3MQ9A 3HV1A 3PU5A 2VOZA 1SVXB 1NH7A 1ZJLA 4YKKA 3CFZA 2QJEA 2P1SA 4OMBA 3MAMA 2DWJA 3LSXA 4UACA 4GWOA 1H3DA 3DM0A 1UIVA 4OYVA 1IIWA 3M3LA 4JBZA 1A54A 2F97A 2P2AA 3FZVA 3S9NC 1RYXA 2QKHA 4IY6A 4R73A 3OSRA 1ATGA 3H3GA 4NMYA 2I48A 4KHZE 4GL8A 4YKJA 3VE1B 1Y3QA 2ZYMA 4NWCA 2GH9A 2Y7WA 1SYHA 2XXXA 3RT8A 4YICA 1OQGA 3IOUA 2REJA 4IGRA 3UK4A 4RPOA 5DVJA 3KOTA 1SI0A 5DEXB 5DYHA 1B4HA 4GD5A 3SEXA 2O7IA 4NF8B 1ZKBA 3TTRA 1MQHA 1UTHA 3PPOA 1JNFA 2AYSA 4LA9A 5JK4A 4BDOA 3D4GA 1MY0A 3IB0A 1O63A 1MPCA 2QPQA 4ELQA 4LP2B 1MH4A 1Y4CA 2QS2A 5IAIA 3O2AA 1DSNA 4U4XA 1DMBA 2JODA 3ONMA 3FUZA 4DZ1A 4DCXA 3VDFA 1URGA 3PUZE 3BBRA 1MQIA 4HW8A 3L6GA 3C33A 3PD8A 3TCGA 2UXAA 1P99A 3MW0A 3DELB 4E0XA 3T96B 4HS7A 4G8HA 3GZGA 1WDNA 3IJOB 3FVKA 3VVFA 3FASA 4R72A 4DLQA 2F35A 2ONSA 3N6UA 1B46A 3O29A 1H43A 5L8DA 3U93A 4R6HA 5I2KA 4EDPA 4F3GA 4U22A 3SESA 3IAZA 5CBRA 3ZS6A 3B6WA 1FTMA 4N6PA 3PUXE 2F7BA 3AXFA 4YB7A 5CBSA 1N3XA 5ELVA 3S4UA 4FAJA 3VLVA 3FJMA 3H06B 1JW5A 3CR9A 5AA2A 4KYDA 2O69A 4F31B 3LR1A 1B58A 1MPDA 5KZTA 3VLUA 1TWYA 3T9UA 3KN3A 3LBSA 2M8CA 3R6UA 1SW4A 3N6TA 1QJMA 2F34A 4H6DA 3FVNA 3CI8A 2F6PA 3CIJA 2QS1A 3I6VA 3EHSA 1P1NA 4ZEDA 1RYOA 3RN8A 1JVYA 1MQGA 2V25A 5I57A 2GHAA 3OD7A 3U1OA 3KSXA 4RPNA 1N7XA 3OXNA 1H45A 3OMBA 1FTKA 4R2BA 2AIXA 1MG1A 3I5OA 2V3QA 4F39A 3KJTA 1BIYA 1XOCA 3P7IA 3QK6A 2HZKA 5I59B 4IB2A 1YCJA 4JDFA 1EZPA 3V5AA 4RY1A 1EH3A 5H8QB 2VP1A 4GOTA 1HSEA 4IO7A 3RLFE 3MWBA 1UIUA 1NNKA 4ECFA 3LC8A 4JSDA 2UYFA 3VFJA 4FE8A 3N7RA 1A55A 1LB9A 2Q2AA 3A09A 4G68B 1NL5A 1FTOA 5H8HA 4DIGA 4Q30B 3W15C 3KOSA 1IUDA 3IOVA 4BDNA 2HEUA 4PP0A 2RCBA 1VE4A 3TDJA 4MF3A 1MRPA 2E1SA 1ZLQA 4I62A 4RK2A 1JW4A 3O97A 3HCQA 1JEUA 4LZ8A 4EQ9A 1FQFA 1GTKA 2DWAA 4NWDA 3OO6A 3EPEA 2NXOA 3C5TA 2XX8A 4QRZA 4YMBA 3U92A 1B1HA 2Z8EA 4IO6A 2X7PA 2B3FA 5B70A 2DP8A 1L5TA 2RC9A 4I9DA 2H99A 4EXLA 4F29A 1NNFA 1B7UA 4PQJA 4MLVA 1YAEA 3U8QA 4DXCA 3O9PA 2XXIA 4DLOA 5CMKA 1FQBA 1TFAA 3KGCA 4ESWA 3TELA 3QSLA 3B6QA 2YJPA 3MVXA 4KI0E 2UYEA 5TU0A 4JWXA 5ITOA 3TCFA 2DS9A 1IZ1A 2F7AA 1M5FA 2VGQA 3C9HA 2L27A 2D21A 3FGSA 3MUQA 1VSOA 3RGYA 2REGA 1UTHB 4RJZA 1MS7A 2R71A 2DOJA 4G77A 4GQOA 5TPAB 4TQUQ 3VVDA 4XTCQ 3SEVA 4N13A 1PC3A 4FEBA 3MP8A 2Q8JA 3K02A 3V8XB 1POY1 3IORA 1B3EA 3T93B 3GBBA 1XT8A 1LBBA 3I3VA 4JWOA 2HXWA 2DXYA 5CRYA 4OFOA 1BP5A 5HM4B 2XXYA 1M5CA 2XX9A 1DOTA 4NF5A 3KSJA 2Z22A 3EHUA 1U34A 3K6WA 1XVXA 5I2KB 2Q88A 2FA7A 1US4A 4PFTA 2DVZA 1I69A 2RCAA 2QMXA 4NF6A 5AA2D 1IEJA 3IOWA 1MH3A 2O7UA 4F1VA 2F8DA 3SKPA 4OERA 4YMAA 1TFDA 4N07A 4WXJA 2RINA 4G68C 4H8IA 4ZS9A 5AA2B 1PB8A 1HSLA 4POXA 1A99A 3JV9A 4QFKA 1QKAA 5A5XA 3O66A 4FEDA 3W9WA 1J1NA 2LAOA 3LSWA 2OJTA 2A5TA 3DLNA 5FTIA 5AA4B 2H25A 3UIFA 3H03A 3K0VA 4EXKA 3B7DA 3N5LA 3CFXA 3HHGA 3KFMA 1MY1A 3TEPA 1P1QA 2DE3A 4DLDA 1H44A 2QRYA 3C4MA 1B0HA 1NFTA 4H5GA 3CRBA 5I57B 1Y20A 4OESA 1Y3PA 3O6HA 2F78A 2UVIA 4F3BA 3H6UA 3Q26A 1Z7NE 1MM7A 2Y7KA 1B5JA 3K4UA 5DVFA 1LGBC 1SBPA 4QHQA 2PX1A 5IKBA 4F18A 1B7ZA 4QF9A 4OWDA 3PUYE 3G3HA 1SW2A 4RYAA 3A3UA 1GV8A 2I0BA 1UTBA 4HCYA 5TPAA 3M8UA 2DVCA 1A7LA 1ZBMA 2OZZA 4NEDA 2XXHA 3DP6A 3RTFB 4F19A 1FW0A 3PMWA 1Y4TA 4PFUA 5I84A 4H65A 3C31A 3CFLA 3TMGA 3IL1B 1B3LA 4XKQA 2X26A 3C34A 1A8EA 4Z0IA 2B3BA 3H6VA 1MXUA 3UN6A 1CB6A 5CMCA 4Z7EA 3VVEA 5H8HB 2O51A 4P0GA 2ONRA 4GVOA 3A3CA 2OLBA 3IO6A 3OOAA 3HO7A 1P1UA 4XKRA 3KBRA 3LUYA 1D4NA 3TPAA 3SDFA 3SERA 3QYTA 1WODA 2I4CA 2F6GA 4LQ2A 1JW1A 3EN3A 1Y1MA 3S9MC 4HTGA 2DE4A 3K1NA 1H76A 3AQFB 1NMUA 3PUWE 5CMMA 4OENA 1QUIA 1PB9A 4I8CA 1LCFA 4QFOA 3MC2A 4DXBA 3PPPA 2KLFA 3KZGA 5I2NA 1P1OA 5CM6A 1LCTA 1R9LA 1FCKA 3OO7A 2ALUA 2ZYOA 2E0SA 3LSLA 4HJ0A 4POWA 1B7HA 4H1XA 2ZYNA 1LFGA 1OMPA 2OWSA 3TTKA 3FATA 5AA4A 2HFBA 1O7TA 2XXTA 1F9BA 1M5EA 4ZE9A 2XDGA 2R9JA 3MP1A 1IITA 3G3KA 4JXIA 3S9LC 2ZNTA 1FQDA 5L9SA 2CMOA 5M2VA 1NH8A 5H8NA 4OEUA 2PMSA 5J1DA 1DPEA 1MXWA 3V83A 5B7DA 3CSGA 1N3WA 1D9YA 1LB8A 3FXQA 4QSDA 2DWHA 3K1MA 2NVUB 3BFTA 1OLCA 4X9TA 3RTWB 2QMWA 2XXVA 5TP9A 4BDQA 3WAFA 1R6ZA 1I6QA 4YZZA 3G3JA 1Q35A 2FNCA 2O68A 3R26A 4F3PA 2UVJA 4U4SA 3CG3A 3Q27A 1MY3A 3IB1A 4ZEIA 4KQPA 1SDXA 1GVCA 4YB6A 4M4GA 1EZ9A 2PT1A 3VV5A 1MXZA 2Z8DA 3GBAA 4NF5B 1URDA 2PBWA 3MPLA 4ISUA 3PPQA 4OHNA 2JNDA 2Y7PA 1MM6A 4F1YA 4MFIA 3UA8A 3E3KA 4IGTA 4IY5A 3ZKLA 2V84A 2ZMBA 2OCUA 5FHOA 4NF6B 3N94A 1B51A 3MZ1A 2ZNUA 1OVBA 4DDDA 4F3SA 1B3GA 2XD3A 2ONKE 5BWJA 4RXLA 3OO9A 3H4ZA 5AA1A 5A5XB 3SEUA 4ELRA 2B65A 2F36A 1MQJA 1B3HA 1JVXA 2H4IA 3T9XB 4IO4A 1FQCA 2OK2A 1B52A 3N7SA 1I6AA 2A5TB 1S50A 3OELA 4X48A 3C36A 4ELPA 2D5WA 1EZOA 3VXCA 3HHFA 2DE2A 5HPQA 5BUUA 3V89B 1NNPA 2RF1A 1B5HA 5FHMA 3O6IA 4EF1A 1GR2A 1ELJA 3TQLA 3ECRA 4IO5A 3L2JA 1POTA 1MDP1 4GRKA 4TOZA 1DTGA 4XIGQ 4IO3A 2WKYA 1PBPA 3TYHA 1M5DA 3KN7A 2HAVA 4LATA 3TTNA 3IOLA 2F5XA 1HSJA 2ANJA 4OZ9A 3K1PA 1LAFE 4QFLA 3T9VA 3GXAA 2XXPA 3HN0A 4C1TA 4O3BA 3QUFA 1EU8A 3FJ7A 4ZGMA 2QS3A 3L6HA 4GXSB 1UTBB 3RNNA 1B05A 4NTLA 4OFJA 3QAXA 3C32A 5L9OA 2GHBA 1LSTA 4GXAA 1LAHE 4U2RA 2PVUA 3K01A 3TFLA 3CSBA 4RA1A 3R7XA 4QFNA 1PB7A 2I0CA 5KCJA 4AQ4A 1VFDA 2O6AA 3N7PA 5DT6A 3MVWA 3PUVE 1AMFA 1IXCA 1LAGE 4AB5A 3G3GA 1B3FA 1OQHA 1SW1A 4TLLB 1XHYA 2W7YA 1IXGA 2P0SA 2V93A 3O28A 2THIA 4ND9A 1VR5A 3EHTA 2XD2A 2ZYKA 3BKIB 4KCDA 1FQEA 1N76A 4OEVA 4PE5B 1LLSA 1Y1ZA 4GLIA 4R75A 4LQ5A 1SW5A 3FVOA 3OSQA 3UP9A 4WEPA 1USYH 4TLMB 1TT1A 1JETA 3H6WA 4H67A 1Y3NA 2BJJX 3PGFA 1QVSA 4EQBA 5I2NB 1QULA 2RKMA 4YU0A 5JTYB 1USYE 1ZIUA 5KDTA 1MQDA 1N0TA 2PT2A 5CC2A 3IR1A 3MPKA 4ZEKA 3TCHA 3RPWA 2AL5A 1PDAA 4GL0A 5H8SA 2R6GE 3KG2A 1D9VA 2NUVA 5DVIA 4BDLA 1ZU0A 4XKNA 4F22A 1S7YA 3JYRA 5FTHA 2G93A 1IXIA 4FJPA 4R9GA 1LFIA 4HCWA 4U21A 3G3FA 4BDRA 5H8NB 4JWYA 3E4RA 3PPRA 4LONB 1Z7ME 3S9EA 4KCCA 4L17A 2G29A 1FTJA 1AL3A 2XXWA 3HPIA 3T66A 4NF4A 3PPNA 1R1NA 2YLNA 4BDMA 3OEKA 4ESXA 4AB6A 3UGWA 1AOVA 2DYXA 1O64A 3VXBA 5EYFA 5DTBA 4R74A 3FV2A 5TP9B 2GFEA 4Q8RA 4H8JA 5ICTA 4DE8A 4ONYA 2HQ0A 1T0KA 2GRVA 1DTZA 2OBGA 1MY2A 2I58A 4ELOA 4MH5A 4E0WA 3ILTB 3QXMA 5I58A 2FYIA 3OENA 3MVYA 1BKAA 4KR5A 5ICQA 1YPNA 3D4CA 4PFWA 4QSEA 3FVGA 3BFUA 4K3FA 4ZE8A 2HCAA 4KYEA 5EHMA 4G8NA 1BTJA 3C59A 1B2HA 3TZAA 4C1UA 3SEWA 4OFLA 4H0WA 3FIRA 4YB5A 1N04A 4WKMA 2ESNA 3RUMA 3U94A 1AH5A 1A8FA 2ZNSA 4KD5A 3ZSFA 4LZ5A 4GF8A 2ZXTA 3GLBA 1MDQA 1B0LA 1TXFA 1B1XA 2NWJA 3F11A 1DPPA 1ANFA 3PV0E 4YKIA 4BLAA 3FV1A 3LSFB 2HZLA 2QSXA 2RC7A 3ZKKA 2JNCA 1S9TA 2VHAA 4FIMA 3G7WA 1US5A 3IB2A 1MY4A 5ITPA 3M3KA 3T22A 4DXUA 1UQWA 2A5SA 5JTYA 4EF2A 3IOTA 4I1DA 2F7CA 3H6TA 4XXUA 2IA4A 4FATA 5CI5A 1MPBA 4P11A 2Q9TA 1B6HA 4QFPA 3KN8A 1PBQA 4Q5TA 4H5FA 5H8FB 1OIBA 4FECA 4JSOA 3M3FA 1CE2A 3SETA 1BLFA 3FXRA 5K2YA 4NE4A 3OEMA 3B6TA 3QIMA 1MXVA 1LBCA 4G4PA 3EQ1A 1N84A 1MXYA 1FQAA 4ZDMA 2IEEA 3TTMA 4ZEBA 2ABHA 3C35A 2DWIA 4PETA 4ZECA 3TTLA 2XXQA 2O1LA 3WAEA 1R9QA 2I49A 1AIVA 2CZLA 2Q89A 4LZ7A 2X7QA 1GGGA 4PFYA 5I56B 3T9HB 3MBPA 2QL3A 2AL4A 5DEXA 2D3IA 5KCJB 5HBCA 2NOOA 3K00A 4NF8A 2VD2A 1KWHA 3IK6B 4M1VA 1LFHA 1B32A 1LAXA 2V3TA 4YKPA 5AA3A 4G8MA 3ODBA 3O6GA 2H9BA 2I3VA 3PD9A 3TUSA 1M5BA 1SQYA 1B9JA 4O3CA 1II5A 3W9VA 2XXUA 3FXUA 4UA8A 1OLAA 4R6YA 2Q2CA 4RNSA 3PMXA 3K6UA 5EHSA 2H5YA 4LF3C 1VFEA 4EQ7A 4IO2A 4GFRA 1SD3A 4FORA 4P0IA 4KFQA 2Y84A 5KDTB 4G2ZA 2Y7RA 4U1OA 1NNTA 1QUJA 4XKPA 1I6BA 3RQTA 3CVGA 1XC1A 1QW0A 3MJNA 4ZEFA 1ZTYA 3USDA 2DXRA 4R2FA 4EUOA 3TAJA 1XVYA 3DP4A 2I3WA 1IQ7A 3E9XA 4R6KA 3E13X 3RY3A 4OXVA 3KEIA 4JB7A 4THIA 4Q0CA 5CMBA 5H8FA 3K6XA 2DQVA 4OETA 1QKBA 1N7WA 2O84X 2OWTA 2XHDA 1JEVA 4R9FA 4O3AA 1Q1KA 1B5IA 4YAHX 3TKDA 3THIA 4NF4B 1XS5A 1WVJA 5FHNA 2I4BA 3IX1A 4QSCA 1YTVA 4GIZA 5II0A 3VLWA 1A40A 3MZ9A 4OVJA 4C0RA 1SI1A 2I6EA 4OTEA 1IXHA 2XXRA 2YPNA 1D3KA 2VD3A 1ZMGA 3K2DA 3MP6A 1NKXA 3IJXB 3JZJA 1P1WA 1QUKA 2DSFA 4X1DA 3RT6B 3KJ7A 3Q28A 1OVTA 1B40A 3MZBA 3HSTA 5I58B 5F7VA 4LVQA 3Q25A 4OQOA 3Q29A 4DCYA 3PMVA 1B4ZA 3IO4A 3QUJA 1SYIA 3DP8A 5I56A
chains in the Genus database with same CATH superfamily
