3EHTA

Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1) in complex with crf
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
452
structure length
452
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPETWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFSLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND MBP
publication title Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 123
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehtA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehtA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3ehtA03
3TCFA 3TZAA 2G29A 1FQAA 1IQ7A 2ONSA 1MDP1 1N7WA 3IB2A 2DXRA 3KGCA 2XX8A 1JNFA 3TPAA 5I56B 1U34A 1B52A 3N26A 3PMVA 5A5XA 4YB6A 1WVJA 2H25A 1MDQA 2Q9TA 4OYVA 1SBPA 2O51A 4BDLA 2QS4A 3C4MA 3IB0A 4DXBA 1LFIA 4O3BA 4AB6A 3EHSA 2RC7A 2XXUA 1JEUA 3IR1A 4AB5A 2Y7IA 4OESA 3VVEA 3EQ1A 4RPNA 4EXKA 3KZGA 3H3GA 1IEJA 1EZPA 4PFUA 4IB2A 5H8HA 1ZLQA 1URGA 4RK9A 3MC2A 5TU0A 1MY1A 4GOTA 2Q2CA 1EZ9A 5BUUA 1FTKA 3RQTA 1UIVA 3GXAA 1DSNA 3THIA 3H4ZA 5HPQA 1US4A 4JBZA 3DP8A 3VVFA 2DVZA 1OVTA 4H5FA 3PUXE 5H8QA 1JW1A 3PPOA 1Z7NE 3LSXA 4KCCA 5B70A 1HSLA 4GFRA 5KCJA 2Y7WA 4POWA 4GD5A 3OO6A 1FTJA 3RN8A 2Z22A 5H8SA 4IO3A 2V3QA 1SVXB 1PBPA 5L9OA 4Q5TA 4OFJA 3N94A 1MQGA 5TP9A 3HPIA 1QW0A 2F5XA 5I58A 3C9HA 1ZTYA 5ELVA 4ZGMA 1S50A 1XS5A 3K1NA 3UK4A 5A5XB 4Z7EA 2E1SA 3MP1A 2I58A 2DQVA 2KLFA 4LVQA 3S9NC 3O2AA 3EHTA 3H7MA 3UORA 2XHDA 2I49A 1SYIA 3K1PA 3CVGA 1BP5A 4Z0IA 3KG2A 2FYIA 4X9TA 3U93A 2H9BA 2F36A 3PUZE 3ZKLA 3FXRA 4PE5B 5HBCA 5DVJA 4OXVA 3PMXA 1XVYA 1Q1KA 3K6VA 3I6VA 3V83A 4H67A 3U8QA 5H8HB 1NFTA 3FATA 4ELRA 1B4ZA 4G4PA 3FXUA 2HCAA 1ZJLA 2D21A 2OK2A 1MXYA 3SESA 4ERSA 5DVIA 1LB9A 2O84X 5K2XA 3S9MC 1MM7A 5H8QB 3DP6A 4R72A 3TTKA 1MG1A 2VGQA 3N5LA 1UTBB 3FV2A 2ZYMA 2XXYA 4OHNA 2QRYA 2HZLA 3O97A 5KCJB 1N3XA 5CI5A 2FNCA 1N0TA 4GLIA 1USYE 4QFPA 2HFBA 2XD2A 4OEUA 1B58A 2JNDA 1Y3PA 3MUQA 1MRPA 3EF7A 5TP9B 3CIJA 3C32A 4H1XA 4BDMA 1GGGA 4ZEDA 4EF1A 5I58B 2ZYNA 4WEDA 3G7WA 3IORA 4ELOA 4XIGQ 4R9GA 3G3JA 3VLWA 5FHMA 4HTGA 4ONYA 3G3IA 4IY5A 1Y4CA 3FZVA 2DSFA 5CRYA 2QS3A 1SW5A 3K6WA 1DPPA 3PU5A 4Q30B 1Y3QA 1B0HA 1A40A 3PMWA 3TMGA 5FTHA 1A99A 4JB7A 3B6WA 1Y9UA 2DE2A 3O6IA 1MPCA 1US5A 5AA2A 2I48A 1LLSA 4IO2A 1XC1A 3HO7A 4MH5A 2UVIA 2QMXA 2UYFA 4LZ7A 2XX9A 2RF1A 1B05A 4HJ0A 1B5IA 3GLBA 1D9VA 4RNSA 4U22A 3U72A 1SQYA 3EN3A 4DXCA 4RJZA 3MPLA 2F6GA 3M3FA 2HXWA 4DDDA 2I0CA 1RKMA 4JSOA 1IUDA 2NXOA 3PPNA 3VXCA 4BLAA 1B7ZA 2YLNA 3ILUB 3PPQA 3B6QA 3MVZA 3TKDA 4U1OA 3CSGA 2P2AA 3D4GA 2DS9A 2O69A 3FJMA 4ESWA 1XHYA 3SEXA 1POY1 2UXAA 4UA8A 4YKIA 4THIA 2ALUA 4DLQA 3T9VA 