3EHSA

Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1)
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
457
structure length
457
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFSLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords fusion protein of CRFR1 extracellular domain and MBP
publication title Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1.
pubmed doi rcsb
source organism Escherichia coli
total genus 131
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehsA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehsA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3ehsA03
3KOSA 4QFLA 2DYXA 3SESA 1FQCA 4G8HA 3QAXA 3VLUA 4UACA 3GLBA 3F11A 5KCJB 3VFJA 3PUXE 3Q25A 3CFZA 1B3HA 1MQJA 3FD3A 1JW5A 1FQFA 4ZE8A 4RNSA 1FTMA 2Z8FA 4JB7A 3O9PA 1CB6A 2DXRA 4KPTA 5EYFA 2XXXA 3H7MA 3FVNA 4EF1A 1M5EA 1IIWA 1KWHA 3T9HB 1XC1A 1R9QA 3HHGA 4RY1A 3PGFA 3D4CA 4EQ9A 1Y1ZA 5DTBA 3MVXA 5B7DA 3IB1A 3O29A 3KSJA 4YB7A 3AQFB 1A8EA 5L8DA 4TOZA 3IOUA 3O6IA 2E1SA 1JW1A 5FTIA 2RCBA 1MQIA 1LSTA 4OHNA 4F3GA 4BDRA 3B6WA 1RKMA 4ZECA 1P1WA 2AL4A 4RA1A 2VOZA 4OYVA 2VHAA 4U2RA 4NE4A 2ANJA 3N6TA 3TODA 4OQOA 1MXUA 4IB2A 4JDFA 1B4ZA 2XXPA 4OESA 3HHFA 4OEUA 5AA2A 5DEXB 2V3UA 1MS7A 1WDNA 1M5FA 4ZEBA 3C5TA 1H45A 2Z8EA 3G3HA 3IR1A 1QW0A 4XKRA 5I56B 1MM6A 1B51A 3KG2A 4IO5A 3K1NA 4KFQA 2X7PA 4I8CA 5F7VA 4RK9A 3Q29A 1URDA 1EU8A 3TTNA 2ZYKA 2OCUA 1GVCA 3A3UA 3IOLA 3RT8A 4H0WA 3OO9A 2DE3A 1R6ZA 1MXYA 3G3FA 3V8XB 2OWSA 2ONKE 1MRPA 1URSA 5JEIA 5H8FA 1OQHA 2DVZA 5L9MA 5BWJA 3GBBA 3B7DA 4U1OA 1OLCA 3TELA 3W9VA 3MJNA 4OENA 5CMCA 2XHDA 3OOAA 1JNFA 3MPKA 3IOVA 4FATA 4TLLB 4R72A 1B6HA 2CZLA 2OZZA 4BLAA 2D5WA 5ELVA 1A55A 2O6AA 1P99A 1US4A 3CRBA 1AH5A 3K6VA 4U1ZA 2NOOA 1J1NA 1I6AA 3R6UA 2PX1A 4PFYA 4XIGQ 3H6TA 4U22A 3IO6A 1LGBC 2RF1A 4O3AA 4F2QA 3T66A 2I4BA 1SYHA 3FJGA 3RTWB 4GVOA 1P1NA 1UIVA 2I58A 1A8FA 3PUZE 2WKYA 5CBRA 1B1XA 3UP9A 1B3FA 4MLQA 1POTA 1B3EA 2UVJA 4GFRA 5AA2B 4MLVA 1YCJA 3KEIA 3IB2A 4PE5B 2THIA 4U4XA 2PBWA 4YMBA 4ECFA 2ZYOA 1QKBA 5I57A 3L2JA 3TCGA 3N94A 3H6VA 2Q89A 1HSJA 3HO7A 4DZ1A 3OO8A 4DE8A 3S9NC 4GXAA 2R71A 4NEDA 5I58A 1DMBA 3H06B 1UTHA 4Q0CA 4ESWA 2HXWA 1PBPA 2UVGA 4NWCA 3GXAA 4KQPA 3RQTA 1ZKBA 3MPLA 3TDJA 2LAOA 3FJMA 5AA3A 2D21A 4R9GA 3FVGA 3TQWA 2DOJA 3K4UA 2YLNA 1QUKA 3SEWA 3SETA 4NF5A 2F97A 1I6BA 1ATGA 3K1PA 3PUVE 5I2NA 3E3KA 1DOTA 3N7RA 4KD5A 4X9TA 3FGSA 4HW8A 1B46A 4TLMB 3OO7A 1O64A 3PPQA 3PMXA 5AE4A 3TTMA 3IB0A 3KJ7A 3M3LA 4JSDA 4OFOA 5HBCA 3ZSFA 4YZZA 5FTHA 1VFDA 1MDP1 3CR9A 3BBRA 3Q26A 1FQAA 1YPNA 2REGA 4ZEDA 4QRZA 2OWTA 4G68A 1A99A 1B9JA 2V3QA 3H6WA 2P2AA 1AL3A 5KZTA 3CFXA 3EF7A 2XXYA 3PD9A 5KCJA 3RY3A 4O3BA 3IAZA 2XXQA 1GGGA 3T96B 4ISUA 3KOTA 4M1VA 4KCCA 3L6GA 1OMPA 3HV1A 3VVEA 1B05A 4THIA 3WAFA 3U1OA 1XT8A 3MP1A 5DVJA 1Y20A 3G3IA 3W15C 2UYEA 4R6KA 1S50A 2XX8A 4L17A 4OFJA 2UVHA 3IO4A 4F1UA 5JTYA 3MZBA 4LP2B 3KFMA 2ESNA 3R26A 1MM7A 4LONB 1H44A 1RYOA 5ISUA 3U72A 1UTHB 3W9WA 4LF3C 2RC7A 2I48A 1MDQA 1ELJA 3WAEA 5H8QB 1XS5A 1H43A 4YMAA 3OMBA 4XKQA 2I0BA 3SEUA 4XKNA 4O3CA 2VD2A 1LCTA 2XXRA 4H5FA 3K00A 2Q2AA 2F34A 3MAMA 2F6PA 3OSRA 1JVXA 3BFTA 2HQ0A 3C33A 3DP4A 3RGYA 4EXKA 3OENA 1Q1KA 3MBPA 1FTLA 2NXOA 5CRYA 5TU0A 2XXUA 1I69A 3R7XA 4G4PA 2DWAA 2O69A 5IKBA 4ZEKA 3TZAA 4AB6A 3S2VA 4OEVA 2RC9A 1FW0A 2I3WA 5AA1A 1DTZA 4XXUA 3KJTA 4OXVA 1PEBA 2D3IA 4G8MA 1B58A 2QS3A 1GV8A 4DDDA 3O6GA 4FORA 1MH3A 2DP8A 2JODA 2B3BA 2RCAA 1B3GA 4FIMA 4Q30B 1MPCA 1FQDA 5J1DA 4TQUQ 1YAEA 1TFDA 3OSQA 4F3BA 2HEUA 4G2ZA 3TYHA 4G68C 3FUZA 4LZ8A 1Y4TA 3DM0A 1JEVA 4F39A 5F1QA 2RINA 3C35A 3LSLA 1TFAA 2YPNA 3M8UA 3K6UA 2AIXA 3KN8A 2XXHA 2E0SA 3LSWA 3B6TA 1D4NA 3LSXA 3FV2A 3TCFA 5JTYB 1MH4A 1SVXB 4YKPA 1ZU0A 2ZMBA 4RK2A 1B0LA 4ZEIA 2V3TA 3USDA 3FJ7A 1N3WA 4HJ0A 2QMXA 5TPAB 1WVJA 2X26A 3HCQA 2BJJX 4IO4A 4F19A 4RPOA 4U21A 4IY5A 4I62A 4PETA 3PPPA 1DPEA 3MZ1A 3EHUA 2XD2A 3ONMA 1IXHA 2O84X 4KCDA 5LOMA 3M3FA 1USYE 4KR5A 4MF3A 1WODA 4F3SA 3MWBA 2ABHA 3CIJA 3G7WA 3UIFA 2Y7WA 4R2FA 1B5IA 2Y7IA 1N7XA 4R73A 4U4SA 1BIYA 3T93B 1OLAA 4H8IA 4QHQA 4ZZEA 4C1TA 1OQGA 2F35A 4NF6A 3PUWE 4GL0A 4YKJA 4BDLA 1POY1 2A5TB 3SEXA 1B3LA 2ZNTA 1LB9A 4C0RA 4X1BA 4YKIA 2DXYA 4R75A 1MQHA 5EHSA 4YB6A 2HZLA 4FEBA 2DWIA 5H8NA 4N6PA 1XOCA 1QVSA 1NNKA 4RPNA 4UA8A 2F78A 3SKPA 1NNTA 4BDOA 4Q8RA 1PB9A 2DWJA 2X7QA 4MBPA 4HCWA 3OELA 2GFEA 3PV0E 2DWHA 1FQBA 4ZS9A 5H8SA 5EHMA 4QFKA 2HAVA 4MFIA 2QKHA 2W7YA 1YTVA 1MY4A 4IO6A 3C9HA 2QSXA 2QJEA 3OEKA 1NH8A 3T22A 1OVTA 1O63A 4N13A 1EH3A 4P0GA 4R6YA 4JWXA 4OVJA 1H3DA 4OFLA 4POXA 1IZ1A 1JW4A 2ZYNA 4QFOA 3TCHA 3C36A 3IL1B 2JNCA 1NFTA 3EPEA 1IXGA 3K1MA 4ZEFA 3T9VA 1N0TA 4X48A 4QFPA 1T0KA 1BTJA 3C59A 2Q9TA 1Y3NA 3T9UA 4I1DA 3QYTA 3O6HA 4G77A 4RYAA 1MY1A 4H8JA 3BFUA 1PB8A 3IOTA 1UIUA 2RC8A 4QFNA 3MP6A 5ITOA 1SDXA 1SYIA 2F36A 4GD5A 1M5DA 2XXIA 2FA7A 2QMWA 1ZMGA 4IY6A 5JK4A 2FYIA 3VVDA 5B70A 1EZPA 5ICQA 2B65A 4ERSA 4NF6B 4FJPA 3BKIB 3PMWA 5H8QA 2REJA 2AYSA 1LFGA 5L9OA 2R9JA 1IUDA 3TPAA 1LBCA 4EUOA 1B7UA 3M3KA 3TTRA 1EZ9A 4OMBA 4FEDA 4R2BA 4IGRA 1ANFA 1SW4A 4ELRA 1LAXA 1ZJLA 1ZIUA 4FAJA 1XVXA 5H8NB 1JVYA 3TAJA 2KLFA 1ZLQA 1SW2A 3OXNA 1Z7NE 3VXBA 3N6UA 1D9VA 5M2VA 2O7IA 4JBZA 2PVUA 3S9EA 3A09A 2Y7KA 3CI8A 3GZGA 3U8QA 1B5JA 5AA4A 1FTKA 4F1VA 1Y3PA 4DIGA 1FCKA 1QULA 3FIRA 2A5SA 3MC2A 4ESXA 2OK2A 2JNDA 5CMKA 1IITA 3VDFA 1VFEA 4M4GA 1JETA 2F5XA 2B3FA 2QRYA 4POWA 4F2OA 1B5HA 4XKPA 1P1UA 3U93A 1SW1A 3FASA 1B1HA 4R6HA 1MY2A 3EHSA 1B40A 1N84A 4DLQA 1JEUA 1MXXA 1LLSA 4GF8A 3I6VA 4KYSA 2UXAA 4QSDA 1IXIA 4DLOA 4P11A 3IJXB 4F18A 1HSEA 3GBAA 5CI5A 3PU5A 1M5BA 3KBRA 1NL5A 3DP8A 4NF4B 2I6EA 3JYRA 4EQ7A 3THIA 3SEYA 3N26A 3TTLA 4E0WA 2DE4A 2GH9A 5AA2D 2HCAA 1PBQA 1N3XA 5TPAA 1GR2A 2Z8DA 1P1OA 2ZNSA 1USYH 3KSXA 4Z7EA 1B2HA 5I2KA 2HAUA 2ZYMA 4ZZAA 3UORA 2O68A 5FHOA 4ONYA 1GTKA 1MXVA 4GLIA 2Q8JA 4FE8A 4KYEA 5L9SA 2VP1A 3E9XA 4OWDA 4NF8B 3H6UA 3QK6A 3FATA 3LC8A 2NWJA 4C1UA 3RT6B 3V89B 2Z22A 3MVYA 4PFUA 3IK6B 3C32A 2DVCA 4F31B 1N76A 1VR5A 3L6HA 3PUYE 3LSFB 2DQVA 4LATA 5ICTA 5AA4B 1N7WA 4GRKA 2O1LA 3FVOA 5H8HA 4IO3A 1PC3A 4PFWA 4F22A 2A5TA 3K6WA 2GHAA 2HFBA 3SDFA 4YAHX 3FVKA 4H1XA 4DCYA 3LR1A 2G29A 2QL3A 4BDMA 1LAGE 3N7PA 4R9FA 2F7AA 1NNFA 3I5OA 3ILUB 4AQ4A 4N07A 3AXFA 4PFTA 1QUIA 3RN8A 1BP5A 4K3FA 3P7IA 1MQGA 2M8CA 4KYDA 2ONRA 3JV9A 3FXQA 1LCFA 4BDNA 1QUJA 1QKAA 3RNNA 4XTCQ 3B6QA 1S9TA 4QF9A 4X1DA 5I59A 1IQ7A 1N04A 4YICA 1DTGA 4NTLA 1S7YA 4IO7A 1MG1A 4NWDA 2F7BA 2OJTA 3K6XA 3HN0A 1BKAA 5I2KB 1SI1A 2XD3A 4GWOA 4ELOA 4PQJA 2PYYA 1AOVA 3TKDA 3C4MA 1SQYA 3KN7A 3UK4A 4WEPA 4DCXA 3V83A 5CMBA 4I9DA 3T9XB 4JWOA 1D3KA 3VE1B 3RTFB 3D4GA 3MUQA 3O66A 1NNPA 1FTOA 4YKKA 3RLFE 5DYHA 3ZKKA 3EHTA 4E0XA 1LB8A 4R74A 2I49A 1IEJA 1FQEA 3E4RA 5H8HB 1Q35A 2Y7RA 4LZ5A 3ECRA 3VV5A 3MVWA 4WEDA 1Y9UA 2I3VA 3MVZA 3TQLA 5ITPA 1R9LA 1F9BA 4GXSB 1H76A 4H5GA 4HTGA 4IGTA 2H9BA 2YJPA 3CG1A 3HPIA 3Q28A 4DXBA 2PT2A 2Y7PA 5TP9A 3OD7A 3MP8A 3A3CA 1M5CA 4F3PA 3O2AA 3SEVA 3FXUA 4H67A 1LAHE 3H4ZA 2H98A 5CC2A 5DVFA 3TFLA 3DELB 4PP0A 4ND9A 2ZNUA 2ONSA 4DLDA 2V84A 3PPOA 4OERA 2Y84A 3QUFA 3PMVA 3FV1A 4DXCA 2GRVA 3RUMA 4EXLA 1B4HA 3K2DA 4GIZA 5I59B 1D9YA 4EDPA 1ZTYA 3CSGA 1EZOA 1NMUA 4LUBA 2OBGA 3N5LA 1AMFA 2IA4A 4HCYA 3IJOB 3CFLA 4ZGMA 1VSOA 2H5YA 2XXTA 4KHZE 2QPQA 4EQBA 2UVIA 3K02A 5II0A 2ZXTA 5A5XA 5CBSA 3O28A 1US5A 1B7ZA 1AIVA 4JSOA 2HZKA 3S9LC 2NUVA 1LFIA 3JZJA 3FXRA 1U34A 5DVIA 1UTBA 4BDQA 3PPRA 2CMOA 1A7LA 2I0CA 2IEEA 3Q27A 3IX1A 3ILTB 3I3VA 3IORA 2F7CA 2H4IA 4NF4A 5KDTA 2H99A 2R6GE 1MPBA 3VLWA 1VE4A 2H25A 1SW5A 1PB7A 3QSLA 3C34A 2RKMA 3U92A 3IOWA 2FNCA 2XX9A 1TXFA 1URGA 1XHYA 3TUSA 3UGWA 1IXCA 4U23A 4RXLA 3EN3A 3MZ9A 1MQDA 1TWYA 3VVFA 1MPDA 4WKMA 4NF8A 5TP9B 3UA8A 5HPQA 4WXJA 1ZBMA 5H8FB 3G3KA 3RPWA 1B52A 1SBPA 5DT6A 3CSBA 5I84A 1NH7A 1Y4CA 1O7TA 3S9MC 2QS2A 1JQFA 3C31A 2Q88A 3TMGA 1QJMA 3N7SA 3HSTA 3G3GA 1Y3QA 1MXZA 3KZGA 5HM4B 1HSLA 1DSNA 1P1QA 5IAIA 1DPPA 4HS7A 4KI0E 1A54A 4G8NA 2XXWA 3E13X 3PPNA 1B0HA 2O51A 2V25A 3KGCA 3SERA 4Z0IA 1MY3A 4F29A 4IO2A 1OIBA 3QIMA 3ZS6A 1B7HA 3VLVA 4H6DA 1BLFA 3U94A 3MQ9A 4OTEA 3G3JA 4YU0A 3H3GA 4ZE9A 4OETA 2P1SA 4GQOA 4Q5TA 3TTKA 5CMMA 1OVBA 3CG3A 1UQWA 1LBBA 4OZ9A 2NVUB 1A40A 3DLNA 5A5XB 1RYXA 2DE2A 4JXIA 1Y1MA 5FHMA 3OO6A 4RJZA 3PD8A 1PDAA 1UTBB 4P0IA 2VGQA 4AB5A 4LQ5A 3OEMA 2F6GA 4QSEA 1SI0A 5KDTB 3LUYA 3H03A 1MY0A 3MW0A 4GOTA 4FECA 3ZKLA 3VXCA 2QS1A 2UYFA 3UN6A 1B32A 5K2XA 5I57B 3O97A 3K0VA 4DXUA 4LA9A 2Q2CA 2OLBA 1NKXA 1LFHA 2XDGA 5I58B 1FTJA 2DSFA 5BUUA 4GL8A 1TT1A 3CVGA 3K01A 1Z7ME 4F1YA 2PT1A 2V93A 4MH5A 2O7UA 2PMSA 2XXVA 1II5A 2G93A 3ODBA 3QUJA 3QXMA 4QSCA 2F8DA 2I4CA 2QS4A 3FZVA 4NF5B 2DS9A 1L5TA 3V5AA 4ELQA 1XVYA 4NMYA 5I2NB 5K2YA 5FHNA 2O1MA 3EQ1A 5DEXA 4ZDMA 1LAFE 1MXWA 2VD3A 2Z23A 4H65A 4LVQA 3DP6A 4LQ2A 2XX7A 2AL5A 3S4UA 5I56A 3LBSA 4LZ7A 2ALUA 1I6QA 1R1NA 2P0SA 1SD3A 2L27A 2GHBA 4ELPA 4YB5A 3KN3A 4JWYA 5CM6A 4EF2A 4G68B 1CE2A 3TEPA