4F1UA 3TODA 1JQFA 3OO8A 4ZZAA 2VPOA 4U1ZA 5AE4A 4ERSA 1NI9A 3H7MA 5LOMA 2QS4A 1RKMA 4RK9A 3N26A 4PGNA 2UVGA 1FJ6A 3EF7A 2FHYA 2RC8A 2HHMA 5I59A 4QBAA 3CG1A 3GYYA 2Z8FA 3EKIA 4LUBA 1FTLA 5H8QA 2Y7IA 4N8YA 3K6VA 4U23A 4WEDA 3MVZA 5L9MA 2KQZA 1IMFA 4KPTA 4G61A 4X1BA 4MLQA 2O1MA 1PEBA 4F2QA 4GX6A 3ILUB 2UVHA 2HAUA 5A5LA 3FD3A 3FJGA 2XX7A 4F2OA 4G68A 5ISUA 2H98A 3G3IA 1MXXA 2V3UA 3SEYA 3UORA 1FPIA 5I7IA 5JEIA 1FBHA 4KYSA 3S2VA 1Y9UA 4ZZEA 3TQWA 3D1RA 2PYYA 1URSA 2Z23A 4AS4A 1NUWA 5K2XA 4OVRA 1YYZA 3A29A 5F1QA 3U72A 1NV2A 4MBPA 3MQ9A 3HV1A 3PU5A 4P9KA 2VOZA 1SVXB 1NH7A 1ZJLA 4YKKA 3CFZA 2QJEA 2P1SA 4OMBA 3MAMA 2DWJA 3RPLB 4OA4A 3LSXA 2CEXA 1VDWA 4UACA 3BIGA 4GWOA 1H3DA 3DM0A 1UIVA 4OYVA 1IIWA 2Y5KA 2CZHA 1FPDA 3M3LA 4MJOA 4JBZA 1A54A 2F97A 2P2AA 3FZVA 2GQ1A 3S9NC 5T3JA 1LBWA 1RYXA 2L5VA 4NQ8A 2QKHA 4IY6A 4R73A 3OSRA 1ATGA 3H3GA 4NMYA 2I48A 2VT5A 4KHZE 4GL8A 4YKJA 3VE1B 2XA5A 1Y3QA 3KBZA 2ZYMA 4NWCA 2GH9A 2Y7WA 4HXVA 1SYHA 2XXXA 4N8GA 3RT8A 4YICA 2XWOA 1OQGA 3IOUA 2REJA 4IGRA 3UK4A 2P3NA 4RPOA 5DVJA 1G0IA 2HPGA 3KOTA 1SI0A 3NOHA 5DEXB 5DYHA 1FPBA 1B4HA 4P47A 4GD5A 3SEXA 2O7IA 4NF8B 1ZKBA 3TTRA 1MQHA 1UTHA 3PPOA 1JNFA 2AYSA 4LA9A 1NUXA 5JK4A 3KC1A 4BDOA 3D4GA 1MY0A 3IB0A 1O63A 1MPCA 2QPQA 4ELQA 4LP2B 1MH4A 4PDHA 1Y4CA 2QS2A 5IAIA 3O2AA 1DSNA 4U4XA 1DMBA 2JODA 3ONMA 3FUZA 4DZ1A 4DCXA 3VDFA 1AWBA 4NG7A 1URGA 3PUZE 3BBRA 1MQIA 4HW8A 5IZ3A 3L6GA 3C33A 3PD8A 3TCGA 2UXAA 1P99A 3MW0A 3DELB 4E0XA 3T96B 1NV5A 4HS7A 1SPIA 4G8HA 3GZGA 1WDNA 3IJOB 3FVKA 3VVFA 3FASA 4R72A 5I5PA 4DLQA 2F35A 2ONSA 3N6UA 3SZPA 1B46A 3O29A 1H43A 5L8DA 3U93A 4R6HA 4NN3A 5I2KA 4EDPA 4F3GA 4U22A 3SESA 3IAZA 5CBRA 3ZS6A 4O94A 3B6WA 1FTMA 4N6PA 3PUXE 2F7BA 3AXFA 4YB7A 5CBSA 1N3XA 5ELVA 3S4UA 4FAJA 3VLVA 3FJMA 3H06B 1JW5A 3CR9A 5AA2A 4KYDA 2O69A 4F31B 3LR1A 1B58A 1MPDA 5KZTA 3VLUA 1TWYA 3RPLA 4JVIA 3T9UA 3KN3A 3LBSA 5EQ8A 2M8CA 3R6UA 1SW4A 3N6TA 1QJMA 2F34A 1FPLA 4H6DA 3FVNA 3CI8A 2F6PA 3CIJA 2QS1A 3I6VA 4MNPA 3EHSA 1P1NA 4MIJA 5IZZA 3B50A 4ZEDA 4X04A 1RYOA 3RN8A 1JVYA 1MQGA 2V25A 5I57A 2GHAA 3OD7A 3U1OA 1DK4A 2WX9A 3KSXA 4RPNA 1N7XA 3OXNA 1CNQA 1H45A 3OMBA 4MHFA 5DW8A 4NAPA 1FTKA 4R2BA 2AIXA 4XEQA 1MG1A 3I5OA 2V3QA 4QXDA 4F39A 3KJTA 1BIYA 4P1LA 1XOCA 3P7IA 3QK6A 2HZKA 5I59B 4P8BA 4IB2A 1YCJA 3QMFA 4JDFA 1EZPA 3V5AA 4RY1A 1EH3A 5H8QB 1RDZA 2VP1A 4GOTA 1HSEA 4IO7A 3RLFE 3MWBA 1UIUA 1NNKA 4ECFA 3LC8A 4JSDA 2UYFA 3VFJA 4FE8A 1LBXA 3N7RA 1A55A 1LB9A 2Q2AA 3A09A 4IR8A 4G68B 1NL5A 1FTOA 5H8HA 4DIGA 4Q30B 3W15C 5J16A 3KOSA 1IUDA 1XI6A 3IOVA 4BDNA 2HEUA 4PP0A 2RCBA 1VE4A 3TDJA 4MF3A 1LBYA 1MRPA 5EQ7A 4N4UA 2E1SA 1ZLQA 4I62A 4RK2A 1JW4A 3O97A 3HCQA 2WEFA 1JEUA 4LZ8A 4MMPA 3E79A 4EQ9A 1FQFA 1GTKA 2DWAA 4NWDA 1NV1A 3OO6A 3EPEA 3ROJA 2NXOA 3C5TA 2XX8A 4QRZA 4YMBA 3U92A 1NUYA 4O7IA 1B1HA 2Z8EA 1NUZA 4IO6A 2X7PA 4PDDA 2B3FA 1NV7A 3PTYA 5B70A 5FBPA 2DP8A 1L5TA 2RC9A 4I9DA 2H99A 4EXLA 4F29A 1NNFA 1INPA 1B7UA 4PQJA 1LEVA 4MLVA 1YAEA 3U8QA 4DXCA 3IFCA 3FXBA 1FPKA 3O9PA 2XXIA 4DLOA 4XF5A 5CMKA 1FQBA 1TFAA 3KGCA 4ESWA 3TELA 1NV6A 3QSLA 2OX3A 1DCUA 2BJIA 3B6QA 2YJPA 3MVXA 2XXKA 4KI0E 4PGPA 2FBPA 2UYEA 5TU0A 4JWXA 5ITOA 3TCFA 2DS9A 1IZ1A 1FPJA 2F7AA 1M5FA 2VGQA 5EQ9A 3C9HA 2L27A 2D21A 1DBZA 3FGSA 3MUQA 1VSOA 3RGYA 2REGA 1UTHB 4RJZA 2VPNA 1MS7A 2R71A 2DOJA 4G77A 4GQOA 5TPAB 4TQUQ 3VVDA 4XTCQ 3SEVA 4N13A 1PC3A 4FEBA 3MP8A 2Q8JA 3K02A 3V8XB 1POY1 3IORA 2FIEA 1B3EA 3T93B 3GBBA 1XT8A 1LBBA 4H46A 3I3VA 4JWOA 1IMBA 2HXWA 5IM2A 2DXYA 5IZ3B 5CRYA 4OFOA 4GWUA 1BP5A 5HM4B 2XXYA 1M5CA 2XX9A 1DOTA 2XWIA 2Y5LA 4NF5A 3KSJA 2Z22A 4GWZA 3EHUA 1U34A 3K6WA 4MNIA 1XVXA 1NV0A 5I2KB 2FVZA 2Q88A 2FA7A 1US4A 4I3EA 4PFTA 2DVZA 1I69A 2RCAA 2QMXA 4NF6A 5AA2D 2KR0A 1IEJA 3IOWA 1MH3A 2O7UA 4F1VA 2F8DA 3SKPA 4OERA 4YMAA 1TFDA 4N07A 4WXJA 2RINA 4G68C 4H8IA 4ZS9A 5AA2B 1PB8A 1HSLA 4POXA 1A99A 3JV9A 4QFKA 1QKAA 5A5XA 3O66A 4FEDA 3W9WA 1J1NA 2LAOA 1FSAA 3LSWA 2OJTA 2A5TA 3DLNA 5FTIA 5AA4B 2H25A 3UIFA 3H03A 3K0VA 4EXKA 3B7DA 3N5LA 3CFXA 3HHGA 3KFMA 1MY1A 3TEPA 1P1QA 2DE3A 4DLDA 1H44A 2QRYA 4N6DA 3C4MA 4PAIA 1B0HA 1NFTA 4H5GA 3CRBA 5I57B 1Y20A 4OESA 1Y3PA 3O6HA 2F78A 2UVIA 4F3BA 3H6UA 4PCDA 3Q26A 1Z7NE 1MM7A 2Y7KA 1B5JA 3K4UA 5DVFA 1LGBC 1SBPA 4QHQA 2PX1A 5IKBA 1LBVA 4F18A 1B7ZA 2FIXA 4QF9A 4OWDA 3PUYE 3G3HA 1SW2A 4RYAA 3A3UA 1GV8A 4AS5A 1FBDA 2I0BA 1UTBA 4HCYA 5TPAA 3M8UA 2QFLA 2DVCA 1A7LA 1ZBMA 2OZZA 4NEDA 2XXHA 3DP6A 3RTFB 4F19A 1FW0A 2F3BA 3PMWA 1Y4TA 4PFUA 5I84A 4H65A 3C31A 1IMEA 3CFLA 3LV0A 3TMGA 1KZ8A 3IL1B 5ESYA 1B3LA 1IMDA 4XKQA 2X26A 3C34A 1A8EA 4Z0IA 2B3BA 3H6VA 1MXUA 3UN6A 2F3DA 1CB6A 5CMCA 4Z7EA 3VVEA 5H8HB 2O51A 4P0GA 2ONRA 4GWSA 4GVOA 3A3CA 2OLBA 3IO6A 3IFAA 3OOAA 4PFBA 3HO7A 1P1UA 4XKRA 3KBRA 3LUYA 1D4NA 3TPAA 3SDFA 3SERA 3QYTA 1WODA 2I4CA 2F6GA 4LQ2A 1JW1A 3EN3A 1Y1MA 3S9MC 4NGUA 4HTGA 2DE4A 3K1NA 1H76A 4JVCA 3AQFB 1NMUA 3PUWE 5CMMA 4OENA 1QUIA 1PB9A 4I8CA 1LCFA 4QFOA 1K9ZA 3MC2A 4DXBA 3PPPA 2KLFA 3KZGA 5I2NA 1P1OA 4OVTA 2ZZWA 4HE2A 5CM6A 1LCTA 1R9LA 1FCKA 3OO7A 5ET6A 2ALUA 2ZYOA 2E0SA 2ZZXA 3LSLA 1KA1A 4HJ0A 4POWA 1B7HA 4H1XA 2ZYNA 4PF8A 1LFGA 1OMPA 2OWSA 3TTKA 1FBGA 3FATA 5EYHA 5AA4A 2HFBA 1O7TA 2XXTA 1F9BA 1KA0A 1M5EA 4ZE9A 2XDGA 2R9JA 3MP1A 1IITA 3G3KA 4JXIA 2PFYA 3S9LC 2ZNTA 1FQDA 4OVSA 2XWKA 5L9SA 5IZ1A 2CMOA 5M2VA 1NH8A 5H8NA 4OEUA 2PMSA 5J1DA 1DPEA 1MXWA 3V83A 5B7DA 4PE3A 4I40A 4GWWA 4HE1A 3CSGA 1N3WA 1D9YA 1LB8A 4N17A 2PCRA 3FXQA 4QSDA 2DWHA 3K1MA 2NVUB 3BFTA 1OLCA 1JP4A 4X9TA 3RTWB 2QMWA 2XXVA 5ET8A 5TP9A 4BDQA 3B8BA 3WAFA 1R6ZA 1RDYA 1I6QA 4YZZA 3G3JA 1Q35A 2FNCA 2O68A 4NF0A 3R26A 3RYDA 4F3PA 1YXIA 2UVJA 4U4SA 3CG3A 3Q27A 1MY3A 3IB1A 4ZEIA 4KQPA 1SDXA 2OWZA 1GVCA 4YB6A 4M4GA 1EZ9A 2PT1A 3VV5A 3KC0A 1MXZA 2Z8DA 3GBAA 4NF5B 1URDA 2PBWA 3MPLA 4ISUA 3PPQA 4OHNA 2JNDA 2Y7PA 1MM6A 4F1YA 4MFIA 3UA8A 3E3KA 4IGTA 4OVPA 4IY5A 3ZKLA 2V84A 2ZMBA 2OCUA 5FHOA 4NF6B 3N94A 1B51A 3MZ1A 5IGAA 2ZNUA 4FBPA 2R8TA 1OVBA 4DDDA 4F3SA 1B3GA 2XD3A 2CZKA 2ONKE 5BWJA 4RXLA 3OO9A 3H4ZA 4PBQA 5AA1A 5A5XB 5F24A 3SEUA 4ELRA 4KXPA 2B65A 1FBPA 1MQJA 2F36A 1B3HA 1JVXA 2H4IA 3T9XB 4IO4A 4H45A 1FQCA 2OK2A 5I3SA 1B52A 3N7SA 1I6AA 2A5TB 1S50A 3OELA 4X48A 4PBHA 3C36A 4ELPA 2XWVA 2D5WA 1EZOA 3VXCA 3HHFA 2DE2A 5HPQA 5BUUA 3V89B 1NNPA 2RF1A 1B5HA 5FHMA 3O6IA 4EF1A 1GR2A 1ELJA 3TQLA 3ECRA 4IO5A 3L2JA 1POTA 1MDP1 4GRKA 4TOZA 1DTGA 4XIGQ 4IO3A 2WKYA 1FRPA 1PBPA 3TYHA 1M5DA 3KN7A 4UABA 5EYGA 2HAVA 2Q8MA 4LATA 3TTNA 3IOLA 2F5XA 2HXRA 1HSJA 2ANJA 4OZ9A 1G0HA 3K1PA 1LAFE 4QFLA 3T9VA 4MCOA 3GXAA 2XXPA 3HN0A 4C1TA 4O3BA 3QUFA 2QVRA 1EU8A 4PAFA 3FJ7A 4ZGMA 2QS3A 3L6HA 4GXSB 4X8RA 1UTBB 3RNNA 1B05A 4NTLA 4OFJA 2ZZVA 3QAXA 3C32A 5L9OA 1FBFA 2GHBA 1LSTA 4GXAA 1LAHE 1NV3A 4N91A 4U2RA 2PVUA 1QGXA 3BIHA 3K01A 2WYPA 3TFLA 3CSBA 4RA1A 3R7XA 4QFNA 1PB7A 2I0CA 5KCJA 4AQ4A 4GBWA 1VFDA 2O6AA 3N7PA 5DT6A 3MVWA 3PUVE 1AMFA 1IXCA 1LAGE 4AB5A 2QVVA 3G3GA 1B3FA 1OQHA 1SW1A 4TLLB 1XHYA 2W7YA 1IXGA 2P0SA 2V93A 3O28A 1RDXA 2THIA 4ND9A 1VR5A 3EHTA 2XD2A 2ZYKA 3BKIB 4KCDA 1FQEA 1N76A 4OEVA 4PE5B 1LLSA 1EYJA 1Y1ZA 4GLIA 4R75A 4LQ5A 1SW5A 3FVOA 3OSQA 3UP9A 4WEPA 1USYH 4TLMB 1TT1A 1JETA 3H6WA 4H67A 1Y3NA 2BJJX 3PGFA 1QVSA 3E78A 4EQBA 5I2NB 1QULA 2WYKA 2RKMA 3U65A 4YU0A 5JTYB 1USYE 1ZIUA 5KDTA 1MQDA 1N0TA 4OANA 2PT2A 5CC2A 2WBDA 3IR1A 4PF6A 3MPKA 4ZEKA 3TCHA 3RPWA 2AL5A 1PDAA 4GL0A 5H8SA 2R6GE 3KG2A 4JVDA 1D9VA 2NUVA 5DVIA 4BDLA 1ZU0A 4XKNA 4F22A 1FPEA 1S7YA 1FBEA 3JYRA 2G93A 1IXIA 5FTHA 4FJPA 4R9GA 1LFIA 4HCWA 1EYIA 4U21A 3G3FA 4BDRA 5H8NB 4JWYA 3E4RA 3PPRA 4LONB 1Z7ME 3MSTA 3S9EA 4KCCA 4L17A 2G29A 1EYKA 4PFRA 1FTJA 1AL3A 2XXWA 3HPIA 3T66A 4NF4A 4PC9A 3PPNA 1R1NA 2YLNA 4BDMA 3OEKA 4ESXA 4AB6A 3UGWA 1AOVA 2DYXA 1O64A 3VXBA 5EYFA 5DTBA 4R74A 4GBVA 3FV2A 4OVQA 1FTAA 5TP9B 2GFEA 4Q8RA 4H8JA 5ICTA 4DE8A 4ONYA 2HQ0A 1T0KA 2GRVA 1DTZA 2OBGA 1MY2A 2I58A 4ELOA 4N6KA 4MH5A 4E0WA 3ILTB 3QXMA 5I58A 2FYIA 3OENA 4P3LA 3MVYA 1BKAA 4KR5A 5ICQA 1YPNA 3D4CA 4PFWA 4QSEA 3FVGA 3BFUA 4K3FA 4ZE8A 2HCAA 4KYEA 5EHMA 4G8NA 1BTJA 3ISPA 4DI3D 3C59A 2Q74A 1B2HA 3TZAA 4C1UA 3SEWA 4OFLA 4H0WA 3FIRA 4YB5A 1N04A 4WKMA 2ESNA 3RUMA 3U94A 1AH5A 1A8FA 2QVUA 2ZNSA 4KD5A 3ZSFA 2B4MA 4LZ5A 4GF8A 1YZ0A 1D9QA 2ZXTA 3GLBA 1MDQA 2DDKA 1B0LA 1TXFA 1B1XA 2NWJA 3F11A 4P56A 2V4CA 1FPGA 1DPPA 1ANFA 3PV0E 4YKIA 4BLAA 3FV1A 3LSFB 2HZLA 2QSXA 2RC7A 1FJ9A 3LUZA 3ZKKA 2JNCA 1S9TA 2VHAA 4FIMA 3G7WA 1US5A 3IB2A 4NX1A 1MY4A 5ITPA 3M3KA 4NHBA 3T22A 4DXUA 1UQWA 2A5SA 5JTYA 4EF2A 3IOTA 4GX3A 4I1DA 2F7CA 3H6TA 4XXUA 4HE0A 2IA4A 4FATA 5CI5A 1FBCA 1MPBA 4P11A 2Q9TA 4N81A 3T0JA 1B6HA 4QFPA 3KN8A 1PBQA 4Q5TA 4H5FA 5H8FB 1OIBA 4FECA 4JSOA 4P1EA 3M3FA 1K9YA 1CE2A 3SETA 1BLFA 3FXRA 3HFUA 5K2YA 4NE4A 3OEMA 3B6TA 3QIMA 1MXVA 1LBCA 4N15A 4G4PA 3EQ1A 