3H6TA 1MXWA 3HHGA 4IY6A 3O6GA 4R73A 3IK6B 2XD3A 1GTKA 4WEPA 3M8UA 3O6HA 3IOTA 4G68C 3TAJA 2HQ0A 3IOLA 5EHSA 1MQIA 5AA2B 2GHBA 3OEMA 3IOUA 1OQHA 4PFTA 2DP8A 2R6GE 4KHZE 3DP4A 3BFUA 1ELJA 4YB5A 4KI0E 4DCXA 1LFHA 3FJ7A 2G93A 1Z7ME 5CMCA 1P1UA 4GQOA 3TTRA 4KR5A 3E4RA 3TCHA 2ZYOA 3L2JA 4OFOA 1LAXA 3T9XB 3KN7A 3TQWA 4OETA 4LZ5A 2XXXA 2NVUB 3T66A 3PPRA 4NF6A 2UVJA 2NUVA 2M8CA 2NWJA 4NTLA 3RTWB 3ZSFA 3CRBA 1POTA 3ZS6A 1AMFA 2H98A 4R2FA 4EF2A 4F2QA 2DYXA 1IXIA 1XVXA 1H44A 3TQLA 3SEWA 3K01A 1T0KA 1QKAA 3MZBA 4U4XA 4LQ2A 5CM6A 1MY2A 4FAJA 4YKKA 3FVNA 1JEVA 3AXFA 3VLUA 1MPDA 3T96B 2OCUA 1P1NA 3I3VA 3SERA 1JVXA 3OEKA 5H8FA 5DEXA 2RINA 3K6XA 2QSXA 4ZDMA 1NNPA 3K2DA 1VFEA 5CMBA 5IKBA 3SEVA 1B1HA 4RK2A 4LP2B 4I1DA 1B1XA 3VLVA 3FVGA 4IGRA 4RA1A 1LAGE 4ZZAA 2I6EA 5F7VA 2X26A 3TTMA 4IGTA 3RT8A 5M2VA 2A5SA 4XKNA 3PUYE 5EYFA 2PT2A 4MF3A 2CZLA 3KOSA 2RCBA 3TELA 1YCJA 2H99A 3JZJA 3T9UA 2V84A 4NWDA 2YJPA 3O66A 4NF6B 4H65A 5K2YA 4DCYA 1A8FA 5KDTA 3S2VA 4OEVA 1R6ZA 2YPNA 1LSTA 3TEPA 1JVYA 2DWJA 4PP0A 1LB8A 1VSOA 2WKYA 2AIXA 1FTLA 2D3IA 4GIZA 4KCDA 1UTBA 2GHAA 2W7YA 4PFYA 3C59A 2Z8DA 4TLLB 1BIYA 1XT8A 2O6AA 3GBAA 2RC9A 2Z8EA 4R6HA 3TUSA 2XXQA 3H6UA 3TYHA 3R7XA 2DWIA 5H8FB 1II5A 1LBCA 5DEXB 2F34A 3ECRA 5I57A 1JETA 2I3VA 4LZ8A 5I2KA 3RLFE 1YTVA 3K00A 2ZXTA 1MPBA 2ONKE 2QPQA 1O64A 3N6UA 5AA4A 1I6AA 3IO6A 4OERA 4QHQA 4NEDA 4C0RA 1D9YA 2O1LA 3IJOB 4X1DA 1FQFA 1PEBA 1PC3A 4JSDA 3ODBA 4EUOA 1N04A 3VVDA 2XXWA 3EHUA 4I62A 3E3KA 2F6PA 1QVSA 4BDQA 3RUMA 4KYEA 3G3FA 3H6WA 4QFNA 3UIFA 2HEUA 3MAMA 2OZZA 3O28A 5KDTB 1YAEA 4GWOA 1MXUA 4ELQA 3Q29A 1B2HA 5DVFA 3OSQA 1B3HA 1P1WA 1AIVA 4M1VA 4G8MA 2F7CA 3N7PA 3ZKKA 3QXMA 3O9PA 4YB7A 5JEIA 4ELPA 2ANJA 2RCAA 1MM6A 5ICTA 1B5HA 2DWAA 4FATA 4H6DA 1MY0A 1SW2A 3V8XB 2HZKA 2Z8FA 2PVUA 3KJ7A 3Q27A 4L17A 1B3GA 1I69A 4IO4A 5IAIA 5I57B 3R6UA 2F7BA 5I2KB 1VFDA 2XXHA 4R6KA 1UIUA 1O63A 2GH9A 3MZ1A 5JK4A 3N6TA 4NMYA 5AA4B 3VFJA 2JODA 4QSDA 2F78A 1LFGA 5I2NA 1PDAA 1ZMGA 4XTCQ 1MQHA 4KPTA 4JXIA 3QAXA 1B5JA 3SEYA 1FTOA 5CBSA 4OMBA 1ATGA 3WAEA 2O1MA 4F19A 3E13X 2UVHA 4ZEFA 3IL1B 3CFLA 3RPWA 1PB9A 4ESXA 3LSLA 3BKIB 4EQ9A 3USDA 1DTZA 1S7YA 3MPKA 3OOAA 1FQBA 4UACA 3KSJA 3O29A 4GXAA 3OENA 1J1NA 3C35A 5DTBA 1MQDA 4ECFA 3FXQA 4IO7A 1H76A 3DLNA 3FGSA 3VV5A 2FA7A 1DOTA 3CFXA 2IEEA 3T22A 4QFOA 3QUFA 1H43A 4P11A 2I4CA 4QF9A 4NF5A 5HM4B 2Y7PA 3A3UA 3MVYA 3PUVE 5H8NA 5F1QA 3BBRA 4FORA 4YMAA 3WAFA 4MLVA 2DXYA 4ZEBA 4Q8RA 3IB1A 1PB8A 3RY3A 1NNFA 1B40A 3C31A 2XX7A 2XXRA 1URSA 2B3FA 4H8JA 4OTEA 1Y1MA 4BDRA 5I2NB 3BFTA 1TXFA 2XXPA 3U94A 5ICQA 3OELA 1AH5A 3F11A 3FUZA 2PMSA 3QUJA 2F97A 4YU0A 4MLQA 3KEIA 1NH8A 2QJEA 