chains in the Genus database with same CATH superfamily
3KOSA 4QFLA 2DYXA 3SESA 1FQCA 4G8HA 3QAXA 3VLUA 4N6KA 4UACA 3GLBA 4PGPA 3F11A 5KCJB 3VFJA 1VDWA 3PUXE 3Q25A 3CFZA 1B3HA 1MQJA 3FD3A 1JW5A 1FQFA 4ZE8A 4RNSA 1FTMA 2Z8FA 4JB7A 3O9PA 1CB6A 2DXRA 4KPTA 5EYFA 2XXXA 3ROJA 3H7MA 3FVNA 4EF1A 1M5EA 1IIWA 1RDYA 1KWHA 3T9HB 1XC1A 1R9QA 3HHGA 4RY1A 3PGFA 3D4CA 4EQ9A 1Y1ZA 5DTBA 3MVXA 5B7DA 3IB1A 3O29A 3KSJA 4YB7A 3AQFB 1A8EA 5L8DA 4TOZA 1EYIA 3IOUA 3O6IA 2E1SA 4N4UA 1JW1A 5FTIA 2RCBA 1MQIA 1LSTA 4OHNA 4F3GA 4MAGA 4BDRA 3B6WA 1RKMA 4ZECA 1P1WA 2AL4A 4RA1A 2VOZA 4OYVA 2VHAA 4U2RA 4MNPA 5I3SA 1YXIA 4NE4A 2ANJA 3N6TA 3TODA 4OQOA 1MXUA 4IB2A 4JDFA 1B4ZA 2XXPA 4OESA 3HHFA 4OEUA 5AA2A 5DEXB 2V3UA 1MS7A 1WDNA 1M5FA 4ZEBA 3C5TA 1H45A 2Z8EA 3G3HA 3IR1A 1QW0A 4XKRA 5I56B 1MM6A 1B51A 3KG2A 4IO5A 4N8YA 3K1NA 4PGNA 4KFQA 2X7PA 4I8CA 5F7VA 4RK9A 3Q29A 1URDA 1EU8A 3TTNA 2ZYKA 4O94A 2OCUA 4N6DA 4MJOA 1GVCA 3A3UA 3IOLA 3BIGA 3RT8A 4H0WA 2FIEA 2QVRA 2DE3A 3OO9A 1R6ZA 5F24A 1MXYA 3G3FA 3KC0A 3V8XB 2OWSA 2ONKE 1MRPA 1URSA 5JEIA 5H8FA 1OQHA 4OA4A 2DVZA 5L9MA 5BWJA 3GBBA 3B7DA 4U1OA 1OLCA 3TELA 3W9VA 3MJNA 4OENA 5CMCA 3U65A 2WYPA 2XHDA 3OOAA 4NHBA 1JNFA 3MPKA 3IOVA 4FATA 4TLLB 4R72A 2FBPA 1B6HA 2CZLA 2OZZA 4JVCA 4MEVA 4BLAA 4NX1A 2D5WA 5ELVA 1A55A 2O6AA 1P99A 1US4A 3CRBA 1AH5A 3K6VA 4U1ZA 2NOOA 1J1NA 1I6AA 3R6UA 2PX1A 4PFYA 3B50A 1LBXA 4XIGQ 3H6TA 4KXPA 4I3YA 4U22A 3IO6A 1LGBC 2RF1A 4O3AA 4F2QA 3T66A 2I4BA 1SYHA 3FJGA 3RTWB 4GVOA 4PBHA 1P1NA 1UIVA 2I58A 2WBDA 1A8FA 3PUZE 2WKYA 1RDXA 5CBRA 1NI9A 2ZZXA 1B1XA 2PFYA 3UP9A 1B3FA 4MLQA 1POTA 1B3EA 2UVJA 4GFRA 5AA2B 4GWUA 4MLVA 1YCJA 3KEIA 3IB2A 2ZZVA 4PE5B 2THIA 4U4XA 1IMAA 4NN3A 2PBWA 5IZ3B 4YMBA 4PDHA 4ECFA 2XWVA 2ZYOA 1QKBA 5I57A 3L2JA 3TCGA 3N94A 3H6VA 2Q89A 1HSJA 3HO7A 4IR8A 4DZ1A 3OO8A 4DE8A 3S9NC 4GXAA 2R71A 4NEDA 5I58A 1DMBA 3H06B 1UTHA 4Q0CA 4ESWA 3KBZA 2HXWA 1SPIA 1PBPA 2UVGA 4NWCA 3GXAA 4KQPA 4PC9A 3RQTA 1ZKBA 3MPLA 3TDJA 1FBEA 1QGXA 2LAOA 3FJMA 5AA3A 2D21A 4R9GA 3FVGA 3TQWA 2DOJA 3K4UA 2YLNA 1QUKA 3SEWA 1AWBA 2VT5A 4NF5A 2F97A 3SETA 3D1RA 1I6BA 1ATGA 3A29A 3K1PA 3PUVE 5I2NA 3E3KA 1DOTA 3N7RA 4KD5A 4X9TA 3FGSA 4HW8A 1B46A 4TLMB 3OO7A 1O64A 3PPQA 3PMXA 1FJ9A 5AE4A 3TTMA 3IB0A 3KJ7A 3M3LA 4JSDA 4OFOA 5HBCA 3ZSFA 4YZZA 5FTHA 4OVQA 4P1EA 1VFDA 4MX6A 1MDP1 5IM2A 3LV0A 3CR9A 3BBRA 3Q26A 1FQAA 1YPNA 2REGA 4ZEDA 4QRZA 2OWTA 4G68A 1A99A 1B9JA 2V3QA 1XI6A 3H6WA 2P2AA 1AL3A 4AS4A 5KZTA 3CFXA 4H45A 3EF7A 2XXYA 3PD9A 1G0HA 3RY3A 5KCJA 4GBWA 4O3BA 3IAZA 2XXQA 1GGGA 3T96B 4ISUA 3KOTA 1INPA 4M1VA 4KCCA 3ISPA 3L6GA 1OMPA 3HV1A 3VVEA 1B05A 4THIA 3WAFA 3U1OA 1XT8A 3MP1A 5DVJA 1Y20A 3G3IA 4X8RA 4OVTA 3W15C 5J16A 2UYEA 4R6KA 1S50A 4XFEA 2XX8A 4L17A 1FBPA 4OFJA 2UVHA 3IO4A 4F1UA 5IZZA 4QXDA 5JTYA 3MZBA 4LP2B 3KFMA 1FSAA 2ESNA 3R26A 1MM7A 5IZ1A 4LONB 4P9KA 1LBZA 1H44A 1RYOA 5ISUA 3U72A 1UTHB 3W9WA 4LF3C 2RC7A 3KC1A 2I48A 1MDQA 3E78A 1ELJA 3BIHA 4P56A 3WAEA 5H8QB 1XS5A 1H43A 4YMAA 3OMBA 4XKQA 2I0BA 3SEUA 4XKNA 4O3CA 2VD2A 2QFLA 4PTKA 1LCTA 2XXRA 4H5FA 3K00A 2Q2AA 2F34A 3MAMA 4PFBA 2F6PA 3OSRA 1JVXA 3BFTA 2HQ0A 3C33A 3DP4A 3RGYA 4EXKA 3OENA 1Q1KA 3MBPA 1FTLA 2B4LA 2NXOA 5CRYA 5TU0A 2XXUA 1I69A 3R7XA 4G4PA 2DWAA 2O69A 5IKBA 4ZEKA 3TZAA 4AB6A 3S2VA 1KA1A 4OEVA 2RC9A 1FW0A 2I3WA 5AA1A 1DTZA 4XXUA 3KJTA 4OXVA 1PEBA 2D3IA 4G8MA 1B58A 2QS3A 2FVZA 1GV8A 4DDDA 4N17A 3O6GA 4FORA 1MH3A 5I5PA 2DP8A 2JODA 4H46A 2B3BA 2RCAA 1B3GA 4FIMA 4Q30B 1MPCA 1FQDA 5J1DA 4TQUQ 4MIJA 1YAEA 5ET8A 1TFDA 3OSQA 4F3BA 2QVUA 2HEUA 4G2ZA 3TYHA 4G68C 3FUZA 4LZ8A 4PAFA 1Y4TA 4N91A 3DM0A 1JEVA 4F39A 1NV1A 5EQ9A 2RINA 5F1QA 4PF8A 3C35A 3LSLA 1TFAA 2YPNA 3M8UA 2Y5KA 3K6UA 2AIXA 3KN8A 2XXHA 2E0SA 5EQ8A 3LSWA 2HXRA 3B6TA 1D4NA 3LSXA 5I7IA 3FV2A 3TCFA 5JTYB 1MH4A 1SVXB 4YKPA 1ZU0A 2ZMBA 4RK2A 1FPBA 1NV4A 1B0LA 2V4CA 4ZEIA 2V3TA 3USDA 3CHGA 3FJ7A 1N3WA 4MNIA 4HJ0A 2QMXA 5TPAB 1WVJA 1FPDA 2X26A 3HCQA 4O8MA 4GX4A 2BJJX 4IO4A 4F19A 4RPOA 5LTCA 4FBPA 4U21A 4IY5A 1FPKA 1DCUA 3RYDA 4I62A 2FIXA 4PETA 4NGUA 3FBPA 3PPPA 1DPEA 3MZ1A 3EHUA 2XD2A 3ONMA 1IXHA 2O84X 4KCDA 5LOMA 3M3FA 1USYE 4KR5A 4MF3A 1WODA 5IZ3A 4F3SA 3MWBA 1NUWA 2ABHA 3CIJA 3G7WA 3UIFA 2Y7WA 4R2FA 1B5IA 2Y7IA 1N7XA 4R73A 4U4SA 1BIYA 3T93B 1OLAA 4H8IA 4QHQA 4ZZEA 2KR0A 4C1TA 1OQGA 2F35A 4NF6A 3PUWE 4GL0A 2PFZA 4YKJA 4BDLA 1POY1 2A5TB 3SEXA 1B3LA 2ZNTA 1LB9A 4C0RA 4X1BA 4YKIA 2HPGA 2DXYA 4R75A 1MQHA 5EHSA 4YB6A 2HZLA 4FEBA 2DWIA 5H8NA 4N6PA 1XOCA 2OWZA 1QVSA 1NNKA 5T3JA 4PFRA 4RPNA 4UA8A 2F78A 3SKPA 1NNTA 4BDOA 4Q8RA 1PB9A 2DWJA 4GBVA 2X7QA 4MBPA 4HCWA 3OELA 2GFEA 3PV0E 2DWHA 1FQBA 1FPLA 4ZS9A 1NV0A 5H8SA 5EHMA 4I3EA 4QFKA 2HAVA 3MYUA 4GWYA 4MFIA 2QKHA 2W7YA 1YTVA 1MY4A 4IO6A 3C9HA 2QVVA 1NV5A 2QSXA 2QJEA 1IMBA 3OEKA 1NH8A 2ZZWA 3T22A 1OVTA 1O63A 4N13A 1EH3A 4P0GA 4R6YA 4JWXA 4OVJA 1H3DA 4OFLA 4MNCA 4POXA 2B4MA 1IZ1A 1JW4A 2ZYNA 4NF0A 4QFOA 3TCHA 3C36A 3IL1B 2JNCA 1NFTA 3EPEA 1IXGA 3K1MA 2Q74A 4ZEFA 3T9VA 1N0TA 4X48A 4QFPA 1LEVA 1T0KA 1BTJA 2P3VA 3C59A 2Q9TA 1Y3NA 3T9UA 4I1DA 3QYTA 3O6HA 4G77A 4RYAA 1MY1A 4H8JA 3BFUA 1PB8A 3IOTA 1UIUA 2RC8A 4QFNA 3MP6A 5ITOA 1K9ZA 1SDXA 1SYIA 1FRPA 2F36A 3IFAA 4GD5A 1M5DA 2XXIA 2FA7A 3MSTA 2QMWA 1ZMGA 4IY6A 5JK4A 1CNQA 2FYIA 3VVDA 5B70A 1IMEA 2BJIA 1EZPA 5ICQA 2B65A 1JP4A 4ERSA 4NF6B 1YZ0A 4FJPA 3BKIB 3PMWA 5H8QA 2REJA 2AYSA 1LFGA 5L9OA 2R9JA 1IUDA 3TPAA 1LBCA 4EUOA 1B7UA 1LBVA 3M3KA 3TTRA 1EZ9A 4OMBA 2XA5A 4FEDA 4R2BA 4IGRA 1ANFA 1SW4A 4ELRA 1LAXA 1ZJLA 1ZIUA 4FAJA 1FBHA 2CZKA 1XVXA 5H8NB 1JVYA 3TAJA 2KLFA 1ZLQA 1KA0A 1SW2A 3OXNA 1Z7NE 3VXBA 4PBQA 2F3BA 4OVSA 3N6UA 3FXBA 1D9VA 5M2VA 2O7IA 4JBZA 2PVUA 3S9EA 3A09A 3T0JA 2Y7KA 3CI8A 3GZGA 4P8BA 3U8QA 1B5JA 5AA4A 1FTKA 4F1VA 1Y3PA 2Y5LA 4DIGA 1FCKA 1QULA 3FIRA 4HE0A 2A5SA 3MC2A 4ESXA 2OK2A 2JNDA 5CMKA 1IITA 5EYHA 3VDFA 1VFEA 4M4GA 1JETA 1NUYA 2F5XA 4I40A 2B3FA 2QRYA 4POWA 4HXVA 4F2OA 1B5HA 1NV2A 4XKPA 1P1UA 3U93A 4G61A 1SW1A 3FASA 1B1HA 4R6HA 1MY2A 4DI3D 3EHSA 1B40A 4O7MA 1N84A 4DLQA 1JEUA 1EYJA 1MXXA 1LLSA 4GF8A 3I6VA 2CEYA 4KYSA 2UXAA 4N15A 4QSDA 1IXIA 5ESYA 4DLOA 4P11A 2CEXA 3IJXB 4F18A 1HSEA 3GBAA 5CI5A 3PU5A 1M5BA 3KBRA 1NL5A 3DP8A 4NAPA 4NF4B 5ET5A 2I6EA 3JYRA 1IMFA 4HE2A 4EQ7A 3THIA 3SEYA 3N26A 3TTLA 4E0WA 2DE4A 2GH9A 5AA2D 2HCAA 1NUXA 1PBQA 1N3XA 1FPFA 5TPAA 1GR2A 2Z8DA 1P1OA 2ZNSA 1USYH 3KSXA 4Z7EA 1B2HA 2OX3A 5I2KA 2HAUA 2ZYMA 4ZZAA 3UORA 2O68A 3EKIA 5FHOA 2Q8MA 1Q9DA 4ONYA 1GTKA 1MXVA 4GLIA 2Q8JA 4FE8A 4KYEA 5L9SA 2VP1A 3E9XA 4OWDA 4NF8B 3H6UA 4LN5A 2CZHA 3QK6A 1NV6A 3FATA 3LC8A 2NWJA 4C1UA 3RT6B 3V89B 1BK4A 2Z22A 3MVYA 4PFUA 3IK6B 3C32A 2DVCA 4F31B 1N76A 1VR5A 3L6HA 1DK4A 3PUYE 3LSFB 2DQVA 4LATA 5ICTA 5AA4B 1N7WA 4GRKA 2O1LA 2L5VA 3FVOA 5H8HA 4IO3A 1PC3A 1FJ6A 4PFWA 4F22A 2VPOA 2A5TA 3K6WA 4PF6A 2GHAA 2HFBA 3SDFA 5EQ7A 4YAHX 3FVKA 4H1XA 4DCYA 3LR1A 2G29A 2QL3A 1DBZA 4BDMA 3T1BA 1LAGE 3N7PA 2WEFA 4R9FA 2CZIA 2DDKA 4NQ8A 2F7AA 4JVIA 1NNFA 3I5OA 4P47A 3ILUB 4AQ4A 4N07A 3AXFA 4PFTA 5IGAA 1QUIA 3RN8A 1BP5A 4K3FA 3P7IA 1MQGA 3RPLA 3B8BA 2M8CA 4KYDA 2ONRA 3JV9A 3FXQA 1LCFA 4BDNA 1QUJA 4MMPA 1QKAA 5A5LA 3RNNA 4XTCQ 3B6QA 1S9TA 4QF9A 4X1DA 1FTAA 5I59A 1IQ7A 1N04A 2FHYA 4YICA 1DTGA 4NTLA 4IO7A 1S7YA 1MG1A 4NWDA 2F7BA 2OJTA 3K6XA 3HN0A 1BKAA 2HHMA 5I2KB 1SI1A 2XD3A 4GWOA 4ELOA 4PQJA 4PDDA 4PFIA 1FBCA 2PYYA 1AOVA 4NG7A 3TKDA 4P1LA 3C4MA 1SQYA 3KN7A 3UK4A 5ET7A 5FBPA 4WEPA 4DCXA 4N8GA 3V83A 4I9DA 4JWOA 5CMBA 3T9XB 1D3KA 5EYGA 4XEQA 3VE1B 3RTFB 3D4GA 3MUQA 3O66A 1NNPA 1FTOA 4YKKA 3RLFE 5DYHA 3ZKKA 3EHTA 4E0XA 2R8TA 1LB8A 4R74A 2I49A 1IEJA 1FBFA 1FQEA 3E4RA 5H8HB 1Q35A 3LUZA 2Y7RA 4LZ5A 3ECRA 3VV5A 3MVWA 1G0IA 4WEDA 1Y9UA 2I3VA 3MVZA 3TQLA 5ITPA 1R9LA 1F9BA 4GXSB 1H76A 4H5GA 4HTGA 4IGTA 2H9BA 2YJPA 3CG1A 3HPIA 3Q28A 4DXBA 2PT2A 2Y7PA 4N81A 4GX3A 5TP9A 3SZPA 3OD7A 2WYKA 3MP8A 3A3CA 1M5CA 4F3PA 1FPEA 3O2AA 3SEVA 3FXUA 4H67A 1LAHE 3H4ZA 2H98A 5CC2A 5DVFA 3RPLB 3TFLA 3DELB 4PP0A 4ND9A 2ZNUA 2ONSA 4DLDA 2V84A 1K9YA 3PPOA 4OERA 2Y84A 3QUFA 3PMVA 4DI4B 3FV1A 4DXCA 