1N84A 1MXYA 1FQAA 4ZDMA 2IEEA 4XFEA 3TTMA 4ZEBA 2ABHA 3C35A 4GWYA 2DWIA 4PETA 4ZECA 3TTLA 4O7MA 3MYUA 2XXQA 2O1LA 3WAEA 1R9QA 4MEVA 2I49A 1AIVA 2CZLA 2Q89A 4LZ7A 5ET7A 2X7QA 1GGGA 4PFYA 5I56B 3T9HB 3MBPA 2QL3A 4LN5A 2AL4A 5DEXA 2D3IA 5KCJB 5HBCA 2NOOA 3K00A 4NF8A 2VD2A 1KWHA 3IK6B 4M1VA 1LFHA 1B32A 1LAXA 4DI4B 2V3TA 4YKPA 5AA3A 4G8MA 4PFIA 3ODBA 3O6GA 2H9BA 2I3VA 3PD9A 3TUSA 1M5BA 4MNCA 1SQYA 3FBPA 1B9JA 4O3CA 1II5A 3W9VA 2XXUA 1FPFA 3FXUA 5LTCA 4UA8A 1OLAA 4R6YA 2CZIA 2Q2CA 4GX4A 4RNSA 2CEYA 3PMXA 4PTKA 3K6UA 5EHSA 2H5YA 4LF3C 1VFEA 1LBZA 4EQ7A 4IO2A 4GFRA 1SD3A 5ET5A 4I3YA 2MKZA 4FORA 4O8MA 4KFQA 4P0IA 2Y84A 5KDTB 4G2ZA 4GWXA 3T1BA 3CHGA 2Y7RA 4U1OA 1NNTA 1QUJA 4XKPA 5EQAA 1I6BA 3RQTA 1IMAA 5LDZA 3CVGA 1XC1A 1QW0A 3MJNA 1Q9DA 4ZEFA 1ZTYA 3USDA 2DXRA 4R2FA 4EUOA 3TAJA 1XVYA 1BK4A 3DP4A 2I3WA 1IQ7A 3E9XA 4R6KA 3E13X 3RY3A 2WBBA 4OXVA 3KEIA 4JB7A 4THIA 4Q0CA 5CMBA 5H8FA 3K6XA 2DQVA 4OETA 1QKBA 1N7WA 2P3VA 2O84X 2OWTA 1IMCA 2XHDA 1JEVA 4R9FA 4O3AA 1Q1KA 1B5IA 4YAHX 3TKDA 3THIA 4NF4B 1XS5A 1WVJA 5FHNA 2I4BA 3IX1A 4QSCA 1YTVA 4GIZA 5II0A 4PAKA 3VLWA 1A40A 3MZ9A 4OVJA 4C0RA 1SI1A 2I6EA 4OTEA 1IXHA 2XXRA 2YPNA 1D3KA 2VD3A 1ZMGA 3K2DA 3MP6A 1NKXA 3IJXB 3JZJA 4MAGA 1P1WA 1QUKA 2DSFA 4X1DA 3KJ7A 3RT6B 3Q28A 1OVTA 1B40A 3MZBA 3HSTA 5I58B 4MX6A 1NV4A 5F7VA 4LVQA 3Q25A 4OQOA 3Q29A 4DCYA 3PMVA 1B4ZA 3IO4A 2JJKA 3QUJA 1SYIA 3DP8A 5I56A 2B4LA 2PFZA
chains in the Genus database with same CATH topology
4F1UA 3TODA 1JQFA 3OO8A 4ZZAA 4U1ZA 5AE4A 4ERSA 3H7MA 5LOMA 2QS4A 1RKMA 4RK9A 3N26A 2UVGA 3EF7A 2RC8A 5I59A 3CG1A 2Z8FA 4LUBA 1FTLA 5H8QA 2Y7IA 3K6VA 4U23A 4WEDA 3MVZA 5L9MA 4KPTA 4X1BA 4MLQA 2O1MA 1PEBA 4F2QA 3ILUB 2UVHA 2HAUA 3FD3A 3FJGA 2XX7A 4F2OA 4G68A 5ISUA 2H98A 3G3IA 1MXXA 2V3UA 3SEYA 3UORA 5JEIA 4KYSA 3S2VA 1Y9UA 4ZZEA 3TQWA 2PYYA 1URSA 2Z23A 5K2XA 5F1QA 3U72A 4MBPA 3MQ9A 3HV1A 3PU5A 2VOZA 1SVXB 1NH7A 1ZJLA 4YKKA 3CFZA 2QJEA 2P1SA 4OMBA 3MAMA 2DWJA 3LSXA 4UACA 4GWOA 1H3DA 3DM0A 1UIVA 4OYVA 1IIWA 3M3LA 4JBZA 1A54A 2F97A 2P2AA 3FZVA 3S9NC 1RYXA 2QKHA 4IY6A 4R73A 3OSRA 1ATGA 3H3GA 4NMYA 2I48A 4KHZE 4GL8A 4YKJA 3VE1B 1Y3QA 2ZYMA 4NWCA 2GH9A 2Y7WA 1SYHA 2XXXA 3RT8A 4YICA 1OQGA 3IOUA 2REJA 4IGRA 3UK4A 4RPOA 5DVJA 3KOTA 1SI0A 5DEXB 5DYHA 1B4HA 4GD5A 3SEXA 2O7IA 4NF8B 1ZKBA 3TTRA 1MQHA 1UTHA 3PPOA 1JNFA 2AYSA 4LA9A 5JK4A 4BDOA 3D4GA 1MY0A 3IB0A 1O63A 1MPCA 2QPQA 4ELQA 4LP2B 1MH4A 1Y4CA 2QS2A 5IAIA 3O2AA 1DSNA 4U4XA 1DMBA 2JODA 3ONMA 3FUZA 4DZ1A 4DCXA 3VDFA 1URGA 3PUZE 3BBRA 1MQIA 4HW8A 3L6GA 3C33A 3PD8A 3TCGA 2UXAA 1P99A 3MW0A 3DELB 4E0XA 3T96B 4HS7A 4G8HA 3GZGA 1WDNA 3IJOB 3FVKA 3VVFA 3FASA 4R72A 4DLQA 2F35A 2ONSA 3N6UA 1B46A 3O29A 1H43A 5L8DA 3U93A 4R6HA 5I2KA 4EDPA 4F3GA 4U22A 3SESA 3IAZA 5CBRA 3ZS6A 3B6WA 1FTMA 4N6PA 3PUXE 2F7BA 3AXFA 4YB7A 5CBSA 1N3XA 5ELVA 3S4UA 4FAJA 3VLVA 3FJMA 3H06B 1JW5A 3CR9A 5AA2A 4KYDA 2O69A 4F31B 3LR1A 1B58A 1MPDA 5KZTA 3VLUA 1TWYA 3T9UA 3KN3A 3LBSA 2M8CA 3R6UA 1SW4A 3N6TA 1QJMA 2F34A 4H6DA 3FVNA 3CI8A 2F6PA 3CIJA 2QS1A 3I6VA 3EHSA 1P1NA 4ZEDA 1RYOA 3RN8A 1JVYA 1MQGA 2V25A 5I57A 2GHAA 3OD7A 3U1OA 3KSXA 4RPNA 1N7XA 3OXNA 1H45A 3OMBA 1FTKA 4R2BA 2AIXA 1MG1A 3I5OA 2V3QA 4F39A 3KJTA 1BIYA 1XOCA 3P7IA 3QK6A 2HZKA 5I59B 4IB2A 1YCJA 4JDFA 1EZPA 3V5AA 4RY1A 1EH3A 5H8QB 2VP1A 4GOTA 1HSEA 4IO7A 3RLFE 3MWBA 1UIUA 1NNKA 4ECFA 3LC8A 4JSDA 2UYFA 3VFJA 4FE8A 3N7RA 1A55A 1LB9A 2Q2AA 3A09A 4G68B 1NL5A 1FTOA 5H8HA 4DIGA 4Q30B 3W15C 3KOSA 1IUDA 3IOVA 4BDNA 2HEUA 4PP0A 2RCBA 1VE4A 3TDJA 4MF3A 1MRPA 2E1SA 1ZLQA 4I62A 4RK2A 1JW4A 3O97A 3HCQA 1JEUA 4LZ8A 4EQ9A 1FQFA 1GTKA 2DWAA 4NWDA 3OO6A 3EPEA 2NXOA 3C5TA 2XX8A 4QRZA 4YMBA 3U92A 1B1HA 2Z8EA 4IO6A 2X7PA 2B3FA 5B70A 2DP8A 1L5TA 2RC9A 4I9DA 2H99A 4EXLA 4F29A 1NNFA 1B7UA 4PQJA 4MLVA 1YAEA 3U8QA 4DXCA 3O9PA 2XXIA 4DLOA 5CMKA 1FQBA 1TFAA 3KGCA 4ESWA 3TELA 3QSLA 3B6QA 2YJPA 3MVXA 4KI0E 2UYEA 5TU0A 4JWXA 5ITOA 3TCFA 2DS9A 1IZ1A 2F7AA 1M5FA 2VGQA 3C9HA 2L27A 2D21A 3FGSA 3MUQA 1VSOA 3RGYA 2REGA 1UTHB 4RJZA 1MS7A 2R71A 2DOJA 4G77A 4GQOA 5TPAB 4TQUQ 3VVDA 4XTCQ 3SEVA 4N13A 1PC3A 4FEBA 3MP8A 2Q8JA 3K02A 3V8XB 1POY1 3IORA 1B3EA 3T93B 3GBBA 1XT8A 1LBBA 3I3VA 4JWOA 2HXWA 2DXYA 5CRYA 4OFOA 1BP5A 5HM4B 2XXYA 1M5CA 2XX9A 1DOTA 4NF5A 3KSJA 2Z22A 3EHUA 1U34A 3K6WA 1XVXA 5I2KB 2Q88A 2FA7A 1US4A 4PFTA 2DVZA 1I69A 2RCAA 2QMXA 4NF6A 5AA2D 1IEJA 3IOWA 1MH3A 2O7UA 4F1VA 2F8DA 3SKPA 4OERA 4YMAA 1TFDA 4N07A 4WXJA 2RINA 4G68C 4H8IA 4ZS9A 5AA2B 1PB8A 1HSLA 4POXA 1A99A 3JV9A 4QFKA 1QKAA 5A5XA 3O66A 4FEDA 3W9WA 1J1NA 2LAOA 3LSWA 2OJTA 2A5TA 3DLNA 5FTIA 5AA4B 2H25A 3UIFA 3H03A 3K0VA 4EXKA 3B7DA 3N5LA 3CFXA 3HHGA 3KFMA 1MY1A 3TEPA 1P1QA 2DE3A 4DLDA 1H44A 2QRYA 3C4MA 1B0HA 1NFTA 4H5GA 3CRBA 5I57B 1Y20A 4OESA 1Y3PA 3O6HA 2F78A 2UVIA 4F3BA 3H6UA 3Q26A 1Z7NE 1MM7A 2Y7KA 1B5JA 3K4UA 5DVFA 1LGBC 1SBPA 4QHQA 2PX1A 5IKBA 4F18A 1B7ZA 4QF9A 4OWDA 3PUYE 3G3HA 1SW2A 4RYAA 3A3UA 1GV8A 2I0BA 1UTBA 4HCYA 5TPAA 3M8UA 2DVCA 1A7LA 1ZBMA 2OZZA 4NEDA 2XXHA 3DP6A 3RTFB 4F19A 1FW0A 3PMWA 1Y4TA 4PFUA 5I84A 4H65A 3C31A 3CFLA 3TMGA 3IL1B 1B3LA 4XKQA 2X26A 3C34A 1A8EA 4Z0IA 2B3BA 3H6VA 1MXUA 3UN6A 1CB6A 5CMCA 4Z7EA 3VVEA 5H8HB 2O51A 4P0GA 2ONRA 4GVOA 3A3CA 2OLBA 3IO6A 3OOAA 3HO7A 1P1UA 4XKRA 3KBRA 3LUYA 1D4NA 3TPAA 3SDFA 3SERA 3QYTA 1WODA 2I4CA 2F6GA 4LQ2A 1JW1A 3EN3A 1Y1MA 3S9MC 4HTGA 2DE4A 3K1NA 1H76A 3AQFB 1NMUA 3PUWE 5CMMA 4OENA 1QUIA 1PB9A 4I8CA 1LCFA 4QFOA 3MC2A 4DXBA 3PPPA 2KLFA 3KZGA 5I2NA 1P1OA 5CM6A 1LCTA 1R9LA 1FCKA 3OO7A 2ALUA 2ZYOA 2E0SA 3LSLA 4HJ0A 4POWA 1B7HA 4H1XA 2ZYNA 1LFGA 1OMPA 2OWSA 3TTKA 3FATA 5AA4A 2HFBA 1O7TA 2XXTA 1F9BA 1M5EA 4ZE9A 2XDGA 2R9JA 3MP1A 1IITA 3G3KA 4JXIA 3S9LC 2ZNTA 1FQDA 5L9SA 2CMOA 5M2VA 1NH8A 5H8NA 4OEUA 2PMSA 5J1DA 1DPEA 1MXWA 3V83A 5B7DA 3CSGA 1N3WA 1D9YA 1LB8A 3FXQA 4QSDA 2DWHA 3K1MA 2NVUB 3BFTA 1OLCA 4X9TA 3RTWB 2QMWA 2XXVA 5TP9A 4BDQA 3WAFA 1R6ZA 1I6QA 4YZZA 3G3JA 1Q35A 2FNCA 2O68A 3R26A 4F3PA 2UVJA 4U4SA 3CG3A 3Q27A 1MY3A 3IB1A 4ZEIA 4KQPA 1SDXA 1GVCA 4YB6A 4M4GA 1EZ9A 2PT1A 3VV5A 1MXZA 2Z8DA 3GBAA 4NF5B 1URDA 2PBWA 3MPLA 4ISUA 3PPQA 4OHNA 2JNDA 2Y7PA 1MM6A 4F1YA 4MFIA 3UA8A 3E3KA 4IGTA 4IY5A 3ZKLA 2V84A 2ZMBA 2OCUA 5FHOA 4NF6B 3N94A 1B51A 3MZ1A 2ZNUA 1OVBA 4DDDA 4F3SA 1B3GA 2XD3A 2ONKE 5BWJA 4RXLA 3OO9A 3H4ZA 5AA1A 5A5XB 3SEUA 4ELRA 2B65A 2F36A 1MQJA 1B3HA 1JVXA 2H4IA 3T9XB 4IO4A 1FQCA 2OK2A 1B52A 3N7SA 1I6AA 2A5TB 1S50A 3OELA 4X48A 3C36A 4ELPA 2D5WA 1EZOA 3VXCA 3HHFA 2DE2A 5HPQA 5BUUA 3V89B 1NNPA 2RF1A 1B5HA 5FHMA 3O6IA 4EF1A 1GR2A 1ELJA 3TQLA 3ECRA 4IO5A 3L2JA 1POTA 1MDP1 4GRKA 4TOZA 1DTGA 4XIGQ 4IO3A 2WKYA 1PBPA 3TYHA 1M5DA 3KN7A 2HAVA 4LATA 3TTNA 3IOLA 2F5XA 1HSJA 2ANJA 4OZ9A 3K1PA 1LAFE 4QFLA 3T9VA 3GXAA 2XXPA 3HN0A 4C1TA 4O3BA 3QUFA 1EU8A 3FJ7A 4ZGMA 2QS3A 3L6HA 4GXSB 1UTBB 3RNNA 1B05A 4NTLA 4OFJA 3QAXA 3C32A 5L9OA 2GHBA 1LSTA 4GXAA 1LAHE 4U2RA 2PVUA 3K01A 3TFLA 3CSBA 4RA1A 3R7XA 4QFNA 1PB7A 2I0CA 5KCJA 4AQ4A 1VFDA 2O6AA 3N7PA 5DT6A 3MVWA 3PUVE 1AMFA 1IXCA 1LAGE 4AB5A 3G3GA 1B3FA 1OQHA 1SW1A 4TLLB 1XHYA 2W7YA 1IXGA 2P0SA 2V93A 3O28A 2THIA 4ND9A 1VR5A 3EHTA 2XD2A 2ZYKA 3BKIB 4KCDA 1FQEA 1N76A 4OEVA 4PE5B 1LLSA 1Y1ZA 4GLIA 4R75A 4LQ5A 1SW5A 3FVOA 3OSQA 3UP9A 4WEPA 1USYH 4TLMB 1TT1A 1JETA 3H6WA 4H67A 1Y3NA 2BJJX 3PGFA 1QVSA 4EQBA 5I2NB 1QULA 2RKMA 4YU0A 5JTYB 1USYE 1ZIUA 5KDTA 1MQDA 1N0TA 2PT2A 5CC2A 3IR1A 3MPKA 4ZEKA 3TCHA 3RPWA 2AL5A 1PDAA 4GL0A 5H8SA 2R6GE 3KG2A 1D9VA 2NUVA 5DVIA 4BDLA 1ZU0A 4XKNA 4F22A 1S7YA 3JYRA 5FTHA 2G93A 1IXIA 4FJPA 4R9GA 1LFIA 4HCWA 4U21A 3G3FA 4BDRA 5H8NB 4JWYA 3E4RA 3PPRA 4LONB 1Z7ME 3S9EA 4KCCA 4L17A 2G29A 1FTJA 1AL3A 2XXWA 3HPIA 3T66A 4NF4A 3PPNA 1R1NA 2YLNA 4BDMA 3OEKA 4ESXA 4AB6A 3UGWA 1AOVA 2DYXA 1O64A 3VXBA 5EYFA 5DTBA 4R74A 3FV2A 5TP9B 2GFEA 4Q8RA 4H8JA 5ICTA 4DE8A 4ONYA 2HQ0A 1T0KA 2GRVA 1DTZA 2OBGA 1MY2A 2I58A 4ELOA 4MH5A 4E0WA 3ILTB 3QXMA 5I58A 2FYIA 3OENA 3MVYA 1BKAA 4KR5A 5ICQA 1YPNA 3D4CA 4PFWA 4QSEA 3FVGA 3BFUA 4K3FA 4ZE8A 2HCAA 4KYEA 5EHMA 4G8NA 1BTJA 3C59A 1B2HA 3TZAA 4C1UA 3SEWA 4OFLA 4H0WA 3FIRA 4YB5A 1N04A 4WKMA 2ESNA 3RUMA 3U94A 1AH5A 1A8FA 2ZNSA 4KD5A 3ZSFA 4LZ5A 4GF8A 2ZXTA 3GLBA 1MDQA 1B0LA 1TXFA 1B1XA 2NWJA 3F11A 1DPPA 1ANFA 3PV0E 4YKIA 4BLAA 3FV1A 3LSFB 2HZLA 2QSXA 2RC7A 3ZKKA 2JNCA 1S9TA 2VHAA 4FIMA 3G7WA 1US5A 3IB2A 1MY4A 5ITPA 3M3KA 3T22A 4DXUA 1UQWA 2A5SA 