4F39A 4G77A 3LSFB 2F8DA 3UGWA 1FCKA 4FJPA 4O3AA 1TFAA 1P1OA 3VXBA 4ZEKA 1WDNA 4QSEA 1P99A 4E0WA 1FQEA 3T93B 4OZ9A 3KSXA 5FHNA 2UYEA 2H4IA 3C34A 1B4HA 3Q26A 4FIMA 3HHFA 4TQUQ 3FD3A 4DLOA 4EQ7A 3MWBA 1N84A 4R2BA 3TTNA 4P0IA 4RXLA 1N7XA 3VE1B 4NF5B 3CI8A 3KN8A 3C5TA 1QUIA 1JW5A 3ONMA 4FEBA 4U21A 5H8NB 3S9LC 3TCGA 4ZE9A 3N7SA 1LGBC 4DLDA 1SDXA 1SD3A 4BDNA 2F7AA 1MXVA 3U92A 4F1VA 1P1QA 3LSWA 4LATA 3M3KA 1MQJA 3IO4A 3CFZA 1B7HA 4HS7A 4F3BA 2PX1A 1ZBMA 2Y84A 4F1UA 3K1MA 4DE8A 1A55A 2X7QA 4HCWA 1Y4TA 2HAVA 4DIGA 2P1SA 3FV1A 1BKAA 3IOWA 2PT1A 2REJA 1RYOA 3B6TA 1IXGA 4IO5A 1MY3A 2GRVA 4E0XA 5EHMA 4MBPA 2GFEA 3I5OA 1B3LA 1QULA 4EDPA 4XKPA 2Y7KA 1B32A 4KD5A 4ISUA 1FQDA 1TT1A 3H6VA 2VD2A 4ZS9A 1B3FA 3C36A 1GR2A 3G3HA 2QS1A 3KBRA 4XKRA 3HCQA 3FJGA 3IOVA 4H5GA 2CMOA 3L6HA 4G68A 2O68A 1IZ1A 1IIWA 1BTJA 4F2OA 1VE4A 5TPAA 1JW4A 3K0VA 1UQWA 4DXUA 4NF4A 4LUBA 5CBRA 4G8NA 4YAHX 1SYHA 1OVBA 2QKHA 2I0BA 1M5BA 2VD3A 2XXVA 2RKMA 1N76A 2OWTA 1NH7A 2ZMBA 1GV8A 3QIMA 4KFQA 1SW1A 1MH4A 2R71A 3OMBA 1Y20A 1MS7A 2P0SA 2I3WA 1H45A 5CC2A 1R9QA 1NKXA 4H0WA 2O7IA 3CG3A 4F18A 2AL5A 1ZU0A 4YZZA 2VP1A 3QSLA 4LA9A 4R9FA 1XOCA 4N6PA 4ZEIA 2PBWA 2OLBA 1S9TA 2PYYA 3P7IA 3W9VA 3SEUA 1QKBA 1URDA 4PETA 1L5TA 4YKPA 4NWCA 2XXIA 3GBBA 4YKJA 3JYRA 3PD8A 1NMUA 4KYSA 1IXCA 5AE4A 1QJMA 4KYDA 4G68B 1OMPA 3UN6A 5L8DA 4TLMB 5TPAB 1PBQA 3ILTB 3IX1A 4NF4B 2DE3A 1I6BA 3L6GA 1DPEA 3K4UA 1PB7A 5BWJA 1UTHA 5DT6A 1NL5A 1USYH 3HSTA 4OVJA 3FVKA 3AQFB 3HV1A 3K02A 3N7RA 1EH3A 4ZE8A 3SDFA 4HW8A 3PPPA 4K3FA 4OWDA 4JDFA 4C1TA 2B3BA 2OWSA 3H06B 3OSRA 1TWYA 3SETA 4Q0CA 3D4CA 3E9XA 3CR9A 3OO8A 4TOZA 4JWYA 1ZIUA 4N07A 1OIBA 1ZKBA 3W9WA 3RNNA 5JTYA 4I8CA 4OFLA 3DELB 3TODA 4WXJA 1MH3A 2LAOA 1QUKA 2F35A 3MJNA 3V89B 2DOJA 4R6YA 2REGA 2H5YA 1B7UA 4FE8A 4H8IA 1LBBA 3OO9A 4R75A 1Q35A 4XKQA 4JWXA 3FIRA 5LOMA 3FASA 4QFKA 4EQBA 2ZNUA 4YMBA 2QL3A 1F9BA 1DTGA 3T9HB 1N3WA 5B7DA 1I6QA 3QYTA 1OLCA 2X7PA 1LAFE 2QMWA 4GL8A 2THIA 1A7LA 3PV0E 4U4SA 4QSCA 3S9EA 1FQCA 5AA3A 1UTHB 2OJTA 3Q25A 4EXLA 3VDFA 4QRZA 3MBPA 4MFIA 5CMKA 4IO6A 1NNKA 2AYSA 1EU8A 4O3CA 2I4BA 4DZ1A 2Q8JA 1FW0A 2ZNSA 3EPEA 5I59A 2DE4A 1MXXA 1OQGA 4LONB 1M5EA 1M5DA 4RPOA 3PD9A 3KFMA 4G8HA 4R74A 2Q2AA 3B7DA 3UP9A 5KZTA 1CE2A 2ESNA 3A09A 4QFLA 4OENA 3TDJA 5JTYB 3MP8A 5J1DA 2DWHA 1R1NA 2IA4A 3OXNA 1B51A 1TFDA 1WODA 4GVOA 3V5AA 4NF8A 1FTMA 5I84A 3LBSA 2Y7RA 3PUWE 3OO7A 3PGFA 1LCFA 1MY4A 2ZNTA 3S4UA 3G3KA 1B3EA 3KN3A 2AL4A 5II0A 4F3SA 2O7UA 4ZZEA 1D4NA 1SI1A 5ITOA 4ZECA 1LAHE 1A8EA 2Q88A 3CG1A 4GF8A 4F31B 1SI0A 2ABHA 2V3UA 3KJTA 3LR1A 1NNTA 3A3CA 2D5WA 3IAZA 1HSJA 2B65A 4RYAA 1QUJA 3MP6A 3MVWA 4F22A 4U1ZA 1AOVA 3W15C 