2GRVA 4GWSA 3RUMA 4EXLA 1B4HA 2P3NA 3K2DA 4GIZA 1D9YA 5I59B 4EDPA 1ZTYA 3CSGA 2WBBA 4OVPA 1EZOA 1NMUA 4LUBA 2OBGA 3N5LA 1AMFA 2IA4A 4HCYA 3IJOB 3CFLA 4ZGMA 1VSOA 2H5YA 2XXTA 2GQ1A 4KHZE 2QPQA 4EQBA 2UVIA 3QMFA 3K02A 1RDZA 5II0A 2ZXTA 5A5XA 5CBSA 4PAKA 3O28A 1US5A 1B7ZA 1AIVA 4JSOA 4JVDA 2HZKA 3S9LC 1IMCA 2NUVA 2XWKA 1LFIA 3JZJA 3FXRA 1U34A 5DVIA 1FPJA 1UTBA 4BDQA 3PPRA 2CMOA 1A7LA 2I0CA 4GX6A 4MCOA 4AS5A 2IEEA 3Q27A 2PCRA 3HFUA 3ILTB 3I3VA 3IORA 2F7CA 3IX1A 4X04A 2H4IA 4PAIA 4NF4A 5KDTA 2H99A 2R6GE 1MPBA 5ET6A 2XWIA 5EQAA 3VLWA 1VE4A 2H25A 1SW5A 4GWWA 1PB7A 3QSLA 3C34A 2RKMA 3U92A 3IOWA 1LBWA 2FNCA 2XX9A 2XXKA 1TXFA 1URGA 1XHYA 1NUZA 1IMDA 3TUSA 2XWOA 3UGWA 1IXCA 4U23A 4RXLA 3EN3A 3MZ9A 1MQDA 1TWYA 3E79A 3VVFA 1MPDA 4WKMA 4NF8A 1FPGA 5TP9B 3NOHA 4PCDA 4WXJA 1ZBMA 3UA8A 5HPQA 5H8FB 3G3KA 3RPWA 1B52A 1SBPA 5DT6A 3CSBA 5I84A 1NH7A 1Y4CA 1O7TA 3S9MC 2QS2A 1JQFA 3C31A 2Q88A 3TMGA 4P3LA 1QJMA 3N7SA 3HSTA 3GYYA 3G3GA 4GWXA 1Y3QA 4OVRA 1MXZA 3KZGA 5HM4B 1LBYA 1HSLA 1DSNA 1P1QA 5IAIA 1DPPA 4HS7A 4KI0E 3IFCA 1A54A 4G8NA 2JJKA 2XXWA 3E13X 1FPIA 3PPNA 1B0HA 2O51A 2V25A 3KGCA 3SERA 4Z0IA 1MY3A 4F29A 4IO2A 3PTYA 1OIBA 2VPNA 3QIMA 3ZS6A 1B7HA 3VLVA 4H6DA 1BLFA 3U94A 3MQ9A 4OTEA 3G3JA 4YU0A 3H3GA 4ZE9A 4OETA 4HE1A 2P1SA 4GQOA 4Q5TA 3TTKA 5CMMA 1OVBA 3CG3A 1UQWA 1LBBA 4OZ9A 2NVUB 1A40A 3DLNA 5A5XB 1FBGA 1RYXA 2DE2A 1EYKA 4JXIA 1Y1MA 5FHMA 3OO6A 4RJZA 3PD8A 1PDAA 1UTBB 4P0IA 2VGQA 4AB5A 4LQ5A 1KZ8A 1NV3A 2F6GA 3OEMA 4QSEA 1SI0A 5KDTB 3LUYA 3H03A 1MY0A 3MW0A 4GOTA 4FECA 3ZKLA 3VXCA 2QS1A 2UYFA 4QBAA 4UABA 1D9QA 3UN6A 1B32A 5K2XA 1NV7A 5I57B 3O97A 3K0VA 4DXUA 4LA9A 2Q2CA 4MHFA 2OLBA 1NKXA 1LFHA 2XDGA 2WX9A 5I58B 1FTJA 2DSFA 4XF5A 5BUUA 4GL8A 1TT1A 3CVGA 3K01A 1Z7ME 2PT1A 4F1YA 2V93A 4MH5A 2O7UA 4GWZA 2PMSA 2XXVA 4PE3A 1II5A 2G93A 4O7IA 3ODBA 3QUJA 3QXMA 4QSCA 2F8DA 2I4CA 2QS4A 3FZVA 4NF5B 2DS9A 1L5TA 3V5AA 4ELQA 1XVYA 5LDZA 4NMYA 5I2NB 5K2YA 5FHNA 4OANA 2O1MA 3EQ1A 5DEXA 4ZDMA 1LAFE 1MXWA 2VD3A 2Z23A 4H65A 4LVQA 3DP6A 4LQ2A 2XX7A 2AL5A 3S4UA 5I56A 3LBSA 2MKZA 4LZ7A 2ALUA 1I6QA 1R1NA 1YYZA 2F3DA 2P0SA 1SD3A 2L27A 2GHBA 1FBDA 4ELPA 4YB5A 3KN3A 2KQZA 4JWYA 5CM6A 4EF2A 5DW8A 4G68B 1CE2A 3TEPA
chains in the Genus database with same CATH topology
3KOSA 4QFLA 2DYXA 3SESA 1FQCA 4G8HA 3QAXA 3VLUA 4UACA 3GLBA 3F11A 5KCJB 3VFJA 3PUXE 3Q25A 3CFZA 1B3HA 1MQJA 3FD3A 1JW5A 1FQFA 4ZE8A 4RNSA 1FTMA 2Z8FA 4JB7A 3O9PA 1CB6A 2DXRA 4KPTA 5EYFA 2XXXA 3H7MA 3FVNA 4EF1A 1M5EA 1IIWA 1KWHA 3T9HB 1XC1A 1R9QA 3HHGA 4RY1A 3PGFA 3D4CA 4EQ9A 1Y1ZA 5DTBA 3MVXA 5B7DA 3IB1A 3O29A 3KSJA 4YB7A 3AQFB 1A8EA 5L8DA 4TOZA 3IOUA 3O6IA 2E1SA 1JW1A 5FTIA 2RCBA 1MQIA 1LSTA 4OHNA 4F3GA 4BDRA 3B6WA 1RKMA 4ZECA 1P1WA 2AL4A 4RA1A 2VOZA 4OYVA 2VHAA 4U2RA 4NE4A 2ANJA 3N6TA 3TODA 4OQOA 1MXUA 4IB2A 4JDFA 1B4ZA 2XXPA 4OESA 3HHFA 4OEUA 5AA2A 5DEXB 2V3UA 1MS7A 1WDNA 1M5FA 4ZEBA 3C5TA 1H45A 2Z8EA 3G3HA 3IR1A 1QW0A 4XKRA 5I56B 1MM6A 1B51A 3KG2A 4IO5A 3K1NA 4KFQA 2X7PA 4I8CA 5F7VA 4RK9A 3Q29A 1URDA 1EU8A 3TTNA 2ZYKA 2OCUA 1GVCA 3A3UA 3IOLA 3RT8A 4H0WA 3OO9A 2DE3A 1R6ZA 1MXYA 3G3FA 3V8XB 2OWSA 2ONKE 1MRPA 1URSA 5JEIA 5H8FA 1OQHA 2DVZA 5L9MA 5BWJA 3GBBA 3B7DA 4U1OA 1OLCA 3TELA 3W9VA 3MJNA 4OENA 5CMCA 2XHDA 3OOAA 1JNFA 3MPKA 3IOVA 4FATA 4TLLB 4R72A 1B6HA 2CZLA 2OZZA 4BLAA 2D5WA 5ELVA 1A55A 2O6AA 1P99A 1US4A 3CRBA 1AH5A 3K6VA 4U1ZA 2NOOA 1J1NA 1I6AA 3R6UA 2PX1A 4PFYA 4XIGQ 3H6TA 4U22A 3IO6A 1LGBC 2RF1A 4O3AA 4F2QA 3T66A 2I4BA 1SYHA 3FJGA 3RTWB 4GVOA 1P1NA 1UIVA 2I58A 1A8FA 3PUZE 2WKYA 5CBRA 1B1XA 3UP9A 1B3FA 4MLQA 1POTA 1B3EA 2UVJA 4GFRA 5AA2B 4MLVA 1YCJA 3KEIA 3IB2A 4PE5B 2THIA 4U4XA 2PBWA 4YMBA 4ECFA 2ZYOA 1QKBA 5I57A 3L2JA 3TCGA 3N94A 3H6VA 2Q89A 1HSJA 3HO7A 4DZ1A 3OO8A 4DE8A 3S9NC 4GXAA 2R71A 4NEDA 5I58A 1DMBA 3H06B 1UTHA 4Q0CA 4ESWA 2HXWA 1PBPA 2UVGA 4NWCA 3GXAA 4KQPA 3RQTA 1ZKBA 3MPLA 3TDJA 2LAOA 3FJMA 5AA3A 2D21A 4R9GA 3FVGA 3TQWA 2DOJA 3K4UA 2YLNA 1QUKA 3SEWA 3SETA 4NF5A 2F97A 1I6BA 1ATGA 3K1PA 3PUVE 5I2NA 3E3KA 1DOTA 3N7RA 4KD5A 4X9TA 3FGSA 4HW8A 1B46A 4TLMB 3OO7A 1O64A 3PPQA 3PMXA 5AE4A 3TTMA 3IB0A 3KJ7A 3M3LA 4JSDA 4OFOA 5HBCA 3ZSFA 4YZZA 5FTHA 1VFDA 1MDP1 3CR9A 3BBRA 3Q26A 1FQAA 1YPNA 2REGA 4ZEDA 4QRZA 2OWTA 4G68A 1A99A 1B9JA 2V3QA 3H6WA 2P2AA 1AL3A 5KZTA 3CFXA 3EF7A 2XXYA 3PD9A 5KCJA 3RY3A 4O3BA 3IAZA 2XXQA 1GGGA 3T96B 4ISUA 3KOTA 4M1VA 4KCCA 3L6GA 1OMPA 3HV1A 3VVEA 1B05A 4THIA 3WAFA 3U1OA 1XT8A 3MP1A 5DVJA 1Y20A 3G3IA 3W15C 2UYEA 4R6KA 1S50A 2XX8A 4L17A 4OFJA 2UVHA 3IO4A 4F1UA 5JTYA 3MZBA 4LP2B 3KFMA 2ESNA 3R26A 1MM7A 4LONB 1H44A 1RYOA 5ISUA 3U72A 1UTHB 3W9WA 4LF3C 2RC7A 2I48A 1MDQA 1ELJA 3WAEA 5H8QB 1XS5A 1H43A 4YMAA 3OMBA 4XKQA 2I0BA 3SEUA 4XKNA 4O3CA 2VD2A 1LCTA 2XXRA 4H5FA 3K00A 2Q2AA 2F34A 3MAMA 2F6PA 3OSRA 1JVXA 3BFTA 2HQ0A 3C33A 3DP4A 3RGYA 4EXKA 3OENA 1Q1KA 3MBPA 1FTLA 2NXOA 5CRYA 5TU0A 2XXUA 1I69A 3R7XA 4G4PA 2DWAA 2O69A 5IKBA 4ZEKA 3TZAA 4AB6A 3S2VA 4OEVA 2RC9A 1FW0A 2I3WA 5AA1A 1DTZA 4XXUA 3KJTA 4OXVA 1PEBA 2D3IA 4G8MA 1B58A 2QS3A 1GV8A 4DDDA 3O6GA 4FORA 1MH3A 2DP8A 2JODA 2B3BA 2RCAA 1B3GA 4FIMA 4Q30B 1MPCA 1FQDA 5J1DA 4TQUQ 1YAEA 1TFDA 3OSQA 4F3BA 2HEUA 4G2ZA 3TYHA 4G68C 3FUZA 4LZ8A 1Y4TA 3DM0A 1JEVA 4F39A 5F1QA 2RINA 3C35A 3LSLA 1TFAA 2YPNA 3M8UA 3K6UA 2AIXA 3KN8A 2XXHA 2E0SA 3LSWA 3B6TA 1D4NA 3LSXA 3FV2A 3TCFA 5JTYB 1MH4A 1SVXB 4YKPA 1ZU0A 2ZMBA 4RK2A 1B0LA 4ZEIA 2V3TA 3USDA 3FJ7A 1N3WA 4HJ0A 2QMXA 5TPAB 1WVJA 2X26A 3HCQA 2BJJX 4IO4A 4F19A 4RPOA 4U21A 4IY5A 4I62A 4PETA 3PPPA 1DPEA 3MZ1A 3EHUA 2XD2A 3ONMA 1IXHA 2O84X 4KCDA 5LOMA 3M3FA 1USYE 4KR5A 4MF3A 1WODA 4F3SA 3MWBA 2ABHA 3CIJA 3G7WA 3UIFA 2Y7WA 4R2FA 1B5IA 2Y7IA 1N7XA 4R73A 4U4SA 1BIYA 3T93B 1OLAA 4H8IA 4QHQA 4ZZEA 4C1TA 1OQGA 2F35A 4NF6A 3PUWE 4GL0A 4YKJA 4BDLA 1POY1 2A5TB 3SEXA 1B3LA 2ZNTA 1LB9A 4C0RA 4X1BA 4YKIA 2DXYA 4R75A 1MQHA 5EHSA 4YB6A 2HZLA 4FEBA 2DWIA 5H8NA 4N6PA 1XOCA 1QVSA 1NNKA 4RPNA 4UA8A 2F78A 3SKPA 1NNTA 4BDOA 4Q8RA 1PB9A 2DWJA 2X7QA 4MBPA 4HCWA 3OELA 2GFEA 3PV0E 2DWHA 1FQBA 4ZS9A 5H8SA 5EHMA 4QFKA 2HAVA 4MFIA 2QKHA 2W7YA 1YTVA 1MY4A 4IO6A 3C9HA 2QSXA 2QJEA 3OEKA 1NH8A 3T22A 1OVTA 1O63A 4N13A 1EH3A 4P0GA 4R6YA 4JWXA 4OVJA 1H3DA 4OFLA 4POXA 1IZ1A 1JW4A 2ZYNA 4QFOA 3TCHA 3C36A 3IL1B 2JNCA 1NFTA 3EPEA 1IXGA 3K1MA 4ZEFA 3T9VA 1N0TA 4X48A 4QFPA 1T0KA 1BTJA 3C59A 2Q9TA 1Y3NA 3T9UA 4I1DA 3QYTA 3O6HA 4G77A 4RYAA 1MY1A 4H8JA 3BFUA 1PB8A 3IOTA 1UIUA 2RC8A 4QFNA 3MP6A 5ITOA 1SDXA 1SYIA 2F36A 4GD5A 1M5DA 2XXIA 2FA7A 2QMWA 1ZMGA 4IY6A 5JK4A 2FYIA 3VVDA 5B70A 1EZPA 5ICQA 2B65A 4ERSA 4NF6B 4FJPA 3BKIB 3PMWA 5H8QA 2REJA 2AYSA 1LFGA 5L9OA 2R9JA 1IUDA 3TPAA 1LBCA 4EUOA 1B7UA 3M3KA 3TTRA 1EZ9A 4OMBA 4FEDA 4R2BA 4IGRA 1ANFA 1SW4A 4ELRA 1LAXA 1ZJLA 1ZIUA 4FAJA 1XVXA 5H8NB 1JVYA 3TAJA 2KLFA 1ZLQA 1SW2A 3OXNA 1Z7NE 3VXBA 3N6UA 1D9VA 5M2VA 2O7IA 4JBZA 2PVUA 3S9EA 3A09A 2Y7KA 3CI8A 3GZGA 3U8QA 1B5JA 5AA4A 1FTKA 4F1VA 1Y3PA 4DIGA 1FCKA 1QULA 3FIRA 2A5SA 3MC2A 4ESXA 2OK2A 2JNDA 5CMKA 1IITA 3VDFA 1VFEA 4M4GA 1JETA 2F5XA 2B3FA 2QRYA 4POWA 4F2OA 1B5HA 4XKPA 1P1UA 3U93A 1SW1A 3FASA 1B1HA 4R6HA 1MY2A 3EHSA 1B40A 1N84A 4DLQA 1JEUA 1MXXA 1LLSA 4GF8A 3I6VA 4KYSA 2UXAA 4QSDA 1IXIA 4DLOA 4P11A 3IJXB 4F18A 1HSEA 3GBAA 5CI5A 3PU5A 1M5BA 3KBRA 1NL5A 3DP8A 4NF4B 2I6EA 3JYRA 4EQ7A 3THIA 3SEYA 3N26A 3TTLA 4E0WA 2DE4A 2GH9A 5AA2D 2HCAA 1PBQA 1N3XA 5TPAA 1GR2A 2Z8DA 1P1OA 2ZNSA 1USYH 3KSXA 4Z7EA 1B2HA 5I2KA 2HAUA 2ZYMA 4ZZAA 3UORA 2O68A 5FHOA 4ONYA 1GTKA 1MXVA 4GLIA 2Q8JA 4FE8A 4KYEA 5L9SA 2VP1A 3E9XA 4OWDA 4NF8B 3H6UA 3QK6A 3FATA 3LC8A 2NWJA 4C1UA 3RT6B 3V89B 2Z22A 3MVYA 4PFUA 3IK6B 3C32A 2DVCA 4F31B 1N76A 1VR5A 3L6HA 3PUYE 3LSFB 2DQVA 4LATA 5ICTA 5AA4B 1N7WA 4GRKA 2O1LA 3FVOA 5H8HA 4IO3A 1PC3A 4PFWA 4F22A 2A5TA 3K6WA 2GHAA 2HFBA 3SDFA 4YAHX 3FVKA 4H1XA 4DCYA 3LR1A 2G29A 2QL3A 4BDMA 1LAGE 3N7PA 4R9FA 2F7AA 1NNFA 3I5OA 3ILUB 4AQ4A 4N07A 3AXFA 4PFTA 1QUIA 3RN8A 1BP5A 4K3FA 3P7IA 1MQGA 2M8CA 4KYDA 2ONRA 3JV9A 3FXQA 1LCFA 4BDNA 1QUJA 1QKAA 3RNNA 4XTCQ 3B6QA 1S9TA 4QF9A 4X1DA 5I59A 1IQ7A 1N04A 4YICA 1DTGA 4NTLA 1S7YA 4IO7A 1MG1A 4NWDA 2F7BA 2OJTA 3K6XA 3HN0A 1BKAA 5I2KB 1SI1A 2XD3A 4GWOA 4ELOA 4PQJA 2PYYA 1AOVA 3TKDA 3C4MA 1SQYA 3KN7A 3UK4A 4WEPA 4DCXA 3V83A 5CMBA 4I9DA 3T9XB 4JWOA 1D3KA 3VE1B 3RTFB 3D4GA 3MUQA 3O66A 1NNPA 1FTOA 4YKKA 3RLFE 5DYHA 3ZKKA 3EHTA 4E0XA 1LB8A 4R74A 2I49A 1IEJA 1FQEA 3E4RA 5H8HB 1Q35A 2Y7RA 4LZ5A 3ECRA 3VV5A 3MVWA 4WEDA 1Y9UA 2I3VA 3MVZA 3TQLA 5ITPA 1R9LA 1F9BA 4GXSB 1H76A 