5JTYA 4EF2A 3IOTA 4I1DA 2F7CA 3H6TA 4XXUA 2IA4A 4FATA 5CI5A 1MPBA 4P11A 2Q9TA 1B6HA 4QFPA 3KN8A 1PBQA 4Q5TA 4H5FA 5H8FB 1OIBA 4FECA 4JSOA 3M3FA 1CE2A 3SETA 1BLFA 3FXRA 5K2YA 4NE4A 3OEMA 3B6TA 3QIMA 1MXVA 1LBCA 4G4PA 3EQ1A 1N84A 1MXYA 1FQAA 4ZDMA 2IEEA 3TTMA 4ZEBA 2ABHA 3C35A 2DWIA 4PETA 4ZECA 3TTLA 2XXQA 2O1LA 3WAEA 1R9QA 2I49A 1AIVA 2CZLA 2Q89A 4LZ7A 2X7QA 1GGGA 4PFYA 5I56B 3T9HB 3MBPA 2QL3A 2AL4A 5DEXA 2D3IA 5KCJB 5HBCA 2NOOA 3K00A 4NF8A 2VD2A 1KWHA 3IK6B 4M1VA 1LFHA 1B32A 1LAXA 2V3TA 4YKPA 5AA3A 4G8MA 3ODBA 3O6GA 2H9BA 2I3VA 3PD9A 3TUSA 1M5BA 1SQYA 1B9JA 4O3CA 1II5A 3W9VA 2XXUA 3FXUA 4UA8A 1OLAA 4R6YA 2Q2CA 4RNSA 3PMXA 3K6UA 5EHSA 2H5YA 4LF3C 1VFEA 4EQ7A 4IO2A 4GFRA 1SD3A 4FORA 4P0IA 4KFQA 2Y84A 5KDTB 4G2ZA 2Y7RA 4U1OA 1NNTA 1QUJA 4XKPA 1I6BA 3RQTA 3CVGA 1XC1A 1QW0A 3MJNA 4ZEFA 1ZTYA 3USDA 2DXRA 4R2FA 4EUOA 3TAJA 1XVYA 3DP4A 2I3WA 1IQ7A 3E9XA 4R6KA 3E13X 3RY3A 4OXVA 3KEIA 4JB7A 4THIA 4Q0CA 5CMBA 5H8FA 3K6XA 2DQVA 4OETA 1QKBA 1N7WA 2O84X 2OWTA 2XHDA 1JEVA 4R9FA 4O3AA 1Q1KA 1B5IA 4YAHX 3TKDA 3THIA 4NF4B 1XS5A 1WVJA 5FHNA 2I4BA 3IX1A 4QSCA 1YTVA 4GIZA 5II0A 3VLWA 1A40A 3MZ9A 4OVJA 4C0RA 1SI1A 2I6EA 4OTEA 1IXHA 2XXRA 2YPNA 1D3KA 2VD3A 1ZMGA 3K2DA 3MP6A 1NKXA 3IJXB 3JZJA 1P1WA 1QUKA 2DSFA 4X1DA 3RT6B 3KJ7A 3Q28A 1OVTA 1B40A 3MZBA 3HSTA 5I58B 5F7VA 4LVQA 3Q25A 4OQOA 3Q29A 4DCYA 3PMVA 1B4ZA 3IO4A 3QUJA 1SYIA 3DP8A 5I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1U A;  3TOD A;  1JQF A;  3OO8 A;  4ZZA A;  4U1Z A;  5AE4 A;  4ERS A;  3H7M A;  5LOM A;  2QS4 A;  1RKM A;  4RK9 A;  3N26 A;  2UVG A;  3EF7 A;  2RC8 A;  5I59 A;  3CG1 A;  2Z8F A;  4LUB A;  1FTL A;  5H8Q A;  2Y7I A;  3K6V A;  4U23 A;  4WED A;  3MVZ A;  5L9M A;  4KPT A;  4X1B A;  4MLQ A;  2O1M A;  1PEB A;  4F2Q A;  3ILU B;  2UVH A;  2HAU A;  3FD3 A;  3FJG A;  2XX7 A;  4F2O A;  4G68 A;  5ISU A;  2H98 A;  3G3I A;  1MXX A;  2V3U A;  3SEY A;  3UOR A;  5JEI A;  4KYS A;  3S2V A;  1Y9U A;  4ZZE A;  3TQW A;  2PYY A;  1URS A;  2Z23 A;  5K2X A;  5F1Q A;  3U72 A;  4MBP A;  3MQ9 A;  3HV1 A;  3PU5 A;  2VOZ A;  1SVX B;  1NH7 A;  1ZJL A;  4YKK A;  3CFZ A;  2QJE A;  2P1S A;  4OMB A;  3MAM A;  2DWJ A;  3LSX A;  4UAC A;  4GWO A;  1H3D A;  3DM0 A;  1UIV A;  4OYV A;  1IIW A;  3M3L A;  4JBZ A;  1A54 A;  2F97 A;  2P2A A;  3FZV A;  3S9N C;  1RYX A;  2QKH A;  4IY6 A;  4R73 A;  3OSR A;  1ATG A;  3H3G A;  4NMY A;  2I48 A;  4KHZ E;  4GL8 A;  4YKJ A;  3VE1 B;  1Y3Q A;  2ZYM A;  4NWC A;  2GH9 A;  2Y7W A;  1SYH A;  2XXX A;  3RT8 A;  4YIC A;  1OQG A;  3IOU A;  2REJ A;  4IGR A;  3UK4 A;  4RPO A;  5DVJ A;  3KOT A;  1SI0 A;  5DEX B;  5DYH A;  1B4H A;  4GD5 A;  3SEX A;  2O7I A;  4NF8 B;  1ZKB A;  3TTR A;  1MQH A;  1UTH A;  3PPO A;  1JNF A;  2AYS A;  4LA9 A;  5JK4 A;  4BDO A;  3D4G A;  1MY0 A;  3IB0 A;  1O63 A;  1MPC A;  2QPQ A;  4ELQ A;  4LP2 B;  1MH4 A;  1Y4C A;  2QS2 A;  5IAI A;  3O2A A;  1DSN A;  4U4X A;  1DMB A;  2JOD A;  3ONM A;  3FUZ A;  4DZ1 A;  4DCX A;  3VDF A;  1URG A;  3PUZ E;  3BBR A;  1MQI A;  4HW8 A;  3L6G A;  3C33 A;  3PD8 A;  3TCG A;  2UXA A;  1P99 A;  3MW0 A;  3DEL B;  4E0X A;  3T96 B;  4HS7 A;  4G8H A;  3GZG A;  1WDN A;  3IJO B;  3FVK A;  3VVF A;  3FAS A;  4R72 A;  4DLQ A;  2F35 A;  2ONS A;  3N6U A;  1B46 A;  3O29 A;  1H43 A;  5L8D A;  3U93 A;  4R6H A;  5I2K A;  4EDP A;  4F3G A;  4U22 A;  3SES A;  3IAZ A;  5CBR A;  3ZS6 A;  3B6W A;  1FTM A;  4N6P A;  3PUX E;  2F7B A;  3AXF A;  4YB7 A;  5CBS A;  1N3X A;  5ELV A;  3S4U A;  4FAJ A;  3VLV A;  3FJM A;  3H06 B;  1JW5 A;  3CR9 A;  5AA2 A;  4KYD A;  2O69 A;  4F31 B;  3LR1 A;  1B58 A;  1MPD A;  5KZT A;  3VLU A;  1TWY A;  3T9U A;  3KN3 A;  3LBS A;  2M8C A;  3R6U A;  1SW4 A;  3N6T A;  1QJM A;  2F34 A;  4H6D A;  3FVN A;  3CI8 A;  2F6P A;  3CIJ A;  2QS1 A;  3I6V A;  3EHS A;  1P1N A;  4ZED A;  1RYO A;  3RN8 A;  1JVY A;  1MQG A;  2V25 A;  5I57 A;  2GHA A;  3OD7 A;  3U1O A;  3KSX A;  4RPN A;  1N7X A;  3OXN A;  1H45 A;  3OMB A;  1FTK A;  4R2B A;  2AIX A;  1MG1 A;  3I5O A;  2V3Q A;  4F39 A;  3KJT A;  1BIY A;  1XOC A;  3P7I A;  3QK6 A;  2HZK A;  5I59 B;  4IB2 A;  1YCJ A;  4JDF A;  1EZP A;  3V5A A;  4RY1 A;  1EH3 A;  5H8Q B;  2VP1 A;  4GOT A;  1HSE A;  4IO7 A;  3RLF E;  3MWB A;  1UIU A;  1NNK A;  4ECF A;  3LC8 A;  4JSD A;  2UYF A;  3VFJ A;  4FE8 A;  3N7R A;  1A55 A;  1LB9 A;  2Q2A A;  3A09 A;  4G68 B;  1NL5 A;  1FTO A;  5H8H A;  4DIG A;  4Q30 B;  3W15 C;  3KOS A;  1IUD A;  3IOV A;  4BDN A;  2HEU A;  4PP0 A;  2RCB A;  1VE4 A;  3TDJ A;  4MF3 A;  1MRP A;  2E1S A;  1ZLQ A;  4I62 A;  4RK2 A;  1JW4 A;  3O97 A;  3HCQ A;  1JEU A;  4LZ8 A;  4EQ9 A;  1FQF A;  1GTK A;  2DWA A;  4NWD A;  3OO6 A;  3EPE A;  2NXO A;  3C5T A;  2XX8 A;  4QRZ A;  4YMB A;  3U92 A;  1B1H A;  2Z8E A;  4IO6 A;  2X7P A;  2B3F A;  5B70 A;  2DP8 A;  1L5T A;  2RC9 A;  4I9D A;  2H99 A;  4EXL A;  4F29 A;  1NNF A;  1B7U A;  4PQJ A;  4MLV A;  1YAE A;  3U8Q A;  4DXC A;  3O9P A;  2XXI A;  4DLO A;  5CMK A;  1FQB A;  1TFA A;  3KGC A;  4ESW A;  3TEL A;  3QSL A;  3B6Q A;  2YJP A;  3MVX A;  4KI0 E;  2UYE A;  5TU0 A;  4JWX A;  5ITO A;  3TCF A;  2DS9 A;  1IZ1 A;  2F7A A;  1M5F A;  2VGQ A;  3C9H A;  2L27 A;  2D21 A;  3FGS A;  3MUQ A;  1VSO A;  3RGY A;  2REG A;  1UTH B;  4RJZ A;  1MS7 A;  2R71 A;  2DOJ A;  4G77 A;  4GQO A;  5TPA B;  4TQU Q;  3VVD A;  4XTC Q;  3SEV A;  4N13 A;  1PC3 A;  4FEB A;  3MP8 A;  2Q8J A;  3K02 A;  3V8X B;  1POY 1;  3IOR A;  1B3E A;  3T93 B;  3GBB A;  1XT8 A;  1LBB A;  3I3V A;  4JWO A;  2HXW A;  2DXY A;  5CRY A;  4OFO A;  1BP5 A;  5HM4 B;  2XXY A;  1M5C A;  2XX9 A;  1DOT A;  4NF5 A;  3KSJ A;  2Z22 A;  3EHU A;  1U34 A;  3K6W A;  1XVX A;  5I2K B;  2Q88 A;  2FA7 A;  1US4 A;  4PFT A;  2DVZ A;  1I69 A;  2RCA A;  2QMX A;  4NF6 A;  5AA2 D;  1IEJ A;  3IOW A;  1MH3 A;  2O7U A;  4F1V A;  2F8D A;  3SKP A;  4OER A;  4YMA A;  1TFD A;  4N07 A;  4WXJ A;  2RIN A;  4G68 C;  4H8I A;  4ZS9 A;  5AA2 B;  1PB8 A;  1HSL A;  4POX A;  1A99 A;  3JV9 A;  4QFK A;  1QKA A;  5A5X A;  3O66 A;  4FED A;  3W9W A;  1J1N A;  2LAO A;  3LSW A;  2OJT A;  2A5T A;  3DLN A;  5FTI A;  5AA4 B;  2H25 A;  3UIF A;  3H03 A;  3K0V A;  4EXK A;  3B7D A;  3N5L A;  3CFX A;  3HHG A;  3KFM A;  1MY1 A;  3TEP A;  1P1Q A;  2DE3 A;  4DLD A;  1H44 A;  2QRY A;  3C4M A;  1B0H A;  1NFT A;  4H5G A;  3CRB A;  5I57 B;  1Y20 A;  4OES A;  1Y3P A;  3O6H A;  2F78 A;  2UVI A;  4F3B A;  3H6U A;  3Q26 A;  1Z7N E;  1MM7 A;  2Y7K A;  1B5J A;  3K4U A;  5DVF A;  1LGB C;  1SBP A;  4QHQ A;  2PX1 A;  5IKB A;  4F18 A;  1B7Z A;  4QF9 A;  4OWD A;  3PUY E;  3G3H A;  1SW2 A;  4RYA A;  3A3U A;  1GV8 A;  2I0B A;  1UTB A;  4HCY A;  5TPA A;  3M8U A;  2DVC A;  1A7L A;  1ZBM A;  2OZZ A;  4NED A;  2XXH A;  3DP6 A;  3RTF B;  4F19 A;  1FW0 A;  3PMW A;  1Y4T A;  4PFU A;  5I84 A;  4H65 A;  3C31 A;  3CFL A;  3TMG A;  3IL1 B;  1B3L A;  4XKQ A;  2X26 A;  3C34 A;  1A8E A;  4Z0I A;  2B3B A;  3H6V A;  1MXU A;  3UN6 A;  1CB6 A;  5CMC A;  4Z7E A;  3VVE A;  5H8H B;  2O51 A;  4P0G A;  2ONR A;  4GVO A;  3A3C A;  2OLB A;  3IO6 A;  3OOA A;  3HO7 A;  1P1U A;  4XKR A;  3KBR A;  3LUY A;  1D4N A;  3TPA A;  3SDF A;  3SER A;  3QYT A;  1WOD A;  2I4C A;  2F6G A;  4LQ2 A;  1JW1 A;  3EN3 A;  1Y1M A;  3S9M C;  4HTG A;  2DE4 A;  3K1N A;  1H76 A;  3AQF B;  1NMU A;  3PUW E;  5CMM A;  4OEN A;  1QUI A;  1PB9 A;  4I8C A;  1LCF A;  4QFO A;  3MC2 A;  4DXB A;  3PPP A;  2KLF A;  3KZG A;  5I2N A;  1P1O A;  5CM6 A;  1LCT A;  1R9L A;  1FCK A;  3OO7 A;  2ALU A;  2ZYO A;  2E0S A;  3LSL A;  4HJ0 A;  4POW A;  1B7H A;  4H1X A;  2ZYN A;  1LFG A;  1OMP A;  2OWS A;  3TTK A;  3FAT A;  5AA4 A;  2HFB A;  1O7T A;  2XXT A;  1F9B A;  1M5E A;  4ZE9 A;  2XDG A;  2R9J A;  3MP1 A;  1IIT A;  3G3K A;  4JXI A;  3S9L C;  2ZNT A;  1FQD A;  5L9S A;  2CMO A;  5M2V A;  1NH8 A;  5H8N A;  4OEU A;  2PMS A;  5J1D A;  1DPE A;  1MXW A;  3V83 A;  5B7D A;  3CSG A;  1N3W A;  1D9Y A;  1LB8 A;  3FXQ A;  4QSD A;  2DWH A;  3K1M A;  2NVU B;  3BFT A;  1OLC A;  4X9T A;  3RTW B;  2QMW A;  2XXV A;  5TP9 A;  4BDQ A;  3WAF A;  1R6Z A;  1I6Q A;  4YZZ A;  3G3J A;  1Q35 A;  2FNC A;  2O68 A;  3R26 A;  4F3P A;  2UVJ A;  4U4S A;  3CG3 A;  3Q27 A;  1MY3 A;  3IB1 A;  4ZEI A;  4KQP A;  1SDX A;  1GVC A;  4YB6 A;  4M4G A;  1EZ9 A;  2PT1 A;  3VV5 A;  1MXZ A;  2Z8D A;  3GBA A;  4NF5 B;  1URD A;  2PBW