2L27A 5L9MA 1BLFA 2VHAA 1D3KA 1B9JA 4WKMA 3K6UA 3R26A 1Y1ZA 1B6HA 5I59B 3RTFB 4M4GA 5ITPA 4AQ4A 3SKPA 4LF3C 1CB6A 1JQFA 2A5TA 2RC8A 1SW4A 3Q28A 1Y3NA 3JV9A 4RY1A 1DMBA 4NE4A 1IITA 4JWOA 4KQPA 5FHOA 1VR5A 3TFLA 5L9SA 3MVXA 4G2ZA 1M5FA 1ANFA 1GVCA 2QS2A 3LUYA 4U23A 5I56A 5ISUA 2ONRA 3LC8A 4NF8B 4F3PA 5CMMA 1M5CA 2XXTA 4GXSB 1B46A 1RYXA 2R9JA 3RGYA 4X1BA 3HN0A 1O7TA 2DVCA 1AL3A 4C1UA 5FTIA 4X48A 4HCYA 4N13A 2V93A 5AA2D 3C33A 4F1YA 2V3TA 4F29A 3RT6B 3OD7A 2VOZA 3MZ9A 4I9DA 4POXA 1MXZA 2Z23A 1HSEA 3M3LA 2UVGA 1A54A 3DM0A 1IXHA 1YPNA 2XDGA 3G3GA 2OBGA 2E0SA 1OLAA 3FVOA 5AA1A 4YICA 5DYHA 2ZYKA 1B0LA 4LQ5A 4ND9A 2Q89A 4F3GA 3UA8A 4OQOA 4P0GA 3MQ9A 3GZGA 3QK6A 4FEDA 1EZOA 4FECA 4BDOA 3KOTA 1KWHA 3TTLA 1R9LA 2NOOA 4PFWA 3U1OA 2JNCA 3MW0A 4GL0A 1H3DA 3CSBA 4U2RA 2A5TB 4XXUA 1LCTA 4PQJA 3H03A 4GRKA 2BJJX 2HAUA 3IJXB 2V25A
chains in the Genus database with same CATH superfamily
3TCFA 3TZAA 2G29A 1FQAA 1IQ7A 2ONSA 1MDP1 1N7WA 3IB2A 2DXRA 3KGCA 2XX8A 1JNFA 2XA5A 2QVRA 5ET8A 3TPAA 5I56B 1U34A 1B52A 3N26A 3PMVA 5A5XA 4YB6A 4O7MA 2WEFA 1WVJA 2H25A 1MDQA 2Q9TA 4OYVA 1SBPA 2O51A 1QGXA 4BDLA 2QS4A 3C4MA 3IB0A 4DXBA 1LFIA 4O3BA 4AB6A 3EHSA 1FTAA 2RC7A 2XXUA 1JEUA 3IR1A 4AB5A 2Y7IA 4OESA 3VVEA 3EQ1A 4RPNA 4EXKA 3KZGA 3H3GA 4KXPA 1IEJA 1EZPA 4HE0A 4GWSA 1NV3A 4PFUA 4IB2A 5H8HA 1ZLQA 1URGA 4RK9A 3MC2A 5TU0A 1MY1A 4GOTA 2Q2CA 1EZ9A 5BUUA 1FTKA 3RQTA 1UIVA 3GXAA 1DSNA 3THIA 3H4ZA 5HPQA 1US4A 2HPGA 3E79A 3DP8A 4JBZA 3VVFA 2DVZA 3GYYA 1OVTA 3KBZA 4H5FA 3PUXE 1KA1A 5ET5A 5H8QA 1JW1A 5LDZA 3PPOA 1Z7NE 1CNQA 3LSXA 2B4LA 4KCCA 5B70A 1HSLA 4GFRA 5KCJA 2Y7WA 4POWA 4GD5A 3OO6A 1FTJA 3RN8A 2Z22A 5H8SA 1FBDA 4IO3A 2V3QA 1SVXB 1PBPA 5L9OA 4Q5TA 2QFLA 4OFJA 1NV5A 3N94A 4PAFA 1MQGA 5TP9A 3HPIA 4NHBA 1QW0A 2CZHA 2F5XA 5I58A 3MYUA 3C9HA 2XWOA 4MAGA 4OVQA 1ZTYA 5ELVA 4ZGMA 1K9YA 1S50A 1XS5A 3K1NA 3UK4A 5A5XB 4Z7EA 2E1SA 3MP1A 2I58A 4P1LA 2DQVA 2KLFA 4LVQA 3S9NC 3O2AA 3EHTA 3H7MA 3UORA 2XHDA 2I49A 1SYIA 3K1PA 3CVGA 1BP5A 3ROJA 4Z0IA 3KG2A 2FYIA 4X9TA 3U93A 2H9BA 2F36A 4FBPA 3PUZE 3ZKLA 2ZZWA 3FXRA 4PE5B 5HBCA 5DVJA 4OXVA 3ISPA 3PMXA 1XVYA 1Q1KA 3K6VA 3I6VA 3V83A 4H67A 3U8QA 5J16A 5H8HB 1NFTA 3FATA 4ELRA 1B4ZA 4PAKA 4G4PA 4NAPA 3FXUA 2HCAA 1ZJLA 2D21A 2OK2A 1MXYA 3FXBA 4N15A 4XFEA 4NGUA 3SESA 4ERSA 5DVIA 1LB9A 4PTKA 2OWZA 1Q9DA 2O84X 5K2XA 3S9MC 1MM7A 5H8QB 3DP6A 4R72A 3TTKA 1MG1A 2VGQA 1FBPA 3N5LA 1UTBB 3FV2A 2ZYMA 2XXYA 4OHNA 2QRYA 2HZLA 3O97A 5KCJB 1N3XA 2FNCA 5CI5A 5I5PA 1N0TA 4GLIA 1USYE 4QFPA 2HFBA 1RDXA 2XD2A 4OEUA 1B58A 2JNDA 1Y3PA 3MUQA 4PFRA 5IZ3A 1MRPA 3EF7A 5TP9B 3CIJA 3C32A 4H1XA 4BDMA 1GGGA 4ZEDA 4EF1A 5I58B 2XWVA 