4H5GA 4HTGA 4IGTA 2H9BA 2YJPA 3CG1A 3HPIA 3Q28A 4DXBA 2PT2A 2Y7PA 5TP9A 3OD7A 3MP8A 3A3CA 1M5CA 4F3PA 3O2AA 3SEVA 3FXUA 4H67A 1LAHE 3H4ZA 2H98A 5CC2A 5DVFA 3TFLA 3DELB 4PP0A 4ND9A 2ZNUA 2ONSA 4DLDA 2V84A 3PPOA 4OERA 2Y84A 3QUFA 3PMVA 3FV1A 4DXCA 2GRVA 3RUMA 4EXLA 1B4HA 3K2DA 4GIZA 5I59B 1D9YA 4EDPA 1ZTYA 3CSGA 1EZOA 1NMUA 4LUBA 2OBGA 3N5LA 1AMFA 2IA4A 4HCYA 3IJOB 3CFLA 4ZGMA 1VSOA 2H5YA 2XXTA 4KHZE 2QPQA 4EQBA 2UVIA 3K02A 5II0A 2ZXTA 5A5XA 5CBSA 3O28A 1US5A 1B7ZA 1AIVA 4JSOA 2HZKA 3S9LC 2NUVA 1LFIA 3JZJA 3FXRA 1U34A 5DVIA 1UTBA 4BDQA 3PPRA 2CMOA 1A7LA 2I0CA 2IEEA 3Q27A 3IX1A 3ILTB 3I3VA 3IORA 2F7CA 2H4IA 4NF4A 5KDTA 2H99A 2R6GE 1MPBA 3VLWA 1VE4A 2H25A 1SW5A 1PB7A 3QSLA 3C34A 2RKMA 3U92A 3IOWA 2FNCA 2XX9A 1TXFA 1URGA 1XHYA 3TUSA 3UGWA 1IXCA 4U23A 4RXLA 3EN3A 3MZ9A 1MQDA 1TWYA 3VVFA 1MPDA 4WKMA 4NF8A 5TP9B 3UA8A 5HPQA 4WXJA 1ZBMA 5H8FB 3G3KA 3RPWA 1B52A 1SBPA 5DT6A 3CSBA 5I84A 1NH7A 1Y4CA 1O7TA 3S9MC 2QS2A 1JQFA 3C31A 2Q88A 3TMGA 1QJMA 3N7SA 3HSTA 3G3GA 1Y3QA 1MXZA 3KZGA 5HM4B 1HSLA 1DSNA 1P1QA 5IAIA 1DPPA 4HS7A 4KI0E 1A54A 4G8NA 2XXWA 3E13X 3PPNA 1B0HA 2O51A 2V25A 3KGCA 3SERA 4Z0IA 1MY3A 4F29A 4IO2A 1OIBA 3QIMA 3ZS6A 1B7HA 3VLVA 4H6DA 1BLFA 3U94A 3MQ9A 4OTEA 3G3JA 4YU0A 3H3GA 4ZE9A 4OETA 2P1SA 4GQOA 4Q5TA 3TTKA 5CMMA 1OVBA 3CG3A 1UQWA 1LBBA 4OZ9A 2NVUB 1A40A 3DLNA 5A5XB 1RYXA 2DE2A 4JXIA 1Y1MA 5FHMA 3OO6A 4RJZA 3PD8A 1PDAA 1UTBB 4P0IA 2VGQA 4AB5A 4LQ5A 3OEMA 2F6GA 4QSEA 1SI0A 5KDTB 3LUYA 3H03A 1MY0A 3MW0A 4GOTA 4FECA 3ZKLA 3VXCA 2QS1A 2UYFA 3UN6A 1B32A 5K2XA 5I57B 3O97A 3K0VA 4DXUA 4LA9A 2Q2CA 2OLBA 1NKXA 1LFHA 2XDGA 5I58B 1FTJA 2DSFA 5BUUA 4GL8A 1TT1A 3CVGA 3K01A 1Z7ME 4F1YA 2PT1A 2V93A 4MH5A 2O7UA 2PMSA 2XXVA 1II5A 2G93A 3ODBA 3QUJA 3QXMA 4QSCA 2F8DA 2I4CA 2QS4A 3FZVA 4NF5B 2DS9A 1L5TA 3V5AA 4ELQA 1XVYA 4NMYA 5I2NB 5K2YA 5FHNA 2O1MA 3EQ1A 5DEXA 4ZDMA 1LAFE 1MXWA 2VD3A 2Z23A 4H65A 4LVQA 3DP6A 4LQ2A 2XX7A 2AL5A 3S4UA 5I56A 3LBSA 4LZ7A 2ALUA 1I6QA 1R1NA 2P0SA 1SD3A 2L27A 2GHBA 4ELPA 4YB5A 3KN3A 4JWYA 5CM6A 4EF2A 4G68B 1CE2A 3TEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOS A;  4QFL A;  2DYX A;  3SES A;  1FQC A;  4G8H A;  3QAX A;  3VLU A;  4UAC A;  3GLB A;  3F11 A;  5KCJ B;  3VFJ A;  3PUX E;  3Q25 A;  3CFZ A;  1B3H A;  1MQJ A;  3FD3 A;  1JW5 A;  1FQF A;  4ZE8 A;  4RNS A;  1FTM A;  2Z8F A;  4JB7 A;  3O9P A;  1CB6 A;  2DXR A;  4KPT A;  5EYF A;  2XXX A;  3H7M A;  3FVN A;  4EF1 A;  1M5E A;  1IIW A;  1KWH A;  3T9H B;  1XC1 A;  1R9Q A;  3HHG A;  4RY1 A;  3PGF A;  3D4C A;  4EQ9 A;  1Y1Z A;  5DTB A;  3MVX A;  5B7D A;  3IB1 A;  3O29 A;  3KSJ A;  4YB7 A;  3AQF B;  1A8E A;  5L8D A;  4TOZ A;  3IOU A;  3O6I A;  2E1S A;  1JW1 A;  5FTI A;  2RCB A;  1MQI A;  1LST A;  4OHN A;  4F3G A;  4BDR A;  3B6W A;  1RKM A;  4ZEC A;  1P1W A;  2AL4 A;  4RA1 A;  2VOZ A;  4OYV A;  2VHA A;  4U2R A;  4NE4 A;  2ANJ A;  3N6T A;  3TOD A;  4OQO A;  1MXU A;  4IB2 A;  4JDF A;  1B4Z A;  2XXP A;  4OES A;  3HHF A;  4OEU A;  5AA2 A;  5DEX B;  2V3U A;  1MS7 A;  1WDN A;  1M5F A;  4ZEB A;  3C5T A;  1H45 A;  2Z8E A;  3G3H A;  3IR1 A;  1QW0 A;  4XKR A;  5I56 B;  1MM6 A;  1B51 A;  3KG2 A;  4IO5 A;  3K1N A;  4KFQ A;  2X7P A;  4I8C A;  5F7V A;  4RK9 A;  3Q29 A;  1URD A;  1EU8 A;  3TTN A;  2ZYK A;  2OCU A;  1GVC A;  3A3U A;  3IOL A;  3RT8 A;  4H0W A;  3OO9 A;  2DE3 A;  1R6Z A;  1MXY A;  3G3F A;  3V8X B;  2OWS A;  2ONK E;  1MRP A;  1URS A;  5JEI A;  5H8F A;  1OQH A;  2DVZ A;  5L9M A;  5BWJ A;  3GBB A;  3B7D A;  4U1O A;  1OLC A;  3TEL A;  3W9V A;  3MJN A;  4OEN A;  5CMC A;  2XHD A;  3OOA A;  1JNF A;  3MPK A;  3IOV A;  4FAT A;  4TLL B;  4R72 A;  1B6H A;  2CZL A;  2OZZ A;  4BLA A;  2D5W A;  5ELV A;  1A55 A;  2O6A A;  1P99 A;  1US4 A;  3CRB A;  1AH5 A;  3K6V A;  4U1Z A;  2NOO A;  1J1N A;  1I6A A;  3R6U A;  2PX1 A;  4PFY A;  4XIG Q;  3H6T A;  4U22 A;  3IO6 A;  1LGB C;  2RF1 A;  4O3A A;  4F2Q A;  3T66 A;  2I4B A;  1SYH A;  3FJG A;  3RTW B;  4GVO A;  1P1N A;  1UIV A;  2I58 A;  1A8F A;  3PUZ E;  2WKY A;  5CBR A;  1B1X A;  3UP9 A;  1B3F A;  4MLQ A;  1POT A;  1B3E A;  2UVJ A;  4GFR A;  5AA2 B;  4MLV A;  1YCJ A;  3KEI A;  3IB2 A;  4PE5 B;  2THI A;  4U4X A;  2PBW A;  4YMB A;  4ECF A;  2ZYO A;  1QKB A;  5I57 A;  3L2J A;  3TCG A;  3N94 A;  3H6V A;  2Q89 A;  1HSJ A;  3HO7 A;  4DZ1 A;  3OO8 A;  4DE8 A;  3S9N C;  4GXA A;  2R71 A;  4NED A;  5I58 A;  1DMB A;  3H06 B;  1UTH A;  4Q0C A;  4ESW A;  2HXW A;  1PBP A;  2UVG A;  4NWC A;  3GXA A;  4KQP A;  3RQT A;  1ZKB A;  3MPL A;  3TDJ A;  2LAO A;  3FJM A;  5AA3 A;  2D21 A;  4R9G A;  3FVG A;  3TQW A;  2DOJ A;  3K4U A;  2YLN A;  1QUK A;  3SEW A;  3SET A;  4NF5 A;  2F97 A;  1I6B A;  1ATG A;  3K1P A;  3PUV E;  5I2N A;  3E3K A;  1DOT A;  3N7R A;  4KD5 A;  4X9T A;  3FGS A;  4HW8 A;  1B46 A;  4TLM B;  3OO7 A;  1O64 A;  3PPQ A;  3PMX A;  5AE4 A;  3TTM A;  3IB0 A;  3KJ7 A;  3M3L A;  4JSD A;  4OFO A;  5HBC A;  3ZSF A;  4YZZ A;  5FTH A;  1VFD A;  1MDP 1;  3CR9 A;  3BBR A;  3Q26 A;  1FQA A;  1YPN A;  2REG A;  4ZED A;  4QRZ A;  2OWT A;  4G68 A;  1A99 A;  1B9J A;  2V3Q A;  3H6W A;  2P2A A;  1AL3 A;  5KZT A;  3CFX A;  3EF7 A;  2XXY A;  3PD9 A;  5KCJ A;  3RY3 A;  4O3B A;  3IAZ A;  2XXQ A;  1GGG A;  3T96 B;  4ISU A;  3KOT A;  4M1V A;  4KCC A;  3L6G A;  1OMP A;  3HV1 A;  3VVE A;  1B05 A;  4THI A;  3WAF A;  3U1O A;  1XT8 A;  3MP1 A;  5DVJ A;  1Y20 A;  3G3I A;  3W15 C;  2UYE A;  4R6K A;  1S50 A;  2XX8 A;  4L17 A;  4OFJ A;  2UVH A;  3IO4 A;  4F1U A;  5JTY A;  3MZB A;  4LP2 B;  3KFM A;  2ESN A;  3R26 A;  1MM7 A;  4LON B;  1H44 A;  1RYO A;  5ISU A;  3U72 A;  1UTH B;  3W9W A;  4LF3 C;  2RC7 A;  2I48 A;  1MDQ A;  1ELJ A;  3WAE A;  5H8Q B;  1XS5 A;  1H43 A;  4YMA A;  3OMB A;  4XKQ A;  2I0B A;  3SEU A;  4XKN A;  4O3C A;  2VD2 A;  1LCT A;  2XXR A;  4H5F A;  3K00 A;  2Q2A A;  2F34 A;  3MAM A;  2F6P A;  3OSR A;  1JVX A;  3BFT A;  2HQ0 A;  3C33 A;  3DP4 A;  3RGY A;  4EXK A;  3OEN A;  1Q1K A;  3MBP A;  1FTL A;  2NXO A;  5CRY A;  5TU0 A;  2XXU A;  1I69 A;  3R7X A;  4G4P A;  2DWA A;  2O69 A;  5IKB A;  4ZEK A;  3TZA A;  4AB6 A;  3S2V A;  4OEV A;  2RC9 A;  1FW0 A;  2I3W A;  5AA1 A;  1DTZ A;  4XXU A;  3KJT A;  4OXV A;  1PEB A;  2D3I A;  4G8M A;  1B58 A;  2QS3 A;  1GV8 A;  4DDD A;  3O6G A;  4FOR A;  1MH3 A;  2DP8 A;  2JOD A;  2B3B A;  2RCA A;  1B3G A;  4FIM A;  4Q30 B;  1MPC A;  1FQD A;  5J1D A;  4TQU Q;  1YAE A;  1TFD A;  3OSQ A;  4F3B A;  2HEU A;  4G2Z A;  3TYH A;  4G68 C;  3FUZ A;  4LZ8 A;  1Y4T A;  3DM0 A;  1JEV A;  4F39 A;  5F1Q A;  2RIN A;  3C35 A;  3LSL A;  1TFA A;  2YPN A;  3M8U A;  3K6U A;  2AIX A;  3KN8 A;  2XXH A;  2E0S A;  3LSW A;  3B6T A;  1D4N A;  3LSX A;  3FV2 A;  3TCF A;  5JTY B;  1MH4 A;  1SVX B;  4YKP A;  1ZU0 A;  2ZMB A;  4RK2 A;  1B0L A;  4ZEI A;  2V3T A;  3USD A;  3FJ7 A;  1N3W A;  4HJ0 A;  2QMX A;  5TPA B;  1WVJ A;  2X26 A;  3HCQ A;  2BJJ X;  4IO4 A;  4F19 A;  4RPO A;  4U21 A;  4IY5 A;  4I62 A;  4PET A;  3PPP A;  1DPE A;  3MZ1 A;  3EHU A;  2XD2 A;  3ONM A;  1IXH A;  2O84 X;  4KCD A;  5LOM A;  3M3F A;  1USY E;  4KR5 A;  4MF3 A;  1WOD A;  4F3S A;  3MWB A;  2ABH A;  3CIJ A;  3G7W A;  3UIF A;  2Y7W A;  4R2F A;  1B5I A;  2Y7I A;  1N7X A;  4R73 A;  4U4S A;  1BIY A;  3T93 B;  1OLA A;  4H8I A;  4QHQ A;  4ZZE A;  4C1T A;  1OQG A;  2F35 A;  4NF6 A;  3PUW E;  4GL0 A;  4YKJ A;  4BDL A;  1POY 1;  2A5T B;  3SEX A;  1B3L A;  2ZNT A;  1LB9 A;  4C0R A;  4X1B A;  4YKI A;  2DXY A;  4R75 A;  1MQH A;  5EHS A;  4YB6 A;  2HZL A;  4FEB A;  2DWI A;  5H8N A;  4N6P A;  1XOC A;  1QVS A;  1NNK A;  4RPN A;  4UA8 A;  2F78 A;  3SKP A;  1NNT A;  4BDO A;  4Q8R A;  1PB9 A;  2DWJ A;  2X7Q A;  4MBP A;  4HCW A;  3OEL A;  2GFE A;  3PV0 E;  2DWH A;  1FQB A;  4ZS9 A;  5H8S A;  5EHM A;  4QFK A;  2HAV A;  4MFI A;  2QKH A;  2W7Y A;  1YTV A;  1MY4 A;  4IO6 A;  3C9H A;  2QSX A;  2QJE A;  3OEK A;  1NH8 A;  3T22 A;  1OVT A;  1O63 A;  4N13 A;  1EH3 A;  4P0G A;  4R6Y A;  4JWX A;  4OVJ A;  1H3D A;  4OFL A;  4POX A;  1IZ1 A;  1JW4 A;  2ZYN A;  4QFO A;  3TCH A;  3C36 A;  3IL1 B;  2JNC A;  1NFT A;  3EPE A;  1IXG A;  3K1M A;  4ZEF A;  3T9V A;  1N0T A;  4X48 A;  4QFP A;  1T0K A;  1BTJ A;  3C59 A;  2Q9T A;  1Y3N A;  3T9U A;  4I1D A;  3QYT A;  3O6H A;  4G77 A;  4RYA A;  1MY1 A;  4H8J A;  3BFU A;  1PB8 A;  3IOT A;  1UIU A;  2RC8 A;  4QFN A;  3MP6 A;  5ITO A;  1SDX A;  1SYI A;  2F36 A;  4GD5 A;  1M5D A;  2XXI A;  2FA7 A;  2QMW A;  1ZMG A;  4IY6 A;  5JK4 A;  2FYI A;  