A;  3MPL A;  4ISU A;  3PPQ A;  4OHN A;  2JND A;  2Y7P A;  1MM6 A;  4F1Y A;  4MFI A;  3UA8 A;  3E3K A;  4IGT A;  4IY5 A;  3ZKL A;  2V84 A;  2ZMB A;  2OCU A;  5FHO A;  4NF6 B;  3N94 A;  1B51 A;  3MZ1 A;  2ZNU A;  1OVB A;  4DDD A;  4F3S A;  1B3G A;  2XD3 A;  2ONK E;  5BWJ A;  4RXL A;  3OO9 A;  3H4Z A;  5AA1 A;  5A5X B;  3SEU A;  4ELR A;  2B65 A;  2F36 A;  1MQJ A;  1B3H A;  1JVX A;  2H4I A;  3T9X B;  4IO4 A;  1FQC A;  2OK2 A;  1B52 A;  3N7S A;  1I6A A;  2A5T B;  1S50 A;  3OEL A;  4X48 A;  3C36 A;  4ELP A;  2D5W A;  1EZO A;  3VXC A;  3HHF A;  2DE2 A;  5HPQ A;  5BUU A;  3V89 B;  1NNP A;  2RF1 A;  1B5H A;  5FHM A;  3O6I A;  4EF1 A;  1GR2 A;  1ELJ A;  3TQL A;  3ECR A;  4IO5 A;  3L2J A;  1POT A;  1MDP 1;  4GRK A;  4TOZ A;  1DTG A;  4XIG Q;  4IO3 A;  2WKY A;  1PBP A;  3TYH A;  1M5D A;  3KN7 A;  2HAV A;  4LAT A;  3TTN A;  3IOL A;  2F5X A;  1HSJ A;  2ANJ A;  4OZ9 A;  3K1P A;  1LAF E;  4QFL A;  3T9V A;  3GXA A;  2XXP A;  3HN0 A;  4C1T A;  4O3B A;  3QUF A;  1EU8 A;  3FJ7 A;  4ZGM A;  2QS3 A;  3L6H A;  4GXS B;  1UTB B;  3RNN A;  1B05 A;  4NTL A;  4OFJ A;  3QAX A;  3C32 A;  5L9O A;  2GHB A;  1LST A;  4GXA A;  1LAH E;  4U2R A;  2PVU A;  3K01 A;  3TFL A;  3CSB A;  4RA1 A;  3R7X A;  4QFN A;  1PB7 A;  2I0C A;  5KCJ A;  4AQ4 A;  1VFD A;  2O6A A;  3N7P A;  5DT6 A;  3MVW A;  3PUV E;  1AMF A;  1IXC A;  1LAG E;  4AB5 A;  3G3G A;  1B3F A;  1OQH A;  1SW1 A;  4TLL B;  1XHY A;  2W7Y A;  1IXG A;  2P0S A;  2V93 A;  3O28 A;  2THI A;  4ND9 A;  1VR5 A;  3EHT A;  2XD2 A;  2ZYK A;  3BKI B;  4KCD A;  1FQE A;  1N76 A;  4OEV A;  4PE5 B;  1LLS A;  1Y1Z A;  4GLI A;  4R75 A;  4LQ5 A;  1SW5 A;  3FVO A;  3OSQ A;  3UP9 A;  4WEP A;  1USY H;  4TLM B;  1TT1 A;  1JET A;  3H6W A;  4H67 A;  1Y3N A;  2BJJ X;  3PGF A;  1QVS A;  4EQB A;  5I2N B;  1QUL A;  2RKM A;  4YU0 A;  5JTY B;  1USY E;  1ZIU A;  5KDT A;  1MQD A;  1N0T A;  2PT2 A;  5CC2 A;  3IR1 A;  3MPK A;  4ZEK A;  3TCH A;  3RPW A;  2AL5 A;  1PDA A;  4GL0 A;  5H8S A;  2R6G E;  3KG2 A;  1D9V A;  2NUV A;  5DVI A;  4BDL A;  1ZU0 A;  4XKN A;  4F22 A;  1S7Y A;  3JYR A;  5FTH A;  2G93 A;  1IXI A;  4FJP A;  4R9G A;  1LFI A;  4HCW A;  4U21 A;  3G3F A;  4BDR A;  5H8N B;  4JWY A;  3E4R A;  3PPR A;  4LON B;  1Z7M E;  3S9E A;  4KCC A;  4L17 A;  2G29 A;  1FTJ A;  1AL3 A;  2XXW A;  3HPI A;  3T66 A;  4NF4 A;  3PPN A;  1R1N A;  2YLN A;  4BDM A;  3OEK A;  4ESX A;  4AB6 A;  3UGW A;  1AOV A;  2DYX A;  1O64 A;  3VXB A;  5EYF A;  5DTB A;  4R74 A;  3FV2 A;  5TP9 B;  2GFE A;  4Q8R A;  4H8J A;  5ICT A;  4DE8 A;  4ONY A;  2HQ0 A;  1T0K A;  2GRV A;  1DTZ A;  2OBG A;  1MY2 A;  2I58 A;  4ELO A;  4MH5 A;  4E0W A;  3ILT B;  3QXM A;  5I58 A;  2FYI A;  3OEN A;  3MVY A;  1BKA A;  4KR5 A;  5ICQ A;  1YPN A;  3D4C A;  4PFW A;  4QSE A;  3FVG A;  3BFU A;  4K3F A;  4ZE8 A;  2HCA A;  4KYE A;  5EHM A;  4G8N A;  1BTJ A;  3C59 A;  1B2H A;  3TZA A;  4C1U A;  3SEW A;  4OFL A;  4H0W A;  3FIR A;  4YB5 A;  1N04 A;  4WKM A;  2ESN A;  3RUM A;  3U94 A;  1AH5 A;  1A8F A;  2ZNS A;  4KD5 A;  3ZSF A;  4LZ5 A;  4GF8 A;  2ZXT A;  3GLB A;  1MDQ A;  1B0L A;  1TXF A;  1B1X A;  2NWJ A;  3F11 A;  1DPP A;  1ANF A;  3PV0 E;  4YKI A;  4BLA A;  3FV1 A;  3LSF B;  2HZL A;  2QSX A;  2RC7 A;  3ZKK A;  2JNC A;  1S9T A;  2VHA A;  4FIM A;  3G7W A;  1US5 A;  3IB2 A;  1MY4 A;  5ITP A;  3M3K A;  3T22 A;  4DXU A;  1UQW A;  2A5S A;  5JTY A;  4EF2 A;  3IOT A;  4I1D A;  2F7C A;  3H6T A;  4XXU A;  2IA4 A;  4FAT A;  5CI5 A;  1MPB A;  4P11 A;  2Q9T A;  1B6H A;  4QFP A;  3KN8 A;  1PBQ A;  4Q5T A;  4H5F A;  5H8F B;  1OIB A;  4FEC A;  4JSO A;  3M3F A;  1CE2 A;  3SET A;  1BLF A;  3FXR A;  5K2Y A;  4NE4 A;  3OEM A;  3B6T A;  3QIM A;  1MXV A;  1LBC A;  4G4P A;  3EQ1 A;  1N84 A;  1MXY A;  1FQA A;  4ZDM A;  2IEE A;  3TTM A;  4ZEB A;  2ABH A;  3C35 A;  2DWI A;  4PET A;  4ZEC A;  3TTL A;  2XXQ A;  2O1L A;  3WAE A;  1R9Q A;  2I49 A;  1AIV A;  2CZL A;  2Q89 A;  4LZ7 A;  2X7Q A;  1GGG A;  4PFY A;  5I56 B;  3T9H B;  3MBP A;  2QL3 A;  2AL4 A;  5DEX A;  2D3I A;  5KCJ B;  5HBC A;  2NOO A;  3K00 A;  4NF8 A;  2VD2 A;  1KWH A;  3IK6 B;  4M1V A;  1LFH A;  1B32 A;  1LAX A;  2V3T A;  4YKP A;  5AA3 A;  4G8M A;  3ODB A;  3O6G A;  2H9B A;  2I3V A;  3PD9 A;  3TUS A;  1M5B A;  1SQY A;  1B9J A;  4O3C A;  1II5 A;  3W9V A;  2XXU A;  3FXU A;  4UA8 A;  1OLA A;  4R6Y A;  2Q2C A;  4RNS A;  3PMX A;  3K6U A;  5EHS A;  2H5Y A;  4LF3 C;  1VFE A;  4EQ7 A;  4IO2 A;  4GFR A;  1SD3 A;  4FOR A;  4P0I A;  4KFQ A;  2Y84 A;  5KDT B;  4G2Z A;  2Y7R A;  4U1O A;  1NNT A;  1QUJ A;  4XKP A;  1I6B A;  3RQT A;  3CVG A;  1XC1 A;  1QW0 A;  3MJN A;  4ZEF A;  1ZTY A;  3USD A;  2DXR A;  4R2F A;  4EUO A;  3TAJ A;  1XVY A;  3DP4 A;  2I3W A;  1IQ7 A;  3E9X A;  4R6K A;  3E13 X;  3RY3 A;  4OXV A;  3KEI A;  4JB7 A;  4THI A;  4Q0C A;  5CMB A;  5H8F A;  3K6X A;  2DQV A;  4OET A;  1QKB A;  1N7W A;  2O84 X;  2OWT A;  2XHD A;  1JEV A;  4R9F A;  4O3A A;  1Q1K A;  1B5I A;  4YAH X;  3TKD A;  3THI A;  4NF4 B;  1XS5 A;  1WVJ A;  5FHN A;  2I4B A;  3IX1 A;  4QSC A;  1YTV A;  4GIZ A;  5II0 A;  3VLW A;  1A40 A;  3MZ9 A;  4OVJ A;  4C0R A;  1SI1 A;  2I6E A;  4OTE A;  1IXH A;  2XXR A;  2YPN A;  1D3K A;  2VD3 A;  1ZMG A;  3K2D A;  3MP6 A;  1NKX A;  3IJX B;  3JZJ A;  1P1W A;  1QUK A;  2DSF A;  4X1D A;  3RT6 B;  3KJ7 A;  3Q28 A;  1OVT A;  1B40 A;  3MZB A;  3HST A;  5I58 B;  5F7V A;  4LVQ A;  3Q25 A;  4OQO A;  3Q29 A;  4DCY A;  3PMV A;  1B4Z A;  3IO4 A;  3QUJ A;  1SYI A;  3DP8 A;  5I56 A; 
#chains in the Genus database with same CATH topology
 4F1U A;  3TOD A;  1JQF A;  3OO8 A;  4ZZA A;  2VPO A;  4U1Z A;  5AE4 A;  4ERS A;  1NI9 A;  3H7M A;  5LOM A;  2QS4 A;  1RKM A;  4RK9 A;  3N26 A;  4PGN A;  2UVG A;  1FJ6 A;  3EF7 A;  2FHY A;  2RC8 A;  2HHM A;  5I59 A;  4QBA A;  3CG1 A;  3GYY A;  2Z8F A;  3EKI A;  4LUB A;  1FTL A;  5H8Q A;  2Y7I A;  4N8Y A;  3K6V A;  4U23 A;  4WED A;  3MVZ A;  5L9M A;  2KQZ A;  1IMF A;  4KPT A;  4G61 A;  4X1B A;  4MLQ A;  2O1M A;  1PEB A;  4F2Q A;  4GX6 A;  3ILU B;  2UVH A;  2HAU A;  5A5L A;  3FD3 A;  3FJG A;  2XX7 A;  4F2O A;  4G68 A;  5ISU A;  2H98 A;  3G3I A;  1MXX A;  2V3U A;  3SEY A;  3UOR A;  1FPI A;  5I7I A;  5JEI A;  1FBH A;  4KYS A;  3S2V A;  1Y9U A;  4ZZE A;  3TQW A;  3D1R A;  2PYY A;  1URS A;  2Z23 A;  4AS4 A;  1NUW A;  5K2X A;  4OVR A;  1YYZ A;  3A29 A;  5F1Q A;  3U72 A;  1NV2 A;  4MBP A;  3MQ9 A;  3HV1 A;  3PU5 A;  4P9K A;  2VOZ A;  1SVX B;  1NH7 A;  1ZJL A;  4YKK A;  3CFZ A;  2QJE A;  2P1S A;  4OMB A;  3MAM A;  2DWJ A;  3RPL B;  4OA4 A;  3LSX A;  2CEX A;  1VDW A;  4UAC A;  3BIG A;  4GWO A;  1H3D A;  3DM0 A;  1UIV A;  4OYV A;  1IIW A;  2Y5K A;  2CZH A;  1FPD A;  3M3L A;  4MJO A;  4JBZ A;  1A54 A;  2F97 A;  2P2A A;  3FZV A;  2GQ1 A;  3S9N C;  5T3J A;  1LBW A;  1RYX A;  2L5V A;  4NQ8 A;  2QKH A;  4IY6 A;  4R73 A;  3OSR A;  1ATG A;  3H3G A;  4NMY A;  2I48 A;  2VT5 A;  4KHZ E;  4GL8 A;  4YKJ A;  3VE1 B;  2XA5 A;  1Y3Q A;  3KBZ A;  2ZYM A;  4NWC A;  2GH9 A;  2Y7W A;  4HXV A;  1SYH A;  2XXX A;  4N8G A;  3RT8 A;  4YIC A;  2XWO A;  1OQG A;  3IOU A;  2REJ A;  4IGR A;  3UK4 A;  2P3N A;  4RPO A;  5DVJ A;  1G0I A;  2HPG A;  3KOT A;  1SI0 A;  3NOH A;  5DEX B;  5DYH A;  1FPB A;  1B4H A;  4P47 A;  4GD5 A;  3SEX A;  2O7I A;  4NF8 B;  1ZKB A;  3TTR A;  1MQH A;  1UTH A;  3PPO A;  1JNF A;  2AYS A;  4LA9 A;  1NUX A;  5JK4 A;  3KC1 A;  4BDO A;  3D4G A;  1MY0 A;  3IB0 A;  1O63 A;  1MPC A;  2QPQ A;  4ELQ A;  4LP2 B;  1MH4 A;  4PDH A;  1Y4C A;  2QS2 A;  5IAI A;  3O2A A;  1DSN A;  4U4X A;  1DMB A;  2JOD A;  3ONM A;  3FUZ A;  4DZ1 A;  4DCX A;  3VDF A;  1AWB A;  4NG7 A;  1URG A;  3PUZ E;  3BBR A;  1MQI A;  4HW8 A;  5IZ3 A;  3L6G A;  3C33 A;  3PD8 A;  3TCG A;  2UXA A;  1P99 A;  3MW0 A;  3DEL B;  4E0X A;  3T96 B;  1NV5 A;  4HS7 A;  1SPI A;  4G8H A;  3GZG A;  1WDN A;  3IJO B;  3FVK A;  3VVF A;  3FAS A;  4R72 A;  5I5P A;  4DLQ A;  2F35 A;  2ONS A;  3N6U A;  3SZP A;  1B46 A;  3O29 A;  1H43 A;  5L8D A;  3U93 A;  4R6H A;  4NN3 A;  5I2K A;  4EDP A;  4F3G A;  4U22 A;  3SES A;  3IAZ A;  5CBR A;  3ZS6 A;  4O94 A;  3B6W A;  1FTM A;  4N6P A;  3PUX E;  2F7B A;  3AXF A;  4YB7 A;  5CBS A;  1N3X A;  5ELV A;  3S4U A;  4FAJ A;  3VLV A;  3FJM A;  3H06 B;  1JW5 A;  3CR9 A;  5AA2 A;  4KYD A;  2O69 A;  4F31 B;  3LR1 A;  1B58 A;  