2ZYNA 4WEDA 3G7WA 3IORA 3RYDA 4ELOA 4XIGQ 4R9GA 2XWKA 3G3JA 3VLWA 5FHMA 4HTGA 4ONYA 3G3IA 3NOHA 4MNPA 4IY5A 3E78A 1Y4CA 4N6KA 3FZVA 2DSFA 5CRYA 2QS3A 1NI9A 1SPIA 1SW5A 3D1RA 3K6WA 4PDHA 1DPPA 3PU5A 4Q30B 1Y3QA 1B0HA 1A40A 3PMWA 3TMGA 5FTHA 1A99A 4JB7A 3B6WA 1Y9UA 2DE2A 3O6IA 1MPCA 1NUYA 1US5A 5AA2A 2I48A 1IMEA 1LLSA 4NQ8A 4GWZA 4IO2A 1FBHA 1XC1A 3HO7A 4MH5A 2UVIA 2QMXA 4PC9A 2XWIA 1LBVA 2UYFA 4LZ7A 2XX9A 2RF1A 1B05A 4HJ0A 1B5IA 4N4UA 3GLBA 5A5LA 1D9VA 4RNSA 4PFIA 4U22A 3U72A 1SQYA 3EN3A 4DXCA 4RJZA 2Q8MA 3MPLA 2F6GA 3M3FA 1NV0A 2HXWA 4DDDA 2I0CA 1RKMA 4JSOA 1IUDA 2NXOA 3PPNA 3VXCA 4BLAA 2ZZVA 5IZ3B 1B7ZA 2YLNA 5IM2A 3ILUB 3PPQA 3B6QA 3MVZA 3TKDA 4U1OA 2FIEA 3CSGA 2HXRA 4GWWA 2P2AA 4PF6A 3D4GA 2DS9A 2O69A 3FJMA 4ESWA 1XHYA 3SEXA 1POY1 2UXAA 4UA8A 4YKIA 4THIA 2ALUA 4DLQA 3T9VA 3H6TA 1MXWA 3HHGA 4IY6A 4PCDA 3O6GA 4R73A 3IK6B 2XD3A 1GTKA 4GWUA 2WBDA 4WEPA 3M8UA 3O6HA 3IOTA 4G68C 3TAJA 2HQ0A 2FVZA 1G0IA 3IOLA 5EQ7A 1JP4A 5EHSA 1MQIA 5AA2B 2GHBA 3OEMA 3IOUA 1OQHA 4N91A 4PFTA 2DP8A 1IMDA 2R6GE 3B8BA 4KHZE 3DP4A 3BFUA 1ELJA 4YB5A 4KI0E 4DCXA 1LFHA 3FJ7A 2G93A 1Z7ME 5CMCA 1FJ9A 2HHMA 1P1UA 4GQOA 5I7IA 3TTRA 4KR5A 4GBVA 3E4RA 3TCHA 5DW8A 2ZYOA 3L2JA 4OFOA 1LAXA 3T9XB 3KN7A 4MEVA 3TQWA 4OETA 4LZ5A 2XXXA 2NVUB 3T66A 4P56A 3PPRA 4NF6A 2UVJA 2NUVA 2M8CA 2NWJA 4NTLA 3RTWB 3ZSFA 3CRBA 1POTA 3ZS6A 5FBPA 1AMFA 1BK4A 2H98A 4R2FA 3QMFA 3LV0A 4EF2A 2KQZA 4JVDA 4F2QA 2DYXA 4OVRA 1IXIA 1XVXA 1H44A 3TQLA 3SEWA 3K01A 1T0KA 1FBFA 1QKAA 3MZBA 4U4XA 4I40A 4LQ2A 5CM6A 1MY2A 4FAJA 4YKKA 3FVNA 1JEVA 3AXFA 3VLUA 1MPDA 3T96B 1NUWA 2OCUA 1P1NA 3I3VA 3SERA 1JVXA 3OEKA 5H8FA 5DEXA 2RINA 3K6XA 2QSXA 4ZDMA 1NNPA 3K2DA 1VFEA 5CMBA 5IKBA 2VPNA 5LTCA 3SEVA 1B1HA 1XI6A 4DI4B 4NN3A 4RK2A 4LP2B 4I1DA 1B1XA 4IR8A 3VLVA 3FVGA 4IGRA 4RA1A 1LAGE 4ZZAA 2I6EA 5F7VA 2X26A 4MIJA 4O94A 3LUZA 3TTMA 4IGTA 3RT8A 5M2VA 2A5SA 4XKNA 2Y5LA 3PUYE 5EYFA 2PT2A 1FPGA 4MF3A 2CZLA 3KOSA 2RCBA 3TELA 1YCJA 2H99A 3JZJA 4H45A 3T9UA 2V84A 4NWDA 1FPJA 2YJPA 3O66A 4NF6B 4H65A 5K2YA 1LEVA 4DCYA 5EQ8A 1A8FA 5KDTA 3S2VA 4OEVA 2CEYA 1R6ZA 4PGPA 2YPNA 2XXKA 1LSTA 3TEPA 1JVYA 2DWJA 4PP0A 1LB8A 1VSOA 2WKYA 2AIXA 1FTLA 2D3IA 4GIZA 4KCDA 1UTBA 2GHAA 4PFYA 2W7YA 3C59A 2Z8DA 5IZZA 4TLLB 1BIYA 1XT8A 2O6AA 3GBAA 2RC9A 2Z8EA 4R6HA 3TUSA 2XXQA 3H6UA 3TYHA 3R7XA 1LBYA 2DWIA 5H8FB 1II5A 1LBCA 5DEXB 2F34A 3ECRA 1IMCA 5I57A 1JETA 2I3VA 4LZ8A 5I2KA 1RDYA 1D9QA 3RLFE 1YTVA 3K00A 2ZXTA 1MPBA 4NF0A 2ONKE 2QPQA 1O64A 3N6UA 5AA4A 1KZ8A 1I6AA 5EYGA 3IO6A 4OERA 4QHQA 4NEDA 4C0RA 1D9YA 1AWBA 2O1LA 3IJOB 4X1DA 1FQFA 1PEBA 1PC3A 4JSDA 3ODBA 4EUOA 1N04A 3T0JA 3VVDA 2XXWA 3EHUA 4MNCA 