3VVD A;  5B70 A;  1EZP A;  5ICQ A;  2B65 A;  4ERS A;  4NF6 B;  4FJP A;  3BKI B;  3PMW A;  5H8Q A;  2REJ A;  2AYS A;  1LFG A;  5L9O A;  2R9J A;  1IUD A;  3TPA A;  1LBC A;  4EUO A;  1B7U A;  3M3K A;  3TTR A;  1EZ9 A;  4OMB A;  4FED A;  4R2B A;  4IGR A;  1ANF A;  1SW4 A;  4ELR A;  1LAX A;  1ZJL A;  1ZIU A;  4FAJ A;  1XVX A;  5H8N B;  1JVY A;  3TAJ A;  2KLF A;  1ZLQ A;  1SW2 A;  3OXN A;  1Z7N E;  3VXB A;  3N6U A;  1D9V A;  5M2V A;  2O7I A;  4JBZ A;  2PVU A;  3S9E A;  3A09 A;  2Y7K A;  3CI8 A;  3GZG A;  3U8Q A;  1B5J A;  5AA4 A;  1FTK A;  4F1V A;  1Y3P A;  4DIG A;  1FCK A;  1QUL A;  3FIR A;  2A5S A;  3MC2 A;  4ESX A;  2OK2 A;  2JND A;  5CMK A;  1IIT A;  3VDF A;  1VFE A;  4M4G A;  1JET A;  2F5X A;  2B3F A;  2QRY A;  4POW A;  4F2O A;  1B5H A;  4XKP A;  1P1U A;  3U93 A;  1SW1 A;  3FAS A;  1B1H A;  4R6H A;  1MY2 A;  3EHS A;  1B40 A;  1N84 A;  4DLQ A;  1JEU A;  1MXX A;  1LLS A;  4GF8 A;  3I6V A;  4KYS A;  2UXA A;  4QSD A;  1IXI A;  4DLO A;  4P11 A;  3IJX B;  4F18 A;  1HSE A;  3GBA A;  5CI5 A;  3PU5 A;  1M5B A;  3KBR A;  1NL5 A;  3DP8 A;  4NF4 B;  2I6E A;  3JYR A;  4EQ7 A;  3THI A;  3SEY A;  3N26 A;  3TTL A;  4E0W A;  2DE4 A;  2GH9 A;  5AA2 D;  2HCA A;  1PBQ A;  1N3X A;  5TPA A;  1GR2 A;  2Z8D A;  1P1O A;  2ZNS A;  1USY H;  3KSX A;  4Z7E A;  1B2H A;  5I2K A;  2HAU A;  2ZYM A;  4ZZA A;  3UOR A;  2O68 A;  5FHO A;  4ONY A;  1GTK A;  1MXV A;  4GLI A;  2Q8J A;  4FE8 A;  4KYE A;  5L9S A;  2VP1 A;  3E9X A;  4OWD A;  4NF8 B;  3H6U A;  3QK6 A;  3FAT A;  3LC8 A;  2NWJ A;  4C1U A;  3RT6 B;  3V89 B;  2Z22 A;  3MVY A;  4PFU A;  3IK6 B;  3C32 A;  2DVC A;  4F31 B;  1N76 A;  1VR5 A;  3L6H A;  3PUY E;  3LSF B;  2DQV A;  4LAT A;  5ICT A;  5AA4 B;  1N7W A;  4GRK A;  2O1L A;  3FVO A;  5H8H A;  4IO3 A;  1PC3 A;  4PFW A;  4F22 A;  2A5T A;  3K6W A;  2GHA A;  2HFB A;  3SDF A;  4YAH X;  3FVK A;  4H1X A;  4DCY A;  3LR1 A;  2G29 A;  2QL3 A;  4BDM A;  1LAG E;  3N7P A;  4R9F A;  2F7A A;  1NNF A;  3I5O A;  3ILU B;  4AQ4 A;  4N07 A;  3AXF A;  4PFT A;  1QUI A;  3RN8 A;  1BP5 A;  4K3F A;  3P7I A;  1MQG A;  2M8C A;  4KYD A;  2ONR A;  3JV9 A;  3FXQ A;  1LCF A;  4BDN A;  1QUJ A;  1QKA A;  3RNN A;  4XTC Q;  3B6Q A;  1S9T A;  4QF9 A;  4X1D A;  5I59 A;  1IQ7 A;  1N04 A;  4YIC A;  1DTG A;  4NTL A;  1S7Y A;  4IO7 A;  1MG1 A;  4NWD A;  2F7B A;  2OJT A;  3K6X A;  3HN0 A;  1BKA A;  5I2K B;  1SI1 A;  2XD3 A;  4GWO A;  4ELO A;  4PQJ A;  2PYY A;  1AOV A;  3TKD A;  3C4M A;  1SQY A;  3KN7 A;  3UK4 A;  4WEP A;  4DCX A;  3V83 A;  5CMB A;  4I9D A;  3T9X B;  4JWO A;  1D3K A;  3VE1 B;  3RTF B;  3D4G A;  3MUQ A;  3O66 A;  1NNP A;  1FTO A;  4YKK A;  3RLF E;  5DYH A;  3ZKK A;  3EHT A;  4E0X A;  1LB8 A;  4R74 A;  2I49 A;  1IEJ A;  1FQE A;  3E4R A;  5H8H B;  1Q35 A;  2Y7R A;  4LZ5 A;  3ECR A;  3VV5 A;  3MVW A;  4WED A;  1Y9U A;  2I3V A;  3MVZ A;  3TQL A;  5ITP A;  1R9L A;  1F9B A;  4GXS B;  1H76 A;  4H5G A;  4HTG A;  4IGT A;  2H9B A;  2YJP A;  3CG1 A;  3HPI A;  3Q28 A;  4DXB A;  2PT2 A;  2Y7P A;  5TP9 A;  3OD7 A;  3MP8 A;  3A3C A;  1M5C A;  4F3P A;  3O2A A;  3SEV A;  3FXU A;  4H67 A;  1LAH E;  3H4Z A;  2H98 A;  5CC2 A;  5DVF A;  3TFL A;  3DEL B;  4PP0 A;  4ND9 A;  2ZNU A;  2ONS A;  4DLD A;  2V84 A;  3PPO A;  4OER A;  2Y84 A;  3QUF A;  3PMV A;  3FV1 A;  4DXC A;  2GRV A;  3RUM A;  4EXL A;  1B4H A;  3K2D A;  4GIZ A;  5I59 B;  1D9Y A;  4EDP A;  1ZTY A;  3CSG A;  1EZO A;  1NMU A;  4LUB A;  2OBG A;  3N5L A;  1AMF A;  2IA4 A;  4HCY A;  3IJO B;  3CFL A;  4ZGM A;  1VSO A;  2H5Y A;  2XXT A;  4KHZ E;  2QPQ A;  4EQB A;  2UVI A;  3K02 A;  5II0 A;  2ZXT A;  5A5X A;  5CBS A;  3O28 A;  1US5 A;  1B7Z A;  1AIV A;  4JSO A;  2HZK A;  3S9L C;  2NUV A;  1LFI A;  3JZJ A;  3FXR A;  1U34 A;  5DVI A;  1UTB A;  4BDQ A;  3PPR A;  2CMO A;  1A7L A;  2I0C A;  2IEE A;  3Q27 A;  3IX1 A;  3ILT B;  3I3V A;  3IOR A;  2F7C A;  2H4I A;  4NF4 A;  5KDT A;  2H99 A;  2R6G E;  1MPB A;  3VLW A;  1VE4 A;  2H25 A;  1SW5 A;  1PB7 A;  3QSL A;  3C34 A;  2RKM A;  3U92 A;  3IOW A;  2FNC A;  2XX9 A;  1TXF A;  1URG A;  1XHY A;  3TUS A;  3UGW A;  1IXC A;  4U23 A;  4RXL A;  3EN3 A;  3MZ9 A;  1MQD A;  1TWY A;  3VVF A;  1MPD A;  4WKM A;  4NF8 A;  5TP9 B;  3UA8 A;  5HPQ A;  4WXJ A;  1ZBM A;  5H8F B;  3G3K A;  3RPW A;  1B52 A;  1SBP A;  5DT6 A;  3CSB A;  5I84 A;  1NH7 A;  1Y4C A;  1O7T A;  3S9M C;  2QS2 A;  1JQF A;  3C31 A;  2Q88 A;  3TMG A;  1QJM A;  3N7S A;  3HST A;  3G3G A;  1Y3Q A;  1MXZ A;  3KZG A;  5HM4 B;  1HSL A;  1DSN A;  1P1Q A;  5IAI A;  1DPP A;  4HS7 A;  4KI0 E;  1A54 A;  4G8N A;  2XXW A;  3E13 X;  3PPN A;  1B0H A;  2O51 A;  2V25 A;  3KGC A;  3SER A;  4Z0I A;  1MY3 A;  4F29 A;  4IO2 A;  1OIB A;  3QIM A;  3ZS6 A;  1B7H A;  3VLV A;  4H6D A;  1BLF A;  3U94 A;  3MQ9 A;  4OTE A;  3G3J A;  4YU0 A;  3H3G A;  4ZE9 A;  4OET A;  2P1S A;  4GQO A;  4Q5T A;  3TTK A;  5CMM A;  1OVB A;  3CG3 A;  1UQW A;  1LBB A;  4OZ9 A;  2NVU B;  1A40 A;  3DLN A;  5A5X B;  1RYX A;  2DE2 A;  4JXI A;  1Y1M A;  5FHM A;  3OO6 A;  4RJZ A;  3PD8 A;  1PDA A;  1UTB B;  4P0I A;  2VGQ A;  4AB5 A;  4LQ5 A;  3OEM A;  2F6G A;  4QSE A;  1SI0 A;  5KDT B;  3LUY A;  3H03 A;  1MY0 A;  3MW0 A;  4GOT A;  4FEC A;  3ZKL A;  3VXC A;  2QS1 A;  2UYF A;  3UN6 A;  1B32 A;  5K2X A;  5I57 B;  3O97 A;  3K0V A;  4DXU A;  4LA9 A;  2Q2C A;  2OLB A;  1NKX A;  1LFH A;  2XDG A;  5I58 B;  1FTJ A;  2DSF A;  5BUU A;  4GL8 A;  1TT1 A;  3CVG A;  3K01 A;  1Z7M E;  4F1Y A;  2PT1 A;  2V93 A;  4MH5 A;  2O7U A;  2PMS A;  2XXV A;  1II5 A;  2G93 A;  3ODB A;  3QUJ A;  3QXM A;  4QSC A;  2F8D A;  2I4C A;  2QS4 A;  3FZV A;  4NF5 B;  2DS9 A;  1L5T A;  3V5A A;  4ELQ A;  1XVY A;  4NMY A;  5I2N B;  5K2Y A;  5FHN A;  2O1M A;  3EQ1 A;  5DEX A;  4ZDM A;  1LAF E;  1MXW A;  2VD3 A;  2Z23 A;  4H65 A;  4LVQ A;  3DP6 A;  4LQ2 A;  2XX7 A;  2AL5 A;  3S4U A;  5I56 A;  3LBS A;  4LZ7 A;  2ALU A;  1I6Q A;  1R1N A;  2P0S A;  1SD3 A;  2L27 A;  2GHB A;  4ELP A;  4YB5 A;  3KN3 A;  4JWY A;  5CM6 A;  4EF2 A;  4G68 B;  1CE2 A;  3TEP A; 
#chains in the Genus database with same CATH topology
 3KOS A;  4QFL A;  2DYX A;  3SES A;  1FQC A;  4G8H A;  3QAX A;  3VLU A;  4N6K A;  4UAC A;  3GLB A;  4PGP A;  3F11 A;  5KCJ B;  3VFJ A;  1VDW A;  3PUX E;  3Q25 A;  3CFZ A;  1B3H A;  1MQJ A;  3FD3 A;  1JW5 A;  1FQF A;  4ZE8 A;  4RNS A;  1FTM A;  2Z8F A;  4JB7 A;  3O9P A;  1CB6 A;  2DXR A;  4KPT A;  5EYF A;  2XXX A;  3ROJ A;  3H7M A;  3FVN A;  4EF1 A;  1M5E A;  1IIW A;  1RDY A;  1KWH A;  3T9H B;  1XC1 A;  1R9Q A;  3HHG A;  4RY1 A;  3PGF A;  3D4C A;  4EQ9 A;  1Y1Z A;  5DTB A;  3MVX A;  5B7D A;  3IB1 A;  3O29 A;  3KSJ A;  4YB7 A;  3AQF B;  1A8E A;  5L8D A;  4TOZ A;  1EYI A;  3IOU A;  3O6I A;  2E1S A;  4N4U A;  1JW1 A;  5FTI A;  2RCB A;  1MQI A;  1LST A;  4OHN A;  4F3G A;  4MAG A;  4BDR A;  3B6W A;  1RKM A;  4ZEC A;  1P1W A;  2AL4 A;  4RA1 A;  2VOZ A;  4OYV A;  2VHA A;  4U2R A;  4MNP A;  5I3S A;  1YXI A;  4NE4 A;  2ANJ A;  3N6T A;  3TOD A;  4OQO A;  1MXU A;  4IB2 A;  4JDF A;  1B4Z A;  2XXP A;  4OES A;  3HHF A;  4OEU A;  5AA2 A;  5DEX B;  2V3U A;  1MS7 A;  1WDN A;  1M5F A;  4ZEB A;  3C5T A;  1H45 A;  2Z8E A;  3G3H A;  3IR1 A;  1QW0 A;  4XKR A;  5I56 B;  1MM6 A;  1B51 A;  3KG2 A;  4IO5 A;  4N8Y A;  3K1N A;  4PGN A;  4KFQ A;  2X7P A;  4I8C A;  5F7V A;  4RK9 A;  3Q29 A;  1URD A;  1EU8 A;  3TTN A;  2ZYK A;  4O94 A;  2OCU A;  4N6D A;  4MJO A;  1GVC A;  3A3U A;  3IOL A;  3BIG A;  3RT8 A;  4H0W A;  2FIE A;  2QVR A;  2DE3 A;  3OO9 A;  1R6Z A;  5F24 A;  1MXY A;  3G3F A;  3KC0 A;  3V8X B;  2OWS A;  2ONK E;  1MRP A;  1URS A;  5JEI A;  5H8F A;  1OQH A;  4OA4 A;  2DVZ A;  5L9M A;  5BWJ A;  3GBB A;  3B7D A;  4U1O A;  1OLC A;  3TEL A;  3W9V A;  3MJN A;  4OEN A;  5CMC A;  3U65 A;  2WYP A;  2XHD A;  3OOA A;  4NHB A;  1JNF A;  3MPK A;  3IOV A;  4FAT A;  4TLL B;  4R72 A;  2FBP A;  1B6H A;  2CZL A;  2OZZ A;  4JVC A;  4MEV A;  4BLA A;  4NX1 A;  2D5W A;  5ELV A;  1A55 A;  2O6A A;  1P99 A;  1US4 A;  3CRB A;  1AH5 A;  3K6V A;  4U1Z A;  2NOO A;  1J1N A;  1I6A A;  3R6U A;  2PX1 A;  4PFY A;  3B50 A;  1LBX A;  4XIG Q;  3H6T A;  4KXP A;  4I3Y A;  4U22 A;  3IO6 A;  1LGB C;  2RF1 A;  4O3A A;  4F2Q A;  3T66 A;  2I4B A;  1SYH A;  3FJG A;  3RTW B;  4GVO A;  4PBH A;  1P1N A;  1UIV A;  2I58 A;  2WBD A;  1A8F A;  3PUZ E;  2WKY A;  1RDX A;  5CBR A;  1NI9 A;  2ZZX A;  1B1X A;  2PFY A;  3UP9 A;  1B3F A;  4MLQ A;  1POT A;  1B3E A;  2UVJ A;  4GFR A;  