1MPD A;  5KZT A;  3VLU A;  1TWY A;  3RPL A;  4JVI A;  3T9U A;  3KN3 A;  3LBS A;  5EQ8 A;  2M8C A;  3R6U A;  1SW4 A;  3N6T A;  1QJM A;  2F34 A;  1FPL A;  4H6D A;  3FVN A;  3CI8 A;  2F6P A;  3CIJ A;  2QS1 A;  3I6V A;  4MNP A;  3EHS A;  1P1N A;  4MIJ A;  5IZZ A;  3B50 A;  4ZED A;  4X04 A;  1RYO A;  3RN8 A;  1JVY A;  1MQG A;  2V25 A;  5I57 A;  2GHA A;  3OD7 A;  3U1O A;  1DK4 A;  2WX9 A;  3KSX A;  4RPN A;  1N7X A;  3OXN A;  1CNQ A;  1H45 A;  3OMB A;  4MHF A;  5DW8 A;  4NAP A;  1FTK A;  4R2B A;  2AIX A;  4XEQ A;  1MG1 A;  3I5O A;  2V3Q A;  4QXD A;  4F39 A;  3KJT A;  1BIY A;  4P1L A;  1XOC A;  3P7I A;  3QK6 A;  2HZK A;  5I59 B;  4P8B A;  4IB2 A;  1YCJ A;  3QMF A;  4JDF A;  1EZP A;  3V5A A;  4RY1 A;  1EH3 A;  5H8Q B;  1RDZ A;  2VP1 A;  4GOT A;  1HSE A;  4IO7 A;  3RLF E;  3MWB A;  1UIU A;  1NNK A;  4ECF A;  3LC8 A;  4JSD A;  2UYF A;  3VFJ A;  4FE8 A;  1LBX A;  3N7R A;  1A55 A;  1LB9 A;  2Q2A A;  3A09 A;  4IR8 A;  4G68 B;  1NL5 A;  1FTO A;  5H8H A;  4DIG A;  4Q30 B;  3W15 C;  5J16 A;  3KOS A;  1IUD A;  1XI6 A;  3IOV A;  4BDN A;  2HEU A;  4PP0 A;  2RCB A;  1VE4 A;  3TDJ A;  4MF3 A;  1LBY A;  1MRP A;  5EQ7 A;  4N4U A;  2E1S A;  1ZLQ A;  4I62 A;  4RK2 A;  1JW4 A;  3O97 A;  3HCQ A;  2WEF A;  1JEU A;  4LZ8 A;  4MMP A;  3E79 A;  4EQ9 A;  1FQF A;  1GTK A;  2DWA A;  4NWD A;  1NV1 A;  3OO6 A;  3EPE A;  3ROJ A;  2NXO A;  3C5T A;  2XX8 A;  4QRZ A;  4YMB A;  3U92 A;  1NUY A;  4O7I A;  1B1H A;  2Z8E A;  1NUZ A;  4IO6 A;  2X7P A;  4PDD A;  2B3F A;  1NV7 A;  3PTY A;  5B70 A;  5FBP A;  2DP8 A;  1L5T A;  2RC9 A;  4I9D A;  2H99 A;  4EXL A;  4F29 A;  1NNF A;  1INP A;  1B7U A;  4PQJ A;  1LEV A;  4MLV A;  1YAE A;  3U8Q A;  4DXC A;  3IFC A;  3FXB A;  1FPK A;  3O9P A;  2XXI A;  4DLO A;  4XF5 A;  5CMK A;  1FQB A;  1TFA A;  3KGC A;  4ESW A;  3TEL A;  1NV6 A;  3QSL A;  2OX3 A;  1DCU A;  2BJI A;  3B6Q A;  2YJP A;  3MVX A;  2XXK A;  4KI0 E;  4PGP A;  2FBP A;  2UYE A;  5TU0 A;  4JWX A;  5ITO A;  3TCF A;  2DS9 A;  1IZ1 A;  1FPJ A;  2F7A A;  1M5F A;  2VGQ A;  5EQ9 A;  3C9H A;  2L27 A;  2D21 A;  1DBZ A;  3FGS A;  3MUQ A;  1VSO A;  3RGY A;  2REG A;  1UTH B;  4RJZ A;  2VPN A;  1MS7 A;  2R71 A;  2DOJ A;  4G77 A;  4GQO A;  5TPA B;  4TQU Q;  3VVD A;  4XTC Q;  3SEV A;  4N13 A;  1PC3 A;  4FEB A;  3MP8 A;  2Q8J A;  3K02 A;  3V8X B;  1POY 1;  3IOR A;  2FIE A;  1B3E A;  3T93 B;  3GBB A;  1XT8 A;  1LBB A;  4H46 A;  3I3V A;  4JWO A;  1IMB A;  2HXW A;  5IM2 A;  2DXY A;  5IZ3 B;  5CRY A;  4OFO A;  4GWU A;  1BP5 A;  5HM4 B;  2XXY A;  1M5C A;  2XX9 A;  1DOT A;  2XWI A;  2Y5L A;  4NF5 A;  3KSJ A;  2Z22 A;  4GWZ A;  3EHU A;  1U34 A;  3K6W A;  4MNI A;  1XVX A;  1NV0 A;  5I2K B;  2FVZ A;  2Q88 A;  2FA7 A;  1US4 A;  4I3E A;  4PFT A;  2DVZ A;  1I69 A;  2RCA A;  2QMX A;  4NF6 A;  5AA2 D;  2KR0 A;  1IEJ A;  3IOW A;  1MH3 A;  2O7U A;  4F1V A;  2F8D A;  3SKP A;  4OER A;  4YMA A;  1TFD A;  4N07 A;  4WXJ A;  2RIN A;  4G68 C;  4H8I A;  4ZS9 A;  5AA2 B;  1PB8 A;  1HSL A;  4POX A;  1A99 A;  3JV9 A;  4QFK A;  1QKA A;  5A5X A;  3O66 A;  4FED A;  3W9W A;  1J1N A;  2LAO A;  1FSA A;  3LSW A;  2OJT A;  2A5T A;  3DLN A;  5FTI A;  5AA4 B;  2H25 A;  3UIF A;  3H03 A;  3K0V A;  4EXK A;  3B7D A;  3N5L A;  3CFX A;  3HHG A;  3KFM A;  1MY1 A;  3TEP A;  1P1Q A;  2DE3 A;  4DLD A;  1H44 A;  2QRY A;  4N6D A;  3C4M A;  4PAI A;  1B0H A;  1NFT A;  4H5G A;  3CRB A;  5I57 B;  1Y20 A;  4OES A;  1Y3P A;  3O6H A;  2F78 A;  2UVI A;  4F3B A;  3H6U A;  4PCD A;  3Q26 A;  1Z7N E;  1MM7 A;  2Y7K A;  1B5J A;  3K4U A;  5DVF A;  1LGB C;  1SBP A;  4QHQ A;  2PX1 A;  5IKB A;  1LBV A;  4F18 A;  1B7Z A;  2FIX A;  4QF9 A;  4OWD A;  3PUY E;  3G3H A;  1SW2 A;  4RYA A;  3A3U A;  1GV8 A;  4AS5 A;  1FBD A;  2I0B A;  1UTB A;  4HCY A;  5TPA A;  3M8U A;  2QFL A;  2DVC A;  1A7L A;  1ZBM A;  2OZZ A;  4NED A;  2XXH A;  3DP6 A;  3RTF B;  4F19 A;  1FW0 A;  2F3B A;  3PMW A;  1Y4T A;  4PFU A;  5I84 A;  4H65 A;  3C31 A;  1IME A;  3CFL A;  3LV0 A;  3TMG A;  1KZ8 A;  3IL1 B;  5ESY A;  1B3L A;  1IMD A;  4XKQ A;  2X26 A;  3C34 A;  1A8E A;  4Z0I A;  2B3B A;  3H6V A;  1MXU A;  3UN6 A;  2F3D A;  1CB6 A;  5CMC A;  4Z7E A;  3VVE A;  5H8H B;  2O51 A;  4P0G A;  2ONR A;  4GWS A;  4GVO A;  3A3C A;  2OLB A;  3IO6 A;  3IFA A;  3OOA A;  4PFB A;  3HO7 A;  1P1U A;  4XKR A;  3KBR A;  3LUY A;  1D4N A;  3TPA A;  3SDF A;  3SER A;  3QYT A;  1WOD A;  2I4C A;  2F6G A;  4LQ2 A;  1JW1 A;  3EN3 A;  1Y1M A;  3S9M C;  4NGU A;  4HTG A;  2DE4 A;  3K1N A;  1H76 A;  4JVC A;  3AQF B;  1NMU A;  3PUW E;  5CMM A;  4OEN A;  1QUI A;  1PB9 A;  4I8C A;  1LCF A;  4QFO A;  1K9Z A;  3MC2 A;  4DXB A;  3PPP A;  2KLF A;  3KZG A;  5I2N A;  1P1O A;  4OVT A;  2ZZW A;  4HE2 A;  5CM6 A;  1LCT A;  1R9L A;  1FCK A;  3OO7 A;  5ET6 A;  2ALU A;  2ZYO A;  2E0S A;  2ZZX A;  3LSL A;  1KA1 A;  4HJ0 A;  4POW A;  1B7H A;  4H1X A;  2ZYN A;  4PF8 A;  1LFG A;  1OMP A;  2OWS A;  3TTK A;  1FBG A;  3FAT A;  5EYH A;  5AA4 A;  2HFB A;  1O7T A;  2XXT A;  1F9B A;  1KA0 A;  1M5E A;  4ZE9 A;  2XDG A;  2R9J A;  3MP1 A;  1IIT A;  3G3K A;  4JXI A;  2PFY A;  3S9L C;  2ZNT A;  1FQD A;  4OVS A;  2XWK A;  5L9S A;  5IZ1 A;  2CMO A;  5M2V A;  1NH8 A;  5H8N A;  4OEU A;  2PMS A;  5J1D A;  1DPE A;  1MXW A;  3V83 A;  5B7D A;  4PE3 A;  4I40 A;  4GWW A;  4HE1 A;  3CSG A;  1N3W A;  1D9Y A;  1LB8 A;  4N17 A;  2PCR A;  3FXQ A;  4QSD A;  2DWH A;  3K1M A;  2NVU B;  3BFT A;  1OLC A;  1JP4 A;  4X9T A;  3RTW B;  2QMW A;  2XXV A;  5ET8 A;  5TP9 A;  4BDQ A;  3B8B A;  3WAF A;  1R6Z A;  1RDY A;  1I6Q A;  4YZZ A;  3G3J A;  1Q35 A;  2FNC A;  2O68 A;  4NF0 A;  3R26 A;  3RYD A;  4F3P A;  1YXI A;  2UVJ A;  4U4S A;  3CG3 A;  3Q27 A;  1MY3 A;  3IB1 A;  4ZEI A;  4KQP A;  1SDX A;  2OWZ A;  1GVC A;  4YB6 A;  4M4G A;  1EZ9 A;  2PT1 A;  3VV5 A;  3KC0 A;  1MXZ A;  2Z8D A;  3GBA A;  4NF5 B;  1URD A;  2PBW A;  3MPL A;  4ISU A;  3PPQ A;  4OHN A;  2JND A;  2Y7P A;  1MM6 A;  4F1Y A;  4MFI A;  3UA8 A;  3E3K A;  4IGT A;  4OVP A;  4IY5 A;  3ZKL A;  2V84 A;  2ZMB A;  2OCU A;  5FHO A;  4NF6 B;  3N94 A;  1B51 A;  3MZ1 A;  5IGA A;  2ZNU A;  4FBP A;  2R8T A;  1OVB A;  4DDD A;  4F3S A;  1B3G A;  2XD3 A;  2CZK A;  2ONK E;  5BWJ A;  4RXL A;  3OO9 A;  3H4Z A;  4PBQ A;  5AA1 A;  5A5X B;  5F24 A;  3SEU A;  4ELR A;  4KXP A;  2B65 A;  1FBP A;  1MQJ A;  2F36 A;  1B3H A;  1JVX A;  2H4I A;  3T9X B;  4IO4 A;  4H45 A;  1FQC A;  2OK2 A;  5I3S A;  1B52 A;  3N7S A;  1I6A A;  2A5T B;  1S50 A;  3OEL A;  4X48 A;  4PBH A;  3C36 A;  4ELP A;  2XWV A;  2D5W A;  1EZO A;  3VXC A;  3HHF A;  2DE2 A;  5HPQ A;  5BUU A;  3V89 B;  1NNP A;  2RF1 A;  1B5H A;  5FHM A;  3O6I A;  4EF1 A;  1GR2 A;  1ELJ A;  3TQL A;  3ECR A;  4IO5 A;  3L2J A;  1POT A;  1MDP 1;  4GRK A;  4TOZ A;  1DTG A;  4XIG Q;  4IO3 A;  2WKY A;  1FRP A;  1PBP A;  3TYH A;  1M5D A;  3KN7 A;  4UAB A;  5EYG A;  2HAV A;  2Q8M A;  4LAT A;  3TTN A;  3IOL A;  2F5X A;  2HXR A;  1HSJ A;  2ANJ A;  4OZ9 A;  1G0H A;  3K1P A;  1LAF E;  4QFL A;  3T9V A;  4MCO A;  3GXA A;  2XXP A;  3HN0 A;  4C1T A;  4O3B A;  3QUF A;  2QVR A;  1EU8 A;  4PAF A;  3FJ7 A;  4ZGM A;  2QS3 A;  3L6H A;  4GXS B;  4X8R A;  1UTB B;  3RNN A;  1B05 A;  4NTL A;  4OFJ A;  2ZZV A;  3QAX A;  3C32 A;  5L9O A;  1FBF A;  2GHB A;  1LST A;  4GXA A;  1LAH E;  1NV3 A;  4N91 A;  4U2R A;  2PVU A;  1QGX A;  3BIH A;  3K01 A;  2WYP A;  3TFL A;  3CSB A;  4RA1 A;  3R7X A;  4QFN A;  1PB7 A;  2I0C A;  5KCJ A;  4AQ4 A;  4GBW A;  1VFD A;  2O6A A;  3N7P A;  5DT6 A;  3MVW A;  3PUV E;  1AMF A;  1IXC A;  1LAG E;  4AB5 A;  2QVV A;  3G3G A;  1B3F A;  1OQH A;  1SW1 A;  4TLL B;  1XHY A;  2W7Y A;  1IXG A;  2P0S A;  2V93 A;  3O28 A;  1RDX A;  2THI A;  4ND9 A;  1VR5 A;  3EHT A;  2XD2 A;  2ZYK A;  3BKI B;  4KCD A;  1FQE A;  1N76 A;  4OEV A;  4PE5 B;  1LLS A;  1EYJ A;  1Y1Z A;  4GLI A;  4R75 A;  4LQ5 A;  1SW5 A;  3FVO A;  3OSQ A;  3UP9 A;  4WEP A;  1USY H;  4TLM B;  1TT1 A;  1JET A;  3H6W A;  4H67 A;  1Y3N A;  2BJJ X;  3PGF A;  1QVS A;  3E78 A;  4EQB A;  5I2N B;  1QUL A;  2WYK A;  2RKM A;  3U65 A;  4YU0 A;  5JTY B;  1USY E;  1ZIU A;  5KDT A;  1MQD A;  1N0T A;  4OAN A;  2PT2 A;  5CC2 A;  2WBD A;  3IR1 A;  4PF6 A;  3MPK A;  4ZEK A;  3TCH A;  3RPW A;  2AL5 A;  1PDA A;  4GL0 A;  5H8S A;  2R6G E;  3KG2 A;  4JVD A;  1D9V A;  2NUV A;  5DVI A;  4BDL A;  