4I62A 2PFYA 2WX9A 3E3KA 2F6PA 1QVSA 4BDQA 3RUMA 4KYEA 1LBWA 3G3FA 3H6WA 4QFNA 3UIFA 2HEUA 3MAMA 2OZZA 3O28A 5KDTB 1YAEA 4GWOA 1MXUA 4ELQA 3Q29A 1B2HA 5DVFA 3OSQA 1B3HA 1P1WA 1AIVA 4M1VA 4G8MA 2F7CA 3N7PA 1FRPA 3ZKKA 3QXMA 3O9PA 4YB7A 5JEIA 3PTYA 4ELPA 2ANJA 1IMAA 2RCAA 1MM6A 5ICTA 1B5HA 2DWAA 4FATA 4H6DA 4MHFA 1MY0A 1SW2A 3V8XB 2HZKA 2Z8FA 2PVUA 3KJ7A 3Q27A 4O8MA 4L17A 1B3GA 1DCUA 3RPLA 1I69A 4P9KA 4IO4A 5IAIA 5I57B 3R6UA 2F7BA 5I2KB 1VFDA 2XXHA 4R6KA 1UIUA 1O63A 2WYPA 2GH9A 3MZ1A 5JK4A 3N6TA 4NMYA 2BJIA 5AA4B 3VFJA 5ET6A 2JODA 4N6DA 4QSDA 2F78A 1LFGA 4OVSA 5I2NA 3HFUA 1PDAA 1ZMGA 2VT5A 4XTCQ 1MQHA 4KPTA 4JXIA 3QAXA 1B5JA 4JVCA 3SEYA 1FTOA 5CBSA 1DBZA 4OMBA 1ATGA 2QVUA 3WAEA 2O1MA 4F19A 3E13X 2UVHA 4ZEFA 3IL1B 3CFLA 3RPWA 1PB9A 4ESXA 2P3VA 3LSLA 3BKIB 4EQ9A 3USDA 1DTZA 1S7YA 3MPKA 3OOAA 4H46A 1FQBA 4UACA 3KSJA 3O29A 3A29A 4GXAA 4PAIA 3OENA 1J1NA 3C35A 5DTBA 1MQDA 4ECFA 3FXQA 4IO7A 2ZZXA 4GWYA 1H76A 3DLNA 4G61A 2PFZA 3FGSA 3VV5A 2FA7A 1DOTA 3CFXA 2IEEA 3T22A 4QFOA 1YZ0A 3QUFA 1H43A 4P11A 2I4CA 4QF9A 4NF5A 5HM4B 2Y7PA 3A3UA 3MVYA 3PUVE 4P1EA 5H8NA 2Q74A 5F1QA 3BBRA 4FORA 4YMAA 3WAFA 4MLVA 2DXYA 3RPLB 4ZEBA 4Q8RA 3IB1A 1PB8A 3RY3A 1NNFA 1B40A 3C31A 2XX7A 2XXRA 1G0HA 1URSA 4PE3A 2B3FA 4H8JA 4OTEA 1Y1MA 4BDRA 5I2NB 3BFTA 1TXFA 2XXPA 3U94A 2VPOA 5ICQA 1NV4A 1NV7A 3OELA 1AH5A 3F11A 3FUZA 2PMSA 3QUJA 4DI3D 2F97A 4P8BA 4YU0A 4MLQA 3KEIA 1NH8A 2QJEA 3MSTA 4F39A 4G77A 2KR0A 3LSFB 2F8DA 3UGWA 1FCKA 4FJPA 4O3AA 1TFAA 1P1OA 3VXBA 4ZEKA 1WDNA 4QSEA 1P99A 1FPLA 4E0WA 1FQEA 4HE1A 3T93B 4OZ9A 3KSXA 5FHNA 2UYEA 2H4IA 3C34A 1B4HA 3Q26A 2V4CA 4FIMA 3HHFA 4GX4A 4TQUQ 3FD3A 4DLOA 4EQ7A 3MWBA 1INPA 1N84A 4R2BA 3TTNA 1NUXA 4QBAA 4P0IA 4RXLA 1N7XA 3VE1B 4NF5B 3CI8A 3KN8A 3C5TA 1QUIA 1JW5A 1YYZA 3ONMA 4FEBA 4U21A 5H8NB 3S9LC 3TCGA 4ZE9A 3N7SA 1FPDA 1LGBC 4DLDA 1SDXA 1SD3A 4BDNA 2F7AA 1MXVA 4AS4A 3U92A 4F1VA 1P1QA 1YXIA 3LSWA 4LATA 3M3KA 1MQJA 3IO4A 2P3NA 3CFZA 1B7HA 4HS7A 4F3BA 2PCRA 2PX1A 1ZBMA 2Y84A 4F1UA 3K1MA 4DE8A 1A55A 2X7QA 4HCWA 1Y4TA 2HAVA 4DIGA 2P1SA 3FV1A 1BKAA 3IOWA 3CHGA 2PT1A 2REJA 3KC0A 1RYOA 3B6TA 1IXGA 4IO5A 1MY3A 2FBPA 2GRVA 4E0XA 5EHMA 4MBPA 2GFEA 3I5OA 1B3LA 1QULA 4EDPA 4PDDA 4XKPA 2MKZA 4MMPA 2Y7KA 1B32A 4KD5A 1FPIA 4ISUA 1FQDA 1TT1A 3H6VA 4AS5A 3IFAA 2VD2A 4ZS9A 1B3FA 3C36A 1GR2A 3G3HA 2QS1A 3KBRA 4XKRA 5ET7A 4MNIA 1LBZA 1VDWA 5IZ1A 4X04A 4GBWA 3HCQA 3FJGA 3IOVA 4H5GA 2CMOA 3L6HA 4G68A 4NX1A 2O68A 1IZ1A 1IIWA 1BTJA 3U65A 4F2OA 1VE4A 5TPAA 1JW4A 3K0VA 1UQWA 4DXUA 4NF4A 4LUBA 5CBRA 4G8NA 4YAHX 1SYHA 1OVBA 3SZPA 2QKHA 2I0BA 1M5BA 2VD3A 2XXVA 2RKMA 1N76A 1NUZA 1FBCA 2OWTA 1NH7A 2ZMBA 1GV8A 3QIMA 