5AA2 B;  4GWU A;  4MLV A;  1YCJ A;  3KEI A;  3IB2 A;  2ZZV A;  4PE5 B;  2THI A;  4U4X A;  1IMA A;  4NN3 A;  2PBW A;  5IZ3 B;  4YMB A;  4PDH A;  4ECF A;  2XWV A;  2ZYO A;  1QKB A;  5I57 A;  3L2J A;  3TCG A;  3N94 A;  3H6V A;  2Q89 A;  1HSJ A;  3HO7 A;  4IR8 A;  4DZ1 A;  3OO8 A;  4DE8 A;  3S9N C;  4GXA A;  2R71 A;  4NED A;  5I58 A;  1DMB A;  3H06 B;  1UTH A;  4Q0C A;  4ESW A;  3KBZ A;  2HXW A;  1SPI A;  1PBP A;  2UVG A;  4NWC A;  3GXA A;  4KQP A;  4PC9 A;  3RQT A;  1ZKB A;  3MPL A;  3TDJ A;  1FBE A;  1QGX A;  2LAO A;  3FJM A;  5AA3 A;  2D21 A;  4R9G A;  3FVG A;  3TQW A;  2DOJ A;  3K4U A;  2YLN A;  1QUK A;  3SEW A;  1AWB A;  2VT5 A;  4NF5 A;  2F97 A;  3SET A;  3D1R A;  1I6B A;  1ATG A;  3A29 A;  3K1P A;  3PUV E;  5I2N A;  3E3K A;  1DOT A;  3N7R A;  4KD5 A;  4X9T A;  3FGS A;  4HW8 A;  1B46 A;  4TLM B;  3OO7 A;  1O64 A;  3PPQ A;  3PMX A;  1FJ9 A;  5AE4 A;  3TTM A;  3IB0 A;  3KJ7 A;  3M3L A;  4JSD A;  4OFO A;  5HBC A;  3ZSF A;  4YZZ A;  5FTH A;  4OVQ A;  4P1E A;  1VFD A;  4MX6 A;  1MDP 1;  5IM2 A;  3LV0 A;  3CR9 A;  3BBR A;  3Q26 A;  1FQA A;  1YPN A;  2REG A;  4ZED A;  4QRZ A;  2OWT A;  4G68 A;  1A99 A;  1B9J A;  2V3Q A;  1XI6 A;  3H6W A;  2P2A A;  1AL3 A;  4AS4 A;  5KZT A;  3CFX A;  4H45 A;  3EF7 A;  2XXY A;  3PD9 A;  1G0H A;  3RY3 A;  5KCJ A;  4GBW A;  4O3B A;  3IAZ A;  2XXQ A;  1GGG A;  3T96 B;  4ISU A;  3KOT A;  1INP A;  4M1V A;  4KCC A;  3ISP A;  3L6G A;  1OMP A;  3HV1 A;  3VVE A;  1B05 A;  4THI A;  3WAF A;  3U1O A;  1XT8 A;  3MP1 A;  5DVJ A;  1Y20 A;  3G3I A;  4X8R A;  4OVT A;  3W15 C;  5J16 A;  2UYE A;  4R6K A;  1S50 A;  4XFE A;  2XX8 A;  4L17 A;  1FBP A;  4OFJ A;  2UVH A;  3IO4 A;  4F1U A;  5IZZ A;  4QXD A;  5JTY A;  3MZB A;  4LP2 B;  3KFM A;  1FSA A;  2ESN A;  3R26 A;  1MM7 A;  5IZ1 A;  4LON B;  4P9K A;  1LBZ A;  1H44 A;  1RYO A;  5ISU A;  3U72 A;  1UTH B;  3W9W A;  4LF3 C;  2RC7 A;  3KC1 A;  2I48 A;  1MDQ A;  3E78 A;  1ELJ A;  3BIH A;  4P56 A;  3WAE A;  5H8Q B;  1XS5 A;  1H43 A;  4YMA A;  3OMB A;  4XKQ A;  2I0B A;  3SEU A;  4XKN A;  4O3C A;  2VD2 A;  2QFL A;  4PTK A;  1LCT A;  2XXR A;  4H5F A;  3K00 A;  2Q2A A;  2F34 A;  3MAM A;  4PFB A;  2F6P A;  3OSR A;  1JVX A;  3BFT A;  2HQ0 A;  3C33 A;  3DP4 A;  3RGY A;  4EXK A;  3OEN A;  1Q1K A;  3MBP A;  1FTL A;  2B4L A;  2NXO A;  5CRY A;  5TU0 A;  2XXU A;  1I69 A;  3R7X A;  4G4P A;  2DWA A;  2O69 A;  5IKB A;  4ZEK A;  3TZA A;  4AB6 A;  3S2V A;  1KA1 A;  4OEV A;  2RC9 A;  1FW0 A;  2I3W A;  5AA1 A;  1DTZ A;  4XXU A;  3KJT A;  4OXV A;  1PEB A;  2D3I A;  4G8M A;  1B58 A;  2QS3 A;  2FVZ A;  1GV8 A;  4DDD A;  4N17 A;  3O6G A;  4FOR A;  1MH3 A;  5I5P A;  2DP8 A;  2JOD A;  4H46 A;  2B3B A;  2RCA A;  1B3G A;  4FIM A;  4Q30 B;  1MPC A;  1FQD A;  5J1D A;  4TQU Q;  4MIJ A;  1YAE A;  5ET8 A;  1TFD A;  3OSQ A;  4F3B A;  2QVU A;  2HEU A;  4G2Z A;  3TYH A;  4G68 C;  3FUZ A;  4LZ8 A;  4PAF A;  1Y4T A;  4N91 A;  3DM0 A;  1JEV A;  4F39 A;  1NV1 A;  5EQ9 A;  2RIN A;  5F1Q A;  4PF8 A;  3C35 A;  3LSL A;  1TFA A;  2YPN A;  3M8U A;  2Y5K A;  3K6U A;  2AIX A;  3KN8 A;  2XXH A;  2E0S A;  5EQ8 A;  3LSW A;  2HXR A;  3B6T A;  1D4N A;  3LSX A;  5I7I A;  3FV2 A;  3TCF A;  5JTY B;  1MH4 A;  1SVX B;  4YKP A;  1ZU0 A;  2ZMB A;  4RK2 A;  1FPB A;  1NV4 A;  1B0L A;  2V4C A;  4ZEI A;  2V3T A;  3USD A;  3CHG A;  3FJ7 A;  1N3W A;  4MNI A;  4HJ0 A;  2QMX A;  5TPA B;  1WVJ A;  1FPD A;  2X26 A;  3HCQ A;  4O8M A;  4GX4 A;  2BJJ X;  4IO4 A;  4F19 A;  4RPO A;  5LTC A;  4FBP A;  4U21 A;  4IY5 A;  1FPK A;  1DCU A;  3RYD A;  4I62 A;  2FIX A;  4PET A;  4NGU A;  3FBP A;  3PPP A;  1DPE A;  3MZ1 A;  3EHU A;  2XD2 A;  3ONM A;  1IXH A;  2O84 X;  4KCD A;  5LOM A;  3M3F A;  1USY E;  4KR5 A;  4MF3 A;  1WOD A;  5IZ3 A;  4F3S A;  3MWB A;  1NUW A;  2ABH A;  3CIJ A;  3G7W A;  3UIF A;  2Y7W A;  4R2F A;  1B5I A;  2Y7I A;  1N7X A;  4R73 A;  4U4S A;  1BIY A;  3T93 B;  1OLA A;  4H8I A;  4QHQ A;  4ZZE A;  2KR0 A;  4C1T A;  1OQG A;  2F35 A;  4NF6 A;  3PUW E;  4GL0 A;  2PFZ A;  4YKJ A;  4BDL A;  1POY 1;  2A5T B;  3SEX A;  1B3L A;  2ZNT A;  1LB9 A;  4C0R A;  4X1B A;  4YKI A;  2HPG A;  2DXY A;  4R75 A;  1MQH A;  5EHS A;  4YB6 A;  2HZL A;  4FEB A;  2DWI A;  5H8N A;  4N6P A;  1XOC A;  2OWZ A;  1QVS A;  1NNK A;  5T3J A;  4PFR A;  4RPN A;  4UA8 A;  2F78 A;  3SKP A;  1NNT A;  4BDO A;  4Q8R A;  1PB9 A;  2DWJ A;  4GBV A;  2X7Q A;  4MBP A;  4HCW A;  3OEL A;  2GFE A;  3PV0 E;  2DWH A;  1FQB A;  1FPL A;  4ZS9 A;  1NV0 A;  5H8S A;  5EHM A;  4I3E A;  4QFK A;  2HAV A;  3MYU A;  4GWY A;  4MFI A;  2QKH A;  2W7Y A;  1YTV A;  1MY4 A;  4IO6 A;  3C9H A;  2QVV A;  1NV5 A;  2QSX A;  2QJE A;  1IMB A;  3OEK A;  1NH8 A;  2ZZW A;  3T22 A;  1OVT A;  1O63 A;  4N13 A;  1EH3 A;  4P0G A;  4R6Y A;  4JWX A;  4OVJ A;  1H3D A;  4OFL A;  4MNC A;  4POX A;  2B4M A;  1IZ1 A;  1JW4 A;  2ZYN A;  4NF0 A;  4QFO A;  3TCH A;  3C36 A;  3IL1 B;  2JNC A;  1NFT A;  3EPE A;  1IXG A;  3K1M A;  2Q74 A;  4ZEF A;  3T9V A;  1N0T A;  4X48 A;  4QFP A;  1LEV A;  1T0K A;  1BTJ A;  2P3V A;  3C59 A;  2Q9T A;  1Y3N A;  3T9U A;  4I1D A;  3QYT A;  3O6H A;  4G77 A;  4RYA A;  1MY1 A;  4H8J A;  3BFU A;  1PB8 A;  3IOT A;  1UIU A;  2RC8 A;  4QFN A;  3MP6 A;  5ITO A;  1K9Z A;  1SDX A;  1SYI A;  1FRP A;  2F36 A;  3IFA A;  4GD5 A;  1M5D A;  2XXI A;  2FA7 A;  3MST A;  2QMW A;  1ZMG A;  4IY6 A;  5JK4 A;  1CNQ A;  2FYI A;  3VVD A;  5B70 A;  1IME A;  2BJI A;  1EZP A;  5ICQ A;  2B65 A;  1JP4 A;  4ERS A;  4NF6 B;  1YZ0 A;  4FJP A;  3BKI B;  3PMW A;  5H8Q A;  2REJ A;  2AYS A;  1LFG A;  5L9O A;  2R9J A;  1IUD A;  3TPA A;  1LBC A;  4EUO A;  1B7U A;  1LBV A;  3M3K A;  3TTR A;  1EZ9 A;  4OMB A;  2XA5 A;  4FED A;  4R2B A;  4IGR A;  1ANF A;  1SW4 A;  4ELR A;  1LAX A;  1ZJL A;  1ZIU A;  4FAJ A;  1FBH A;  2CZK A;  1XVX A;  5H8N B;  1JVY A;  3TAJ A;  2KLF A;  1ZLQ A;  1KA0 A;  1SW2 A;  3OXN A;  1Z7N E;  3VXB A;  4PBQ A;  2F3B A;  4OVS A;  3N6U A;  3FXB A;  1D9V A;  5M2V A;  2O7I A;  4JBZ A;  2PVU A;  3S9E A;  3A09 A;  3T0J A;  2Y7K A;  3CI8 A;  3GZG A;  4P8B A;  3U8Q A;  1B5J A;  5AA4 A;  1FTK A;  4F1V A;  1Y3P A;  2Y5L A;  4DIG A;  1FCK A;  1QUL A;  3FIR A;  4HE0 A;  2A5S A;  3MC2 A;  4ESX A;  2OK2 A;  2JND A;  5CMK A;  1IIT A;  5EYH A;  3VDF A;  1VFE A;  4M4G A;  1JET A;  1NUY A;  2F5X A;  4I40 A;  2B3F A;  2QRY A;  4POW A;  4HXV A;  4F2O A;  1B5H A;  1NV2 A;  4XKP A;  1P1U A;  3U93 A;  4G61 A;  1SW1 A;  3FAS A;  1B1H A;  4R6H A;  1MY2 A;  4DI3 D;  3EHS A;  1B40 A;  4O7M A;  1N84 A;  4DLQ A;  1JEU A;  1EYJ A;  1MXX A;  1LLS A;  4GF8 A;  3I6V A;  2CEY A;  4KYS A;  2UXA A;  4N15 A;  4QSD A;  1IXI A;  5ESY A;  4DLO A;  4P11 A;  2CEX A;  3IJX B;  4F18 A;  1HSE A;  3GBA A;  5CI5 A;  3PU5 A;  1M5B A;  3KBR A;  1NL5 A;  3DP8 A;  4NAP A;  4NF4 B;  5ET5 A;  2I6E A;  3JYR A;  1IMF A;  4HE2 A;  4EQ7 A;  3THI A;  3SEY A;  3N26 A;  3TTL A;  4E0W A;  2DE4 A;  2GH9 A;  5AA2 D;  2HCA A;  1NUX A;  1PBQ A;  1N3X A;  1FPF A;  5TPA A;  1GR2 A;  2Z8D A;  1P1O A;  2ZNS A;  1USY H;  3KSX A;  4Z7E A;  1B2H A;  2OX3 A;  5I2K A;  2HAU A;  2ZYM A;  4ZZA A;  3UOR A;  2O68 A;  3EKI A;  5FHO A;  2Q8M A;  1Q9D A;  4ONY A;  1GTK A;  1MXV A;  4GLI A;  2Q8J A;  4FE8 A;  4KYE A;  5L9S A;  2VP1 A;  3E9X A;  4OWD A;  4NF8 B;  3H6U A;  4LN5 A;  2CZH A;  3QK6 A;  1NV6 A;  3FAT A;  3LC8 A;  2NWJ A;  4C1U A;  3RT6 B;  3V89 B;  1BK4 A;  2Z22 A;  3MVY A;  4PFU A;  3IK6 B;  3C32 A;  2DVC A;  4F31 B;  1N76 A;  1VR5 A;  3L6H A;  1DK4 A;  3PUY E;  3LSF B;  2DQV A;  4LAT A;  5ICT A;  5AA4 B;  1N7W A;  4GRK A;  2O1L A;  2L5V A;  3FVO A;  5H8H A;  4IO3 A;  1PC3 A;  1FJ6 A;  4PFW A;  4F22 A;  2VPO A;  2A5T A;  3K6W A;  4PF6 A;  2GHA A;  2HFB A;  3SDF A;  5EQ7 A;  4YAH X;  3FVK A;  4H1X A;  4DCY A;  3LR1 A;  2G29 A;  2QL3 A;  1DBZ A;  4BDM A;  3T1B A;  1LAG E;  3N7P A;  2WEF A;  4R9F A;  2CZI A;  2DDK A;  4NQ8 A;  2F7A A;  4JVI A;  1NNF A;  3I5O A;  4P47 A;  3ILU B;  4AQ4 A;  4N07 A;  3AXF A;  4PFT A;  5IGA A;  1QUI A;  3RN8 A;  1BP5 A;  4K3F A;  3P7I A;  1MQG A;  3RPL A;  3B8B A;  2M8C A;  4KYD A;  2ONR A;  3JV9 A;  3FXQ A;  1LCF A;  4BDN A;  1QUJ A;  4MMP A;  1QKA A;  5A5L A;  3RNN A;  4XTC Q;  3B6Q A;  1S9T A;  4QF9 A;  4X1D A;  1FTA A;  5I59 A;  1IQ7 A;  1N04 A;  2FHY A;  4YIC A;  1DTG A;  4NTL A;  4IO7 A;  1S7Y A;  1MG1 A;  4NWD A;  2F7B A;  2OJT A;  3K6X A;  3HN0 A;  1BKA A;  2HHM A;  5I2K B;  1SI1 A;  2XD3 A;  4GWO A;  4ELO