1ZU0 A;  4XKN A;  4F22 A;  1FPE A;  1S7Y A;  1FBE A;  3JYR A;  2G93 A;  1IXI A;  5FTH A;  4FJP A;  4R9G A;  1LFI A;  4HCW A;  1EYI A;  4U21 A;  3G3F A;  4BDR A;  5H8N B;  4JWY A;  3E4R A;  3PPR A;  4LON B;  1Z7M E;  3MST A;  3S9E A;  4KCC A;  4L17 A;  2G29 A;  1EYK A;  4PFR A;  1FTJ A;  1AL3 A;  2XXW A;  3HPI A;  3T66 A;  4NF4 A;  4PC9 A;  3PPN A;  1R1N A;  2YLN A;  4BDM A;  3OEK A;  4ESX A;  4AB6 A;  3UGW A;  1AOV A;  2DYX A;  1O64 A;  3VXB A;  5EYF A;  5DTB A;  4R74 A;  4GBV A;  3FV2 A;  4OVQ A;  1FTA A;  5TP9 B;  2GFE A;  4Q8R A;  4H8J A;  5ICT A;  4DE8 A;  4ONY A;  2HQ0 A;  1T0K A;  2GRV A;  1DTZ A;  2OBG A;  1MY2 A;  2I58 A;  4ELO A;  4N6K A;  4MH5 A;  4E0W A;  3ILT B;  3QXM A;  5I58 A;  2FYI A;  3OEN A;  4P3L A;  3MVY A;  1BKA A;  4KR5 A;  5ICQ A;  1YPN A;  3D4C A;  4PFW A;  4QSE A;  3FVG A;  3BFU A;  4K3F A;  4ZE8 A;  2HCA A;  4KYE A;  5EHM A;  4G8N A;  1BTJ A;  3ISP A;  4DI3 D;  3C59 A;  2Q74 A;  1B2H A;  3TZA A;  4C1U A;  3SEW A;  4OFL A;  4H0W A;  3FIR A;  4YB5 A;  1N04 A;  4WKM A;  2ESN A;  3RUM A;  3U94 A;  1AH5 A;  1A8F A;  2QVU A;  2ZNS A;  4KD5 A;  3ZSF A;  2B4M A;  4LZ5 A;  4GF8 A;  1YZ0 A;  1D9Q A;  2ZXT A;  3GLB A;  1MDQ A;  2DDK A;  1B0L A;  1TXF A;  1B1X A;  2NWJ A;  3F11 A;  4P56 A;  2V4C A;  1FPG A;  1DPP A;  1ANF A;  3PV0 E;  4YKI A;  4BLA A;  3FV1 A;  3LSF B;  2HZL A;  2QSX A;  2RC7 A;  1FJ9 A;  3LUZ A;  3ZKK A;  2JNC A;  1S9T A;  2VHA A;  4FIM A;  3G7W A;  1US5 A;  3IB2 A;  4NX1 A;  1MY4 A;  5ITP A;  3M3K A;  4NHB A;  3T22 A;  4DXU A;  1UQW A;  2A5S A;  5JTY A;  4EF2 A;  3IOT A;  4GX3 A;  4I1D A;  2F7C A;  3H6T A;  4XXU A;  4HE0 A;  2IA4 A;  4FAT A;  5CI5 A;  1FBC A;  1MPB A;  4P11 A;  2Q9T A;  4N81 A;  3T0J A;  1B6H A;  4QFP A;  3KN8 A;  1PBQ A;  4Q5T A;  4H5F A;  5H8F B;  1OIB A;  4FEC A;  4JSO A;  4P1E A;  3M3F A;  1K9Y A;  1CE2 A;  3SET A;  1BLF A;  3FXR A;  3HFU A;  5K2Y A;  4NE4 A;  3OEM A;  3B6T A;  3QIM A;  1MXV A;  1LBC A;  4N15 A;  4G4P A;  3EQ1 A;  1N84 A;  1MXY A;  1FQA A;  4ZDM A;  2IEE A;  4XFE A;  3TTM A;  4ZEB A;  2ABH A;  3C35 A;  4GWY A;  2DWI A;  4PET A;  4ZEC A;  3TTL A;  4O7M A;  3MYU A;  2XXQ A;  2O1L A;  3WAE A;  1R9Q A;  4MEV A;  2I49 A;  1AIV A;  2CZL A;  2Q89 A;  4LZ7 A;  5ET7 A;  2X7Q A;  1GGG A;  4PFY A;  5I56 B;  3T9H B;  3MBP A;  2QL3 A;  4LN5 A;  2AL4 A;  5DEX A;  2D3I A;  5KCJ B;  5HBC A;  2NOO A;  3K00 A;  4NF8 A;  2VD2 A;  1KWH A;  3IK6 B;  4M1V A;  1LFH A;  1B32 A;  1LAX A;  4DI4 B;  2V3T A;  4YKP A;  5AA3 A;  4G8M A;  4PFI A;  3ODB A;  3O6G A;  2H9B A;  2I3V A;  3PD9 A;  3TUS A;  1M5B A;  4MNC A;  1SQY A;  3FBP A;  1B9J A;  4O3C A;  1II5 A;  3W9V A;  2XXU A;  1FPF A;  3FXU A;  5LTC A;  4UA8 A;  1OLA A;  4R6Y A;  2CZI A;  2Q2C A;  4GX4 A;  4RNS A;  2CEY A;  3PMX A;  4PTK A;  3K6U A;  5EHS A;  2H5Y A;  4LF3 C;  1VFE A;  1LBZ A;  4EQ7 A;  4IO2 A;  4GFR A;  1SD3 A;  5ET5 A;  4I3Y A;  2MKZ A;  4FOR A;  4O8M A;  4KFQ A;  4P0I A;  2Y84 A;  5KDT B;  4G2Z A;  4GWX A;  3T1B A;  3CHG A;  2Y7R A;  4U1O A;  1NNT A;  1QUJ A;  4XKP A;  5EQA A;  1I6B A;  3RQT A;  1IMA A;  5LDZ A;  3CVG A;  1XC1 A;  1QW0 A;  3MJN A;  1Q9D A;  4ZEF A;  1ZTY A;  3USD A;  2DXR A;  4R2F A;  4EUO A;  3TAJ A;  1XVY A;  1BK4 A;  3DP4 A;  2I3W A;  1IQ7 A;  3E9X A;  4R6K A;  3E13 X;  3RY3 A;  2WBB A;  4OXV A;  3KEI A;  4JB7 A;  4THI A;  4Q0C A;  5CMB A;  5H8F A;  3K6X A;  2DQV A;  4OET A;  1QKB A;  1N7W A;  2P3V A;  2O84 X;  2OWT A;  1IMC A;  2XHD A;  1JEV A;  4R9F A;  4O3A A;  1Q1K A;  1B5I A;  4YAH X;  3TKD A;  3THI A;  4NF4 B;  1XS5 A;  1WVJ A;  5FHN A;  2I4B A;  3IX1 A;  4QSC A;  1YTV A;  4GIZ A;  5II0 A;  4PAK A;  3VLW A;  1A40 A;  3MZ9 A;  4OVJ A;  4C0R A;  1SI1 A;  2I6E A;  4OTE A;  1IXH A;  2XXR A;  2YPN A;  1D3K A;  2VD3 A;  1ZMG A;  3K2D A;  3MP6 A;  1NKX A;  3IJX B;  3JZJ A;  4MAG A;  1P1W A;  1QUK A;  2DSF A;  4X1D A;  3KJ7 A;  3RT6 B;  3Q28 A;  1OVT A;  1B40 A;  3MZB A;  3HST A;  5I58 B;  4MX6 A;  1NV4 A;  5F7V A;  4LVQ A;  3Q25 A;  4OQO A;  3Q29 A;  4DCY A;  3PMV A;  1B4Z A;  3IO4 A;  2JJK A;  3QUJ A;  1SYI A;  3DP8 A;  5I56 A;  2B4L A;  2PFZ A; 
#chains in the Genus database with same CATH homology
 4F1U A;  3TOD A;  1JQF A;  3OO8 A;  4ZZA A;  4U1Z A;  5AE4 A;  4ERS A;  3H7M A;  5LOM A;  2QS4 A;  1RKM A;  4RK9 A;  3N26 A;  2UVG A;  3EF7 A;  2RC8 A;  5I59 A;  3CG1 A;  2Z8F A;  4LUB A;  1FTL A;  5H8Q A;  2Y7I A;  3K6V A;  4U23 A;  4WED A;  3MVZ A;  5L9M A;  4KPT A;  4X1B A;  4MLQ A;  2O1M A;  1PEB A;  4F2Q A;  3ILU B;  2UVH A;  2HAU A;  3FD3 A;  3FJG A;  2XX7 A;  4F2O A;  4G68 A;  5ISU A;  2H98 A;  3G3I A;  1MXX A;  2V3U A;  3SEY A;  3UOR A;  5JEI A;  4KYS A;  3S2V A;  1Y9U A;  4ZZE A;  3TQW A;  2PYY A;  1URS A;  2Z23 A;  5K2X A;  5F1Q A;  3U72 A;  4MBP A;  3MQ9 A;  3HV1 A;  3PU5 A;  2VOZ A;  1SVX B;  1NH7 A;  1ZJL A;  4YKK A;  3CFZ A;  2QJE A;  2P1S A;  4OMB A;  3MAM A;  2DWJ A;  3LSX A;  4UAC A;  4GWO A;  1H3D A;  3DM0 A;  1UIV A;  4OYV A;  1IIW A;  3M3L A;  4JBZ A;  1A54 A;  2F97 A;  2P2A A;  3FZV A;  3S9N C;  1RYX A;  2QKH A;  4IY6 A;  4R73 A;  3OSR A;  1ATG A;  3H3G A;  4NMY A;  2I48 A;  4KHZ E;  4GL8 A;  4YKJ A;  3VE1 B;  1Y3Q A;  2ZYM A;  4NWC A;  2GH9 A;  2Y7W A;  1SYH A;  2XXX A;  3RT8 A;  4YIC A;  1OQG A;  3IOU A;  2REJ A;  4IGR A;  3UK4 A;  4RPO A;  5DVJ A;  3KOT A;  1SI0 A;  5DEX B;  5DYH A;  1B4H A;  4GD5 A;  3SEX A;  2O7I A;  4NF8 B;  1ZKB A;  3TTR A;  1MQH A;  1UTH A;  3PPO A;  1JNF A;  2AYS A;  4LA9 A;  5JK4 A;  4BDO A;  3D4G A;  1MY0 A;  3IB0 A;  1O63 A;  1MPC A;  2QPQ A;  4ELQ A;  4LP2 B;  1MH4 A;  1Y4C A;  2QS2 A;  5IAI A;  3O2A A;  1DSN A;  4U4X A;  1DMB A;  2JOD A;  3ONM A;  3FUZ A;  4DZ1 A;  4DCX A;  3VDF A;  1URG A;  3PUZ E;  3BBR A;  1MQI A;  4HW8 A;  3L6G A;  3C33 A;  3PD8 A;  3TCG A;  2UXA A;  1P99 A;  3MW0 A;  3DEL B;  4E0X A;  3T96 B;  4HS7 A;  4G8H A;  3GZG A;  1WDN A;  3IJO B;  3FVK A;  3VVF A;  3FAS A;  4R72 A;  4DLQ A;  2F35 A;  2ONS A;  3N6U A;  1B46 A;  3O29 A;  1H43 A;  5L8D A;  3U93 A;  4R6H A;  5I2K A;  4EDP A;  4F3G A;  4U22 A;  3SES A;  3IAZ A;  5CBR A;  3ZS6 A;  3B6W A;  1FTM A;  4N6P A;  3PUX E;  2F7B A;  3AXF A;  4YB7 A;  5CBS A;  1N3X A;  5ELV A;  3S4U A;  4FAJ A;  3VLV A;  3FJM A;  3H06 B;  1JW5 A;  3CR9 A;  5AA2 A;  4KYD A;  2O69 A;  4F31 B;  3LR1 A;  1B58 A;  1MPD A;  5KZT A;  3VLU A;  1TWY A;  3T9U A;  3KN3 A;  3LBS A;  2M8C A;  3R6U A;  1SW4 A;  3N6T A;  1QJM A;  2F34 A;  4H6D A;  3FVN A;  3CI8 A;  2F6P A;  3CIJ A;  2QS1 A;  3I6V A;  3EHS A;  1P1N A;  4ZED A;  1RYO A;  3RN8 A;  1JVY A;  1MQG A;  2V25 A;  5I57 A;  2GHA A;  3OD7 A;  3U1O A;  3KSX A;  4RPN A;  1N7X A;  3OXN A;  1H45 A;  3OMB A;  1FTK A;  4R2B A;  2AIX A;  1MG1 A;  3I5O A;  2V3Q A;  4F39 A;  3KJT A;  1BIY A;  1XOC A;  3P7I A;  3QK6 A;  2HZK A;  5I59 B;  4IB2 A;  1YCJ A;  4JDF A;  1EZP A;  3V5A A;  4RY1 A;  1EH3 A;  5H8Q B;  2VP1 A;  4GOT A;  1HSE A;  4IO7 A;  3RLF E;  3MWB A;  1UIU A;  1NNK A;  4ECF A;  3LC8 A;  4JSD A;  2UYF A;  3VFJ A;  4FE8 A;  3N7R A;  1A55 A;  1LB9 A;  2Q2A A;  3A09 A;  4G68 B;  1NL5 A;  1FTO A;  5H8H A;  4DIG A;  4Q30 B;  3W15 C;  3KOS A;  1IUD A;  3IOV A;  4BDN A;  2HEU A;  4PP0 A;  2RCB A;  1VE4 A;  3TDJ A;  4MF3 A;  1MRP A;  2E1S A;  1ZLQ A;  4I62 A;  4RK2 A;  1JW4 A;  3O97 A;  3HCQ A;  1JEU A;  4LZ8 A;  4EQ9 A;  1FQF A;  1GTK A;  2DWA A;  4NWD A;  3OO6 A;  3EPE A;  2NXO A;  3C5T A;  2XX8 A;  4QRZ A;  4YMB A;  3U92 A;  1B1H A;  2Z8E A;  4IO6 A;  2X7P A;  2B3F A;  5B70 A;  2DP8 A;  1L5T A;  2RC9 A;  4I9D A;  2H99 A;  4EXL A;  4F29 A;  1NNF A;  1B7U A;  4PQJ A;  4MLV A;  1YAE A;  3U8Q A;  4DXC A;  3O9P A;  2XXI A;  4DLO A;  5CMK A;  1FQB A;  1TFA A;  3KGC A;  4ESW A;  3TEL A;  3QSL A;  3B6Q A;  2YJP A;  3MVX A;  4KI0 E;  2UYE A;  5TU0 A;  4JWX A;  5ITO A;  3TCF A;  2DS9 A;  1IZ1 A;  2F7A A;  1M5F A;  2VGQ A;  3C9H A;  2L27 A;  2D21 A;  3FGS A;  3MUQ A;  1VSO A;  3RGY A;  2REG A;  1UTH B;  4RJZ A;  1MS7 A;  2R71 A;  2DOJ A;  4G77 A;  4GQO A;  5TPA B;  4TQU Q;  3VVD A;  4XTC Q;  3SEV A;  4N13 A;  1PC3 A;  4FEB A;  3MP8 A;  2Q8J A;  3K02 A;  3V8X B;  1POY 1;  3IOR A;  1B3E A;  3T93 B;  3GBB A;  1XT8 A;  1LBB A;  3I3V A;  4JWO A;  2HXW A;  2DXY A;  5CRY A;  4OFO A;  1BP5 A;  5HM4 B;  