4KFQA 3BIHA 1SW1A 1LBXA 1MH4A 2R71A 2FIXA 3OMBA 1Y20A 4I3YA 1MS7A 2P0SA 2I3WA 1H45A 5CC2A 1R9QA 2L5VA 1NKXA 4H0WA 1FSAA 2O7IA 3T1BA 3CG3A 1FBEA 4F18A 2AL5A 1ZU0A 4YZZA 2VP1A 3QSLA 4LA9A 1FPEA 1XOCA 4R9FA 4N6PA 4ZEIA 2PBWA 2OLBA 1S9TA 2PYYA 3P7IA 5EQAA 2R8TA 3W9VA 3SEUA 1QKBA 1URDA 4PETA 1L5TA 4NWCA 4YKPA 2XXIA 3GBBA 4YKJA 3JYRA 3PD8A 1NMUA 1K9ZA 4KYSA 1IXCA 5AE4A 1QJMA 4KYDA 4G68B 1OMPA 1NV1A 3UN6A 1FPKA 5I3SA 2WYKA 5L8DA 4TLMB 5TPAB 1PBQA 3ILTB 4HE2A 3IX1A 4NF4B 2DE3A 1I6BA 3L6GA 1DPEA 3K4UA 1PB7A 1NV2A 5BWJA 2QVVA 1UTHA 5DT6A 1NL5A 1USYH 4N81A 2OX3A 3HSTA 4OVJA 3FVKA 3AQFB 3HV1A 3K02A 3N7RA 2CZIA 1EH3A 4ZE8A 3SDFA 4HW8A 3PPPA 4K3FA 4OWDA 4JDFA 4N8YA 4C1TA 2B3BA 2OWSA 3H06B 4HXVA 3OSRA 2DDKA 1TWYA 3B50A 4Q0CA 3SETA 3D4CA 3E9XA 3CR9A 3OO8A 4TOZA 1FJ6A 4P47A 4JWYA 1ZIUA 4N07A 4QXDA 1OIBA 4GX6A 1ZKBA 3W9WA 3RNNA 4XF5A 2B4MA 5JTYA 4I8CA 4OFLA 3DELB 3TODA 4WXJA 1MH3A 2CZKA 2LAOA 1QUKA 1EYJA 2F35A 3MJNA 3V89B 2DOJA 4R6YA 2REGA 2H5YA 1B7UA 4FE8A 4H8IA 1LBBA 3OO9A 4R75A 1Q35A 4XKQA 4JWXA 3FIRA 5LOMA 5EQ9A 5T3JA 3FASA 4QFKA 4EQBA 2ZNUA 1EYKA 4YMBA 2QL3A 1F9BA 2Y5KA 1DTGA 3BIGA 5ESYA 3T9HB 1N3WA 5IGAA 4OVTA 1FBGA 5B7DA 4PBHA 1I6QA 3QYTA 1OLCA 2X7PA 1LAFE 2QMWA 4GL8A 2THIA 1A7LA 3PV0E 4U4SA 4QSCA 3S9EA 4MJOA 1FQCA 5AA3A 1UTHB 2OJTA 3Q25A 4EXLA 3VDFA 4QRZA 3MBPA 4MFIA 5CMKA 4IO6A 1NNKA 2AYSA 1EU8A 4O3CA 2I4BA 4DZ1A 2Q8JA 1FW0A 2ZNSA 3EPEA 5I59A 4P3LA 2DE4A 1MXXA 1OQGA 4LONB 1M5EA 1M5DA 4RPOA 4OVPA 3PD9A 3KFMA 4G8HA 4R74A 2Q2AA 3B7DA 1IMFA 3UP9A 5KZTA 1CE2A 2ESNA 3A09A 4QFLA 4OENA 3TDJA 5JTYB 3MP8A 5J1DA 2DWHA 1R1NA 2IA4A 3OXNA 1B51A 4LN5A 1TFDA 1WODA 4GVOA 3V5AA 4NF8A 1FTMA 5EYHA 5I84A 3LBSA 2Y7RA 3PUWE 3OO7A 1FPBA 4UABA 3PGFA 1LCFA 1MY4A 2ZNTA 3S4UA 3G3KA 1B3EA 3KN3A 2AL4A 5II0A 4F3SA 2O7UA 4ZZEA 1D4NA 1SI1A 4GX3A 5ITOA 4ZECA 1LAHE 1A8EA 1NV6A 2Q88A 3CG1A 4GF8A 4F31B 1SI0A 2ABHA 2V3UA 3KJTA 4MCOA 3LR1A 4OA4A 1NNTA 2F3BA 3A3CA 2D5WA 3IAZA 1HSJA 2B65A 4RYAA 1QUJA 3MP6A 3MVWA 4F22A 4U1ZA 1AOVA 3W15C 2L27A 5L9MA 1BLFA 2VHAA 1D3KA 2JJKA 1B9JA 4WKMA 2F3DA 3K6UA 3R26A 1Y1ZA 1B6HA 5I59B 2FHYA 3RTFB 4M4GA 5ITPA 4AQ4A 3SKPA 4LF3C 4PGNA 1CB6A 1JQFA 2A5TA 2RC8A 1SW4A 3Q28A 1Y3NA 1DK4A 3JV9A 4RY1A 1DMBA 4PBQA 1FPFA 4NE4A 1IITA 4JWOA 4KQPA 5FHOA 1VR5A 1KA0A 3EKIA 3TFLA 5L9SA 3MVXA 4G2ZA 1M5FA 1ANFA 1GVCA 2CEXA 1EYIA 2QS2A 3LUYA 4U23A 3IFCA 5I56A 5ISUA 2ONRA 3LC8A 4NF8B 4F3PA 5CMMA 4PF8A 1M5CA 2XXTA 4GXSB 1B46A 1RYXA 2WBBA 2R9JA 3RGYA 4X8RA 4X1BA 3HN0A 1O7TA 2DVCA 1AL3A 4C1UA 5FTIA 4X48A 4MX6A 4HCYA 4N13A 2V93A 1IMBA 4JVIA 3C33A 4GWXA 5AA2D 4F1YA 2V3TA 4OANA 4F29A 3RT6B 3OD7A 2VOZA 3MZ9A 4I9DA 4POXA 1MXZA 