A;  4PQJ A;  4PDD A;  4PFI A;  1FBC A;  2PYY A;  1AOV A;  4NG7 A;  3TKD A;  4P1L A;  3C4M A;  1SQY A;  3KN7 A;  3UK4 A;  5ET7 A;  5FBP A;  4WEP A;  4DCX A;  4N8G A;  3V83 A;  4I9D A;  4JWO A;  5CMB A;  3T9X B;  1D3K A;  5EYG A;  4XEQ A;  3VE1 B;  3RTF B;  3D4G A;  3MUQ A;  3O66 A;  1NNP A;  1FTO A;  4YKK A;  3RLF E;  5DYH A;  3ZKK A;  3EHT A;  4E0X A;  2R8T A;  1LB8 A;  4R74 A;  2I49 A;  1IEJ A;  1FBF A;  1FQE A;  3E4R A;  5H8H B;  1Q35 A;  3LUZ A;  2Y7R A;  4LZ5 A;  3ECR A;  3VV5 A;  3MVW A;  1G0I A;  4WED A;  1Y9U A;  2I3V A;  3MVZ A;  3TQL A;  5ITP A;  1R9L A;  1F9B A;  4GXS B;  1H76 A;  4H5G A;  4HTG A;  4IGT A;  2H9B A;  2YJP A;  3CG1 A;  3HPI A;  3Q28 A;  4DXB A;  2PT2 A;  2Y7P A;  4N81 A;  4GX3 A;  5TP9 A;  3SZP A;  3OD7 A;  2WYK A;  3MP8 A;  3A3C A;  1M5C A;  4F3P A;  1FPE A;  3O2A A;  3SEV A;  3FXU A;  4H67 A;  1LAH E;  3H4Z A;  2H98 A;  5CC2 A;  5DVF A;  3RPL B;  3TFL A;  3DEL B;  4PP0 A;  4ND9 A;  2ZNU A;  2ONS A;  4DLD A;  2V84 A;  1K9Y A;  3PPO A;  4OER A;  2Y84 A;  3QUF A;  3PMV A;  4DI4 B;  3FV1 A;  4DXC A;  2GRV A;  4GWS A;  3RUM A;  4EXL A;  1B4H A;  2P3N A;  3K2D A;  4GIZ A;  1D9Y A;  5I59 B;  4EDP A;  1ZTY A;  3CSG A;  2WBB A;  4OVP A;  1EZO A;  1NMU A;  4LUB A;  2OBG A;  3N5L A;  1AMF A;  2IA4 A;  4HCY A;  3IJO B;  3CFL A;  4ZGM A;  1VSO A;  2H5Y A;  2XXT A;  2GQ1 A;  4KHZ E;  2QPQ A;  4EQB A;  2UVI A;  3QMF A;  3K02 A;  1RDZ A;  5II0 A;  2ZXT A;  5A5X A;  5CBS A;  4PAK A;  3O28 A;  1US5 A;  1B7Z A;  1AIV A;  4JSO A;  4JVD A;  2HZK A;  3S9L C;  1IMC A;  2NUV A;  2XWK A;  1LFI A;  3JZJ A;  3FXR A;  1U34 A;  5DVI A;  1FPJ A;  1UTB A;  4BDQ A;  3PPR A;  2CMO A;  1A7L A;  2I0C A;  4GX6 A;  4MCO A;  4AS5 A;  2IEE A;  3Q27 A;  2PCR A;  3HFU A;  3ILT B;  3I3V A;  3IOR A;  2F7C A;  3IX1 A;  4X04 A;  2H4I A;  4PAI A;  4NF4 A;  5KDT A;  2H99 A;  2R6G E;  1MPB A;  5ET6 A;  2XWI A;  5EQA A;  3VLW A;  1VE4 A;  2H25 A;  1SW5 A;  4GWW A;  1PB7 A;  3QSL A;  3C34 A;  2RKM A;  3U92 A;  3IOW A;  1LBW A;  2FNC A;  2XX9 A;  2XXK A;  1TXF A;  1URG A;  1XHY A;  1NUZ A;  1IMD A;  3TUS A;  2XWO A;  3UGW A;  1IXC A;  4U23 A;  4RXL A;  3EN3 A;  3MZ9 A;  1MQD A;  1TWY A;  3E79 A;  3VVF A;  1MPD A;  4WKM A;  4NF8 A;  1FPG A;  5TP9 B;  3NOH A;  4PCD A;  4WXJ A;  1ZBM A;  3UA8 A;  5HPQ A;  5H8F B;  3G3K A;  3RPW A;  1B52 A;  1SBP A;  5DT6 A;  3CSB A;  5I84 A;  1NH7 A;  1Y4C A;  1O7T A;  3S9M C;  2QS2 A;  1JQF A;  3C31 A;  2Q88 A;  3TMG A;  4P3L A;  1QJM A;  3N7S A;  3HST A;  3GYY A;  3G3G A;  4GWX A;  1Y3Q A;  4OVR A;  1MXZ A;  3KZG A;  5HM4 B;  1LBY A;  1HSL A;  1DSN A;  1P1Q A;  5IAI A;  1DPP A;  4HS7 A;  4KI0 E;  3IFC A;  1A54 A;  4G8N A;  2JJK A;  2XXW A;  3E13 X;  1FPI A;  3PPN A;  1B0H A;  2O51 A;  2V25 A;  3KGC A;  3SER A;  4Z0I A;  1MY3 A;  4F29 A;  4IO2 A;  3PTY A;  1OIB A;  2VPN A;  3QIM A;  3ZS6 A;  1B7H A;  3VLV A;  4H6D A;  1BLF A;  3U94 A;  3MQ9 A;  4OTE A;  3G3J A;  4YU0 A;  3H3G A;  4ZE9 A;  4OET A;  4HE1 A;  2P1S A;  4GQO A;  4Q5T A;  3TTK A;  5CMM A;  1OVB A;  3CG3 A;  1UQW A;  1LBB A;  4OZ9 A;  2NVU B;  1A40 A;  3DLN A;  5A5X B;  1FBG A;  1RYX A;  2DE2 A;  1EYK A;  4JXI A;  1Y1M A;  5FHM A;  3OO6 A;  4RJZ A;  3PD8 A;  1PDA A;  1UTB B;  4P0I A;  2VGQ A;  4AB5 A;  4LQ5 A;  1KZ8 A;  1NV3 A;  2F6G A;  3OEM A;  4QSE A;  1SI0 A;  5KDT B;  3LUY A;  3H03 A;  1MY0 A;  3MW0 A;  4GOT A;  4FEC A;  3ZKL A;  3VXC A;  2QS1 A;  2UYF A;  4QBA A;  4UAB A;  1D9Q A;  3UN6 A;  1B32 A;  5K2X A;  1NV7 A;  5I57 B;  3O97 A;  3K0V A;  4DXU A;  4LA9 A;  2Q2C A;  4MHF A;  2OLB A;  1NKX A;  1LFH A;  2XDG A;  2WX9 A;  5I58 B;  1FTJ A;  2DSF A;  4XF5 A;  5BUU A;  4GL8 A;  1TT1 A;  3CVG A;  3K01 A;  1Z7M E;  2PT1 A;  4F1Y A;  2V93 A;  4MH5 A;  2O7U A;  4GWZ A;  2PMS A;  2XXV A;  4PE3 A;  1II5 A;  2G93 A;  4O7I A;  3ODB A;  3QUJ A;  3QXM A;  4QSC A;  2F8D A;  2I4C A;  2QS4 A;  3FZV A;  4NF5 B;  2DS9 A;  1L5T A;  3V5A A;  4ELQ A;  1XVY A;  5LDZ A;  4NMY A;  5I2N B;  5K2Y A;  5FHN A;  4OAN A;  2O1M A;  3EQ1 A;  5DEX A;  4ZDM A;  1LAF E;  1MXW A;  2VD3 A;  2Z23 A;  4H65 A;  4LVQ A;  3DP6 A;  4LQ2 A;  2XX7 A;  2AL5 A;  3S4U A;  5I56 A;  3LBS A;  2MKZ A;  4LZ7 A;  2ALU A;  1I6Q A;  1R1N A;  1YYZ A;  2F3D A;  2P0S A;  1SD3 A;  2L27 A;  2GHB A;  1FBD A;  4ELP A;  4YB5 A;  3KN3 A;  2KQZ A;  4JWY A;  5CM6 A;  4EF2 A;  5DW8 A;  4G68 B;  1CE2 A;  3TEP A; 
#chains in the Genus database with same CATH homology
 3KOS A;  4QFL A;  2DYX A;  3SES A;  1FQC A;  4G8H A;  3QAX A;  3VLU A;  4UAC A;  3GLB A;  3F11 A;  5KCJ B;  3VFJ A;  3PUX E;  3Q25 A;  3CFZ A;  1B3H A;  1MQJ A;  3FD3 A;  1JW5 A;  1FQF A;  4ZE8 A;  4RNS A;  1FTM A;  2Z8F A;  4JB7 A;  3O9P A;  1CB6 A;  2DXR A;  4KPT A;  5EYF A;  2XXX A;  3H7M A;  3FVN A;  4EF1 A;  1M5E A;  1IIW A;  1KWH A;  3T9H B;  1XC1 A;  1R9Q A;  3HHG A;  4RY1 A;  3PGF A;  3D4C A;  4EQ9 A;  1Y1Z A;  5DTB A;  3MVX A;  5B7D A;  3IB1 A;  3O29 A;  3KSJ A;  4YB7 A;  3AQF B;  1A8E A;  5L8D A;  4TOZ A;  3IOU A;  3O6I A;  2E1S A;  1JW1 A;  5FTI A;  2RCB A;  1MQI A;  1LST A;  4OHN A;  4F3G A;  4BDR A;  3B6W A;  1RKM A;  4ZEC A;  1P1W A;  2AL4 A;  4RA1 A;  2VOZ A;  4OYV A;  2VHA A;  4U2R A;  4NE4 A;  2ANJ A;  3N6T A;  3TOD A;  4OQO A;  1MXU A;  4IB2 A;  4JDF A;  1B4Z A;  2XXP A;  4OES A;  3HHF A;  4OEU A;  5AA2 A;  5DEX B;  2V3U A;  1MS7 A;  1WDN A;  1M5F A;  4ZEB A;  3C5T A;  1H45 A;  2Z8E A;  3G3H A;  3IR1 A;  1QW0 A;  4XKR A;  5I56 B;  1MM6 A;  1B51 A;  3KG2 A;  4IO5 A;  3K1N A;  4KFQ A;  2X7P A;  4I8C A;  5F7V A;  4RK9 A;  3Q29 A;  1URD A;  1EU8 A;  3TTN A;  2ZYK A;  2OCU A;  1GVC A;  3A3U A;  3IOL A;  3RT8 A;  4H0W A;  3OO9 A;  2DE3 A;  1R6Z A;  1MXY A;  3G3F A;  3V8X B;  2OWS A;  2ONK E;  1MRP A;  1URS A;  5JEI A;  5H8F A;  1OQH A;  2DVZ A;  5L9M A;  5BWJ A;  3GBB A;  3B7D A;  4U1O A;  1OLC A;  3TEL A;  3W9V A;  3MJN A;  4OEN A;  5CMC A;  2XHD A;  3OOA A;  1JNF A;  3MPK A;  3IOV A;  4FAT A;  4TLL B;  4R72 A;  1B6H A;  2CZL A;  2OZZ A;  4BLA A;  2D5W A;  5ELV A;  1A55 A;  2O6A A;  1P99 A;  1US4 A;  3CRB A;  1AH5 A;  3K6V A;  4U1Z A;  2NOO A;  1J1N A;  1I6A A;  3R6U A;  2PX1 A;  4PFY A;  4XIG Q;  3H6T A;  4U22 A;  3IO6 A;  1LGB C;  2RF1 A;  4O3A A;  4F2Q A;  3T66 A;  2I4B A;  1SYH A;  3FJG A;  3RTW B;  4GVO A;  1P1N A;  1UIV A;  2I58 A;  1A8F A;  3PUZ E;  2WKY A;  5CBR A;  1B1X A;  3UP9 A;  1B3F A;  4MLQ A;  1POT A;  1B3E A;  2UVJ A;  4GFR A;  5AA2 B;  4MLV A;  1YCJ A;  3KEI A;  3IB2 A;  4PE5 B;  2THI A;  4U4X A;  2PBW A;  4YMB A;  4ECF A;  2ZYO A;  1QKB A;  5I57 A;  3L2J A;  3TCG A;  3N94 A;  3H6V A;  2Q89 A;  1HSJ A;  3HO7 A;  4DZ1 A;  3OO8 A;  4DE8 A;  3S9N C;  4GXA A;  2R71 A;  4NED A;  5I58 A;  1DMB A;  3H06 B;  1UTH A;  4Q0C A;  4ESW A;  2HXW A;  1PBP A;  2UVG A;  4NWC A;  3GXA A;  4KQP A;  3RQT A;  1ZKB A;  3MPL A;  3TDJ A;  2LAO A;  3FJM A;  5AA3 A;  2D21 A;  4R9G A;  3FVG A;  3TQW A;  2DOJ A;  3K4U A;  2YLN A;  1QUK A;  3SEW A;  3SET A;  4NF5 A;  2F97 A;  1I6B A;  1ATG A;  3K1P A;  3PUV E;  5I2N A;  3E3K A;  1DOT A;  3N7R A;  4KD5 A;  4X9T A;  3FGS A;  4HW8 A;  1B46 A;  4TLM B;  3OO7 A;  1O64 A;  3PPQ A;  3PMX A;  5AE4 A;  3TTM A;  3IB0 A;  3KJ7 A;  3M3L A;  4JSD A;  4OFO A;  5HBC A;  3ZSF A;  4YZZ A;  5FTH A;  1VFD A;  1MDP 1;  3CR9 A;  3BBR A;  3Q26 A;  1FQA A;  1YPN A;  2REG A;  4ZED A;  4QRZ A;  2OWT A;  4G68 A;  1A99 A;  1B9J A;  2V3Q A;  3H6W A;  2P2A A;  1AL3 A;  5KZT A;  3CFX A;  3EF7 A;  2XXY A;  3PD9 A;  5KCJ A;  3RY3 A;  4O3B A;  3IAZ A;  2XXQ A;  1GGG A;  3T96 B;  4ISU A;  3KOT A;  4M1V A;  4KCC A;  3L6G A;  1OMP A;  3HV1 A;  3VVE A;  1B05 A;  4THI A;  3WAF A;  3U1O A;  1XT8 A;  3MP1 A;  5DVJ A;  1Y20 A;  3G3I A;  3W15 C;  2UYE A;  4R6K A;  1S50 A;  2XX8 A;  4L17 A;  4OFJ A;  2UVH A;  3IO4 A;  4F1U A;  5JTY A;  3MZB A;  4LP2 B;  3KFM A;  2ESN A;  3R26 A;  1MM7 A;  4LON B;  1H44 A;  1RYO A;  5ISU A;  3U72 A;  1UTH B;  3W9W A;  4LF3 C;  2RC7 A;  2I48 A;  1MDQ A;  1ELJ A;  3WAE A;  5H8Q B;  1XS5 A;  1H43 A;  4YMA A;  3OMB A;  4XKQ A;  2I0B A;  3SEU A;  4XKN A;  4O3C A;  2VD2 A;  1LCT A;  2XXR A;  4H5F A;  3K00 A;  2Q2A A;  2F34 A;  3MAM A;  2F6P A;  3OSR A;  1JVX A;  3BFT A;  2HQ0 A;  3C33 A;  3DP4 A;  3RGY A;  4EXK A;  3OEN A;  1Q1K A;  3MBP A;  1FTL A;  2NXO A;  5CRY A;  5TU0 A;  2XXU A;  1I69 A;  3R7X A;  4G4P A;  2DWA A;  2O69 A;  5IKB A;  4ZEK A;  3TZA A;  4AB6 