2XXY A;  1M5C A;  2XX9 A;  1DOT A;  4NF5 A;  3KSJ A;  2Z22 A;  3EHU A;  1U34 A;  3K6W A;  1XVX A;  5I2K B;  2Q88 A;  2FA7 A;  1US4 A;  4PFT A;  2DVZ A;  1I69 A;  2RCA A;  2QMX A;  4NF6 A;  5AA2 D;  1IEJ A;  3IOW A;  1MH3 A;  2O7U A;  4F1V A;  2F8D A;  3SKP A;  4OER A;  4YMA A;  1TFD A;  4N07 A;  4WXJ A;  2RIN A;  4G68 C;  4H8I A;  4ZS9 A;  5AA2 B;  1PB8 A;  1HSL A;  4POX A;  1A99 A;  3JV9 A;  4QFK A;  1QKA A;  5A5X A;  3O66 A;  4FED A;  3W9W A;  1J1N A;  2LAO A;  3LSW A;  2OJT A;  2A5T A;  3DLN A;  5FTI A;  5AA4 B;  2H25 A;  3UIF A;  3H03 A;  3K0V A;  4EXK A;  3B7D A;  3N5L A;  3CFX A;  3HHG A;  3KFM A;  1MY1 A;  3TEP A;  1P1Q A;  2DE3 A;  4DLD A;  1H44 A;  2QRY A;  3C4M A;  1B0H A;  1NFT A;  4H5G A;  3CRB A;  5I57 B;  1Y20 A;  4OES A;  1Y3P A;  3O6H A;  2F78 A;  2UVI A;  4F3B A;  3H6U A;  3Q26 A;  1Z7N E;  1MM7 A;  2Y7K A;  1B5J A;  3K4U A;  5DVF A;  1LGB C;  1SBP A;  4QHQ A;  2PX1 A;  5IKB A;  4F18 A;  1B7Z A;  4QF9 A;  4OWD A;  3PUY E;  3G3H A;  1SW2 A;  4RYA A;  3A3U A;  1GV8 A;  2I0B A;  1UTB A;  4HCY A;  5TPA A;  3M8U A;  2DVC A;  1A7L A;  1ZBM A;  2OZZ A;  4NED A;  2XXH A;  3DP6 A;  3RTF B;  4F19 A;  1FW0 A;  3PMW A;  1Y4T A;  4PFU A;  5I84 A;  4H65 A;  3C31 A;  3CFL A;  3TMG A;  3IL1 B;  1B3L A;  4XKQ A;  2X26 A;  3C34 A;  1A8E A;  4Z0I A;  2B3B A;  3H6V A;  1MXU A;  3UN6 A;  1CB6 A;  5CMC A;  4Z7E A;  3VVE A;  5H8H B;  2O51 A;  4P0G A;  2ONR A;  4GVO A;  3A3C A;  2OLB A;  3IO6 A;  3OOA A;  3HO7 A;  1P1U A;  4XKR A;  3KBR A;  3LUY A;  1D4N A;  3TPA A;  3SDF A;  3SER A;  3QYT A;  1WOD A;  2I4C A;  2F6G A;  4LQ2 A;  1JW1 A;  3EN3 A;  1Y1M A;  3S9M C;  4HTG A;  2DE4 A;  3K1N A;  1H76 A;  3AQF B;  1NMU A;  3PUW E;  5CMM A;  4OEN A;  1QUI A;  1PB9 A;  4I8C A;  1LCF A;  4QFO A;  3MC2 A;  4DXB A;  3PPP A;  2KLF A;  3KZG A;  5I2N A;  1P1O A;  5CM6 A;  1LCT A;  1R9L A;  1FCK A;  3OO7 A;  2ALU A;  2ZYO A;  2E0S A;  3LSL A;  4HJ0 A;  4POW A;  1B7H A;  4H1X A;  2ZYN A;  1LFG A;  1OMP A;  2OWS A;  3TTK A;  3FAT A;  5AA4 A;  2HFB A;  1O7T A;  2XXT A;  1F9B A;  1M5E A;  4ZE9 A;  2XDG A;  2R9J A;  3MP1 A;  1IIT A;  3G3K A;  4JXI A;  3S9L C;  2ZNT A;  1FQD A;  5L9S A;  2CMO A;  5M2V A;  1NH8 A;  5H8N A;  4OEU A;  2PMS A;  5J1D A;  1DPE A;  1MXW A;  3V83 A;  5B7D A;  3CSG A;  1N3W A;  1D9Y A;  1LB8 A;  3FXQ A;  4QSD A;  2DWH A;  3K1M A;  2NVU B;  3BFT A;  1OLC A;  4X9T A;  3RTW B;  2QMW A;  2XXV A;  5TP9 A;  4BDQ A;  3WAF A;  1R6Z A;  1I6Q A;  4YZZ A;  3G3J A;  1Q35 A;  2FNC A;  2O68 A;  3R26 A;  4F3P A;  2UVJ A;  4U4S A;  3CG3 A;  3Q27 A;  1MY3 A;  3IB1 A;  4ZEI A;  4KQP A;  1SDX A;  1GVC A;  4YB6 A;  4M4G A;  1EZ9 A;  2PT1 A;  3VV5 A;  1MXZ A;  2Z8D A;  3GBA A;  4NF5 B;  1URD A;  2PBW A;  3MPL A;  4ISU A;  3PPQ A;  4OHN A;  2JND A;  2Y7P A;  1MM6 A;  4F1Y A;  4MFI A;  3UA8 A;  3E3K A;  4IGT A;  4IY5 A;  3ZKL A;  2V84 A;  2ZMB A;  2OCU A;  5FHO A;  4NF6 B;  3N94 A;  1B51 A;  3MZ1 A;  2ZNU A;  1OVB A;  4DDD A;  4F3S A;  1B3G A;  2XD3 A;  2ONK E;  5BWJ A;  4RXL A;  3OO9 A;  3H4Z A;  5AA1 A;  5A5X B;  3SEU A;  4ELR A;  2B65 A;  2F36 A;  1MQJ A;  1B3H A;  1JVX A;  2H4I A;  3T9X B;  4IO4 A;  1FQC A;  2OK2 A;  1B52 A;  3N7S A;  1I6A A;  2A5T B;  1S50 A;  3OEL A;  4X48 A;  3C36 A;  4ELP A;  2D5W A;  1EZO A;  3VXC A;  3HHF A;  2DE2 A;  5HPQ A;  5BUU A;  3V89 B;  1NNP A;  2RF1 A;  1B5H A;  5FHM A;  3O6I A;  4EF1 A;  1GR2 A;  1ELJ A;  3TQL A;  3ECR A;  4IO5 A;  3L2J A;  1POT A;  1MDP 1;  4GRK A;  4TOZ A;  1DTG A;  4XIG Q;  4IO3 A;  2WKY A;  1PBP A;  3TYH A;  1M5D A;  3KN7 A;  2HAV A;  4LAT A;  3TTN A;  3IOL A;  2F5X A;  1HSJ A;  2ANJ A;  4OZ9 A;  3K1P A;  1LAF E;  4QFL A;  3T9V A;  3GXA A;  2XXP A;  3HN0 A;  4C1T A;  4O3B A;  3QUF A;  1EU8 A;  3FJ7 A;  4ZGM A;  2QS3 A;  3L6H A;  4GXS B;  1UTB B;  3RNN A;  1B05 A;  4NTL A;  4OFJ A;  3QAX A;  3C32 A;  5L9O A;  2GHB A;  1LST A;  4GXA A;  1LAH E;  4U2R A;  2PVU A;  3K01 A;  3TFL A;  3CSB A;  4RA1 A;  3R7X A;  4QFN A;  1PB7 A;  2I0C A;  5KCJ A;  4AQ4 A;  1VFD A;  2O6A A;  3N7P A;  5DT6 A;  3MVW A;  3PUV E;  1AMF A;  1IXC A;  1LAG E;  4AB5 A;  3G3G A;  1B3F A;  1OQH A;  1SW1 A;  4TLL B;  1XHY A;  2W7Y A;  1IXG A;  2P0S A;  2V93 A;  3O28 A;  2THI A;  4ND9 A;  1VR5 A;  3EHT A;  2XD2 A;  2ZYK A;  3BKI B;  4KCD A;  1FQE A;  1N76 A;  4OEV A;  4PE5 B;  1LLS A;  1Y1Z A;  4GLI A;  4R75 A;  4LQ5 A;  1SW5 A;  3FVO A;  3OSQ A;  3UP9 A;  4WEP A;  1USY H;  4TLM B;  1TT1 A;  1JET A;  3H6W A;  4H67 A;  1Y3N A;  2BJJ X;  3PGF A;  1QVS A;  4EQB A;  5I2N B;  1QUL A;  2RKM A;  4YU0 A;  5JTY B;  1USY E;  1ZIU A;  5KDT A;  1MQD A;  1N0T A;  2PT2 A;  5CC2 A;  3IR1 A;  3MPK A;  4ZEK A;  3TCH A;  3RPW A;  2AL5 A;  1PDA A;  4GL0 A;  5H8S A;  2R6G E;  3KG2 A;  1D9V A;  2NUV A;  5DVI A;  4BDL A;  1ZU0 A;  4XKN A;  4F22 A;  1S7Y A;  3JYR A;  5FTH A;  2G93 A;  1IXI A;  4FJP A;  4R9G A;  1LFI A;  4HCW A;  4U21 A;  3G3F A;  4BDR A;  5H8N B;  4JWY A;  3E4R A;  3PPR A;  4LON B;  1Z7M E;  3S9E A;  4KCC A;  4L17 A;  2G29 A;  1FTJ A;  1AL3 A;  2XXW A;  3HPI A;  3T66 A;  4NF4 A;  3PPN A;  1R1N A;  2YLN A;  4BDM A;  3OEK A;  4ESX A;  4AB6 A;  3UGW A;  1AOV A;  2DYX A;  1O64 A;  3VXB A;  5EYF A;  5DTB A;  4R74 A;  3FV2 A;  5TP9 B;  2GFE A;  4Q8R A;  4H8J A;  5ICT A;  4DE8 A;  4ONY A;  2HQ0 A;  1T0K A;  2GRV A;  1DTZ A;  2OBG A;  1MY2 A;  2I58 A;  4ELO A;  4MH5 A;  4E0W A;  3ILT B;  3QXM A;  5I58 A;  2FYI A;  3OEN A;  3MVY A;  1BKA A;  4KR5 A;  5ICQ A;  1YPN A;  3D4C A;  4PFW A;  4QSE A;  3FVG A;  3BFU A;  4K3F A;  4ZE8 A;  2HCA A;  4KYE A;  5EHM A;  4G8N A;  1BTJ A;  3C59 A;  1B2H A;  3TZA A;  4C1U A;  3SEW A;  4OFL A;  4H0W A;  3FIR A;  4YB5 A;  1N04 A;  4WKM A;  2ESN A;  3RUM A;  3U94 A;  1AH5 A;  1A8F A;  2ZNS A;  4KD5 A;  3ZSF A;  4LZ5 A;  4GF8 A;  2ZXT A;  3GLB A;  1MDQ A;  1B0L A;  1TXF A;  1B1X A;  2NWJ A;  3F11 A;  1DPP A;  1ANF A;  3PV0 E;  4YKI A;  4BLA A;  3FV1 A;  3LSF B;  2HZL A;  2QSX A;  2RC7 A;  3ZKK A;  2JNC A;  1S9T A;  2VHA A;  4FIM A;  3G7W A;  1US5 A;  3IB2 A;  1MY4 A;  5ITP A;  3M3K A;  3T22 A;  4DXU A;  1UQW A;  2A5S A;  5JTY A;  4EF2 A;  3IOT A;  4I1D A;  2F7C A;  3H6T A;  4XXU A;  2IA4 A;  4FAT A;  5CI5 A;  1MPB A;  4P11 A;  2Q9T A;  1B6H A;  4QFP A;  3KN8 A;  1PBQ A;  4Q5T A;  4H5F A;  5H8F B;  1OIB A;  4FEC A;  4JSO A;  3M3F A;  1CE2 A;  3SET A;  1BLF A;  3FXR A;  5K2Y A;  4NE4 A;  3OEM A;  3B6T A;  3QIM A;  1MXV A;  1LBC A;  4G4P A;  3EQ1 A;  1N84 A;  1MXY A;  1FQA A;  4ZDM A;  2IEE A;  3TTM A;  4ZEB A;  2ABH A;  3C35 A;  2DWI A;  4PET A;  4ZEC A;  3TTL A;  2XXQ A;  2O1L A;  3WAE A;  1R9Q A;  2I49 A;  1AIV A;  2CZL A;  2Q89 A;  4LZ7 A;  2X7Q A;  1GGG A;  4PFY A;  5I56 B;  3T9H B;  3MBP A;  2QL3 A;  2AL4 A;  5DEX A;  2D3I A;  5KCJ B;  5HBC A;  2NOO A;  3K00 A;  4NF8 A;  2VD2 A;  1KWH A;  3IK6 B;  4M1V A;  1LFH A;  1B32 A;  1LAX A;  2V3T A;  4YKP A;  5AA3 A;  4G8M A;  3ODB A;  3O6G A;  2H9B A;  2I3V A;  3PD9 A;  3TUS A;  1M5B A;  1SQY A;  1B9J A;  4O3C A;  1II5 A;  3W9V A;  2XXU A;  3FXU A;  4UA8 A;  1OLA A;  4R6Y A;  2Q2C A;  4RNS A;  3PMX A;  3K6U A;  5EHS A;  2H5Y A;  4LF3 C;  1VFE A;  4EQ7 A;  4IO2 A;  4GFR A;  1SD3 A;  4FOR A;  4P0I A;  4KFQ A;  2Y84 A;  5KDT B;  4G2Z A;  2Y7R A;  4U1O A;  1NNT A;  1QUJ A;  4XKP A;  1I6B A;  3RQT A;  3CVG A;  1XC1 A;  1QW0 A;  3MJN A;  4ZEF A;  1ZTY A;  3USD A;  2DXR A;  4R2F A;  4EUO A;  3TAJ A;  1XVY A;  3DP4 A;  2I3W A;  1IQ7 A;  3E9X A;  4R6K A;  3E13 X;  3RY3 A;  4OXV A;  3KEI A;  4JB7 A;  4THI A;  4Q0C A;  5CMB A;  5H8F A;  3K6X A;  2DQV A;  4OET A;  1QKB A;  1N7W A;  2O84 X;  2OWT A;  2XHD A;  1JEV A;  4R9F A;  4O3A A;  1Q1K A;  1B5I A;  4YAH X;  3TKD A;  3THI A;  4NF4 B;  1XS5 A;  1WVJ A;  5FHN A;  2I4B A;  3IX1 A;  4QSC A;  1YTV A;  4GIZ A;  5II0 A;  3VLW A;  1A40 A;  3MZ9 A;  4OVJ A;  4C0R A;  1SI1 A;  2I6E A;  4OTE A;  1IXH A;  2XXR A;  2YPN A;  1D3K A;  2VD3 A;  1ZMG A;  3K2D A;  3MP6 A;  1NKX A;  3IJX B;  3JZJ A;  1P1W A;  1QUK A;  2DSF A;  4X1D A;  3RT6 B;  3KJ7 A;  3Q28 A;  1OVT A;  1B40 A;  3MZB A;  3HST A;  5I58 B;  5F7V A;  4LVQ A;  3Q25 A;  4OQO A;  3Q29 A;  4DCY A;  3PMV A;  1B4Z A;  3IO4 A;  3QUJ A;  1SYI A;  3DP8 A;  5I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...