3KC1A 4N8GA 2Z23A 1HSEA 3M3LA 2UVGA 1A54A 3DM0A 1IXHA 3FBPA 1YPNA 2XDGA 3G3GA 2OBGA 4PFBA 4N17A 2E0SA 1OLAA 3FVOA 5AA1A 4YICA 5DYHA 2ZYKA 1B0LA 4LQ5A 4NG7A 4ND9A 2Q89A 4F3GA 3UA8A 4I3EA 4OQOA 4P0GA 3MQ9A 3GZGA 4O7IA 2GQ1A 3QK6A 4FEDA 1EZOA 4FECA 4BDOA 3KOTA 1KWHA 3TTLA 4XEQA 1R9LA 2NOOA 4PFWA 3U1OA 2JNCA 3MW0A 4GL0A 1RDZA 5F24A 1H3DA 3CSBA 4U2RA 2A5TB 4XXUA 1LCTA 4PQJA 3H03A 4GRKA 2BJJX 2HAUA 3IJXB 2V25A
chains in the Genus database with same CATH topology
3TCFA 3TZAA 2G29A 1FQAA 1IQ7A 2ONSA 1MDP1 1N7WA 3IB2A 2DXRA 3KGCA 2XX8A 1JNFA 3TPAA 5I56B 1U34A 1B52A 3N26A 3PMVA 5A5XA 4YB6A 1WVJA 2H25A 1MDQA 2Q9TA 4OYVA 1SBPA 2O51A 4BDLA 2QS4A 3C4MA 3IB0A 4DXBA 1LFIA 4O3BA 4AB6A 3EHSA 2RC7A 2XXUA 1JEUA 3IR1A 4AB5A 2Y7IA 4OESA 3VVEA 3EQ1A 4RPNA 4EXKA 3KZGA 3H3GA 1IEJA 1EZPA 4PFUA 4IB2A 5H8HA 1ZLQA 1URGA 4RK9A 3MC2A 5TU0A 1MY1A 4GOTA 2Q2CA 1EZ9A 5BUUA 1FTKA 3RQTA 1UIVA 3GXAA 1DSNA 3THIA 3H4ZA 5HPQA 1US4A 4JBZA 3DP8A 3VVFA 2DVZA 1OVTA 4H5FA 3PUXE 5H8QA 1JW1A 3PPOA 1Z7NE 3LSXA 4KCCA 5B70A 1HSLA 4GFRA 5KCJA 2Y7WA 4POWA 4GD5A 3OO6A 1FTJA 3RN8A 2Z22A 5H8SA 4IO3A 2V3QA 1SVXB 1PBPA 5L9OA 4Q5TA 4OFJA 3N94A 1MQGA 5TP9A 3HPIA 1QW0A 2F5XA 5I58A 3C9HA 1ZTYA 5ELVA 4ZGMA 1S50A 1XS5A 3K1NA 3UK4A 5A5XB 4Z7EA 2E1SA 3MP1A 2I58A 2DQVA 2KLFA 4LVQA 3S9NC 3O2AA 3EHTA 3H7MA 3UORA 2XHDA 2I49A 1SYIA 3K1PA 3CVGA 1BP5A 4Z0IA 3KG2A 2FYIA 4X9TA 3U93A 2H9BA 2F36A 3PUZE 3ZKLA 3FXRA 4PE5B 5HBCA 5DVJA 4OXVA 3PMXA 1XVYA 1Q1KA 3K6VA 3I6VA 3V83A 4H67A 3U8QA 5H8HB 1NFTA 3FATA 4ELRA 1B4ZA 4G4PA 3FXUA 2HCAA 1ZJLA 2D21A 2OK2A 1MXYA 3SESA 4ERSA 5DVIA 1LB9A 2O84X 5K2XA 3S9MC 1MM7A 5H8QB 3DP6A 4R72A 3TTKA 1MG1A 2VGQA 3N5LA 1UTBB 3FV2A 2ZYMA 2XXYA 4OHNA 2QRYA 2HZLA 3O97A 5KCJB 1N3XA 5CI5A 2FNCA 1N0TA 4GLIA 1USYE 4QFPA 2HFBA 2XD2A 4OEUA 1B58A 2JNDA 1Y3PA 3MUQA 1MRPA 3EF7A 5TP9B 3CIJA 3C32A 4H1XA 4BDMA 1GGGA 4ZEDA 4EF1A 5I58B 2ZYNA 4WEDA 3G7WA 3IORA 4ELOA 4XIGQ 4R9GA 3G3JA 3VLWA 5FHMA 4HTGA 4ONYA 3G3IA 4IY5A 1Y4CA 3FZVA 2DSFA 5CRYA 2QS3A 1SW5A 3K6WA 1DPPA 3PU5A 4Q30B 1Y3QA 1B0HA 1A40A 3PMWA 3TMGA 5FTHA 1A99A 4JB7A 3B6WA 1Y9UA 2DE2A 3O6IA 1MPCA 1US5A 5AA2A 2I48A 1LLSA 4IO2A 1XC1A 3HO7A 4MH5A 2UVIA 2QMXA 2UYFA 4LZ7A 2XX9A 2RF1A 1B05A 4HJ0A 1B5IA 3GLBA 1D9VA 4RNSA 4U22A 3U72A 1SQYA 3EN3A 4DXCA 4RJZA 3MPLA 2F6GA 3M3FA 2HXWA 4DDDA 2I0CA 1RKMA 4JSOA 1IUDA 2NXOA 3PPNA 3VXCA 4BLAA 1B7ZA 2YLNA 3ILUB 3PPQA 3B6QA 3MVZA 3TKDA 4U1OA 3CSGA 2P2AA 3D4GA 2DS9A 2O69A 3FJMA 4ESWA 1XHYA 3SEXA 1POY1 2UXAA 4UA8A 4YKIA 4THIA 2ALUA 4DLQA 3T9VA 3H6TA 1MXWA 3HHGA 4IY6A 3O6GA 4R73A 3IK6B 2XD3A 1GTKA 4WEPA 3M8UA 3O6HA 3IOTA 4G68C 3TAJA 2HQ0A 3IOLA 5EHSA 1MQIA 5AA2B 2GHBA 