A;  3S2V A;  4OEV A;  2RC9 A;  1FW0 A;  2I3W A;  5AA1 A;  1DTZ A;  4XXU A;  3KJT A;  4OXV A;  1PEB A;  2D3I A;  4G8M A;  1B58 A;  2QS3 A;  1GV8 A;  4DDD A;  3O6G A;  4FOR A;  1MH3 A;  2DP8 A;  2JOD A;  2B3B A;  2RCA A;  1B3G A;  4FIM A;  4Q30 B;  1MPC A;  1FQD A;  5J1D A;  4TQU Q;  1YAE A;  1TFD A;  3OSQ A;  4F3B A;  2HEU A;  4G2Z A;  3TYH A;  4G68 C;  3FUZ A;  4LZ8 A;  1Y4T A;  3DM0 A;  1JEV A;  4F39 A;  5F1Q A;  2RIN A;  3C35 A;  3LSL A;  1TFA A;  2YPN A;  3M8U A;  3K6U A;  2AIX A;  3KN8 A;  2XXH A;  2E0S A;  3LSW A;  3B6T A;  1D4N A;  3LSX A;  3FV2 A;  3TCF A;  5JTY B;  1MH4 A;  1SVX B;  4YKP A;  1ZU0 A;  2ZMB A;  4RK2 A;  1B0L A;  4ZEI A;  2V3T A;  3USD A;  3FJ7 A;  1N3W A;  4HJ0 A;  2QMX A;  5TPA B;  1WVJ A;  2X26 A;  3HCQ A;  2BJJ X;  4IO4 A;  4F19 A;  4RPO A;  4U21 A;  4IY5 A;  4I62 A;  4PET A;  3PPP A;  1DPE A;  3MZ1 A;  3EHU A;  2XD2 A;  3ONM A;  1IXH A;  2O84 X;  4KCD A;  5LOM A;  3M3F A;  1USY E;  4KR5 A;  4MF3 A;  1WOD A;  4F3S A;  3MWB A;  2ABH A;  3CIJ A;  3G7W A;  3UIF A;  2Y7W A;  4R2F A;  1B5I A;  2Y7I A;  1N7X A;  4R73 A;  4U4S A;  1BIY A;  3T93 B;  1OLA A;  4H8I A;  4QHQ A;  4ZZE A;  4C1T A;  1OQG A;  2F35 A;  4NF6 A;  3PUW E;  4GL0 A;  4YKJ A;  4BDL A;  1POY 1;  2A5T B;  3SEX A;  1B3L A;  2ZNT A;  1LB9 A;  4C0R A;  4X1B A;  4YKI A;  2DXY A;  4R75 A;  1MQH A;  5EHS A;  4YB6 A;  2HZL A;  4FEB A;  2DWI A;  5H8N A;  4N6P A;  1XOC A;  1QVS A;  1NNK A;  4RPN A;  4UA8 A;  2F78 A;  3SKP A;  1NNT A;  4BDO A;  4Q8R A;  1PB9 A;  2DWJ A;  2X7Q A;  4MBP A;  4HCW A;  3OEL A;  2GFE A;  3PV0 E;  2DWH A;  1FQB A;  4ZS9 A;  5H8S A;  5EHM A;  4QFK A;  2HAV A;  4MFI A;  2QKH A;  2W7Y A;  1YTV A;  1MY4 A;  4IO6 A;  3C9H A;  2QSX A;  2QJE A;  3OEK A;  1NH8 A;  3T22 A;  1OVT A;  1O63 A;  4N13 A;  1EH3 A;  4P0G A;  4R6Y A;  4JWX A;  4OVJ A;  1H3D A;  4OFL A;  4POX A;  1IZ1 A;  1JW4 A;  2ZYN A;  4QFO A;  3TCH A;  3C36 A;  3IL1 B;  2JNC A;  1NFT A;  3EPE A;  1IXG A;  3K1M A;  4ZEF A;  3T9V A;  1N0T A;  4X48 A;  4QFP A;  1T0K A;  1BTJ A;  3C59 A;  2Q9T A;  1Y3N A;  3T9U A;  4I1D A;  3QYT A;  3O6H A;  4G77 A;  4RYA A;  1MY1 A;  4H8J A;  3BFU A;  1PB8 A;  3IOT A;  1UIU A;  2RC8 A;  4QFN A;  3MP6 A;  5ITO A;  1SDX A;  1SYI A;  2F36 A;  4GD5 A;  1M5D A;  2XXI A;  2FA7 A;  2QMW A;  1ZMG A;  4IY6 A;  5JK4 A;  2FYI A;  3VVD A;  5B70 A;  1EZP A;  5ICQ A;  2B65 A;  4ERS A;  4NF6 B;  4FJP A;  3BKI B;  3PMW A;  5H8Q A;  2REJ A;  2AYS A;  1LFG A;  5L9O A;  2R9J A;  1IUD A;  3TPA A;  1LBC A;  4EUO A;  1B7U A;  3M3K A;  3TTR A;  1EZ9 A;  4OMB A;  4FED A;  4R2B A;  4IGR A;  1ANF A;  1SW4 A;  4ELR A;  1LAX A;  1ZJL A;  1ZIU A;  4FAJ A;  1XVX A;  5H8N B;  1JVY A;  3TAJ A;  2KLF A;  1ZLQ A;  1SW2 A;  3OXN A;  1Z7N E;  3VXB A;  3N6U A;  1D9V A;  5M2V A;  2O7I A;  4JBZ A;  2PVU A;  3S9E A;  3A09 A;  2Y7K A;  3CI8 A;  3GZG A;  3U8Q A;  1B5J A;  5AA4 A;  1FTK A;  4F1V A;  1Y3P A;  4DIG A;  1FCK A;  1QUL A;  3FIR A;  2A5S A;  3MC2 A;  4ESX A;  2OK2 A;  2JND A;  5CMK A;  1IIT A;  3VDF A;  1VFE A;  4M4G A;  1JET A;  2F5X A;  2B3F A;  2QRY A;  4POW A;  4F2O A;  1B5H A;  4XKP A;  1P1U A;  3U93 A;  1SW1 A;  3FAS A;  1B1H A;  4R6H A;  1MY2 A;  3EHS A;  1B40 A;  1N84 A;  4DLQ A;  1JEU A;  1MXX A;  1LLS A;  4GF8 A;  3I6V A;  4KYS A;  2UXA A;  4QSD A;  1IXI A;  4DLO A;  4P11 A;  3IJX B;  4F18 A;  1HSE A;  3GBA A;  5CI5 A;  3PU5 A;  1M5B A;  3KBR A;  1NL5 A;  3DP8 A;  4NF4 B;  2I6E A;  3JYR A;  4EQ7 A;  3THI A;  3SEY A;  3N26 A;  3TTL A;  4E0W A;  2DE4 A;  2GH9 A;  5AA2 D;  2HCA A;  1PBQ A;  1N3X A;  5TPA A;  1GR2 A;  2Z8D A;  1P1O A;  2ZNS A;  1USY H;  3KSX A;  4Z7E A;  1B2H A;  5I2K A;  2HAU A;  2ZYM A;  4ZZA A;  3UOR A;  2O68 A;  5FHO A;  4ONY A;  1GTK A;  1MXV A;  4GLI A;  2Q8J A;  4FE8 A;  4KYE A;  5L9S A;  2VP1 A;  3E9X A;  4OWD A;  4NF8 B;  3H6U A;  3QK6 A;  3FAT A;  3LC8 A;  2NWJ A;  4C1U A;  3RT6 B;  3V89 B;  2Z22 A;  3MVY A;  4PFU A;  3IK6 B;  3C32 A;  2DVC A;  4F31 B;  1N76 A;  1VR5 A;  3L6H A;  3PUY E;  3LSF B;  2DQV A;  4LAT A;  5ICT A;  5AA4 B;  1N7W A;  4GRK A;  2O1L A;  3FVO A;  5H8H A;  4IO3 A;  1PC3 A;  4PFW A;  4F22 A;  2A5T A;  3K6W A;  2GHA A;  2HFB A;  3SDF A;  4YAH X;  3FVK A;  4H1X A;  4DCY A;  3LR1 A;  2G29 A;  2QL3 A;  4BDM A;  1LAG E;  3N7P A;  4R9F A;  2F7A A;  1NNF A;  3I5O A;  3ILU B;  4AQ4 A;  4N07 A;  3AXF A;  4PFT A;  1QUI A;  3RN8 A;  1BP5 A;  4K3F A;  3P7I A;  1MQG A;  2M8C A;  4KYD A;  2ONR A;  3JV9 A;  3FXQ A;  1LCF A;  4BDN A;  1QUJ A;  1QKA A;  3RNN A;  4XTC Q;  3B6Q A;  1S9T A;  4QF9 A;  4X1D A;  5I59 A;  1IQ7 A;  1N04 A;  4YIC A;  1DTG A;  4NTL A;  1S7Y A;  4IO7 A;  1MG1 A;  4NWD A;  2F7B A;  2OJT A;  3K6X A;  3HN0 A;  1BKA A;  5I2K B;  1SI1 A;  2XD3 A;  4GWO A;  4ELO A;  4PQJ A;  2PYY A;  1AOV A;  3TKD A;  3C4M A;  1SQY A;  3KN7 A;  3UK4 A;  4WEP A;  4DCX A;  3V83 A;  5CMB A;  4I9D A;  3T9X B;  4JWO A;  1D3K A;  3VE1 B;  3RTF B;  3D4G A;  3MUQ A;  3O66 A;  1NNP A;  1FTO A;  4YKK A;  3RLF E;  5DYH A;  3ZKK A;  3EHT A;  4E0X A;  1LB8 A;  4R74 A;  2I49 A;  1IEJ A;  1FQE A;  3E4R A;  5H8H B;  1Q35 A;  2Y7R A;  4LZ5 A;  3ECR A;  3VV5 A;  3MVW A;  4WED A;  1Y9U A;  2I3V A;  3MVZ A;  3TQL A;  5ITP A;  1R9L A;  1F9B A;  4GXS B;  1H76 A;  4H5G A;  4HTG A;  4IGT A;  2H9B A;  2YJP A;  3CG1 A;  3HPI A;  3Q28 A;  4DXB A;  2PT2 A;  2Y7P A;  5TP9 A;  3OD7 A;  3MP8 A;  3A3C A;  1M5C A;  4F3P A;  3O2A A;  3SEV A;  3FXU A;  4H67 A;  1LAH E;  3H4Z A;  2H98 A;  5CC2 A;  5DVF A;  3TFL A;  3DEL B;  4PP0 A;  4ND9 A;  2ZNU A;  2ONS A;  4DLD A;  2V84 A;  3PPO A;  4OER A;  2Y84 A;  3QUF A;  3PMV A;  3FV1 A;  4DXC A;  2GRV A;  3RUM A;  4EXL A;  1B4H A;  3K2D A;  4GIZ A;  5I59 B;  1D9Y A;  4EDP A;  1ZTY A;  3CSG A;  1EZO A;  1NMU A;  4LUB A;  2OBG A;  3N5L A;  1AMF A;  2IA4 A;  4HCY A;  3IJO B;  3CFL A;  4ZGM A;  1VSO A;  2H5Y A;  2XXT A;  4KHZ E;  2QPQ A;  4EQB A;  2UVI A;  3K02 A;  5II0 A;  2ZXT A;  5A5X A;  5CBS A;  3O28 A;  1US5 A;  1B7Z A;  1AIV A;  4JSO A;  2HZK A;  3S9L C;  2NUV A;  1LFI A;  3JZJ A;  3FXR A;  1U34 A;  5DVI A;  1UTB A;  4BDQ A;  3PPR A;  2CMO A;  1A7L A;  2I0C A;  2IEE A;  3Q27 A;  3IX1 A;  3ILT B;  3I3V A;  3IOR A;  2F7C A;  2H4I A;  4NF4 A;  5KDT A;  2H99 A;  2R6G E;  1MPB A;  3VLW A;  1VE4 A;  2H25 A;  1SW5 A;  1PB7 A;  3QSL A;  3C34 A;  2RKM A;  3U92 A;  3IOW A;  2FNC A;  2XX9 A;  1TXF A;  1URG A;  1XHY A;  3TUS A;  3UGW A;  1IXC A;  4U23 A;  4RXL A;  3EN3 A;  3MZ9 A;  1MQD A;  1TWY A;  3VVF A;  1MPD A;  4WKM A;  4NF8 A;  5TP9 B;  3UA8 A;  5HPQ A;  4WXJ A;  1ZBM A;  5H8F B;  3G3K A;  3RPW A;  1B52 A;  1SBP A;  5DT6 A;  3CSB A;  5I84 A;  1NH7 A;  1Y4C A;  1O7T A;  3S9M C;  2QS2 A;  1JQF A;  3C31 A;  2Q88 A;  3TMG A;  1QJM A;  3N7S A;  3HST A;  3G3G A;  1Y3Q A;  1MXZ A;  3KZG A;  5HM4 B;  1HSL A;  1DSN A;  1P1Q A;  5IAI A;  1DPP A;  4HS7 A;  4KI0 E;  1A54 A;  4G8N A;  2XXW A;  3E13 X;  3PPN A;  1B0H A;  2O51 A;  2V25 A;  3KGC A;  3SER A;  4Z0I A;  1MY3 A;  4F29 A;  4IO2 A;  1OIB A;  3QIM A;  3ZS6 A;  1B7H A;  3VLV A;  4H6D A;  1BLF A;  3U94 A;  3MQ9 A;  4OTE A;  3G3J A;  4YU0 A;  3H3G A;  4ZE9 A;  4OET A;  2P1S A;  4GQO A;  4Q5T A;  3TTK A;  5CMM A;  1OVB A;  3CG3 A;  1UQW A;  1LBB A;  4OZ9 A;  2NVU B;  1A40 A;  3DLN A;  5A5X B;  1RYX A;  2DE2 A;  4JXI A;  1Y1M A;  5FHM A;  3OO6 A;  4RJZ A;  3PD8 A;  1PDA A;  1UTB B;  4P0I A;  2VGQ A;  4AB5 A;  4LQ5 A;  3OEM A;  2F6G A;  4QSE A;  1SI0 A;  5KDT B;  3LUY A;  3H03 A;  1MY0 A;  3MW0 A;  4GOT A;  4FEC A;  3ZKL A;  3VXC A;  2QS1 A;  2UYF A;  3UN6 A;  1B32 A;  5K2X A;  5I57 B;  3O97 A;  3K0V A;  4DXU A;  4LA9 A;  2Q2C A;  2OLB A;  1NKX A;  1LFH A;  2XDG A;  5I58 B;  1FTJ A;  2DSF A;  5BUU A;  4GL8 A;  1TT1 A;  3CVG A;  3K01 A;  1Z7M E;  4F1Y A;  2PT1 A;  2V93 A;  4MH5 A;  2O7U A;  2PMS A;  2XXV A;  1II5 A;  2G93 A;  3ODB A;  3QUJ A;  3QXM A;  4QSC A;  2F8D A;  2I4C A;  2QS4 A;  3FZV A;  4NF5 B;  2DS9 A;  1L5T A;  3V5A A;  4ELQ A;  1XVY A;  4NMY A;  5I2N B;  5K2Y A;  5FHN A;  2O1M A;  3EQ1 A;  5DEX A;  4ZDM A;  1LAF E;  1MXW A;  2VD3 A;  2Z23 A;  4H65 A;  4LVQ A;  3DP6 A;  4LQ2 A;  2XX7 A;  2AL5 A;  3S4U A;  5I56 A;  3LBS A;  4LZ7 A;  2ALU A;  1I6Q A;  1R1N A;  2P0S A;  1SD3 A;  2L27 A;  2GHB A;  4ELP A;  4YB5 A;  3KN3 A;  4JWY A;  5CM6 A;  4EF2 A;  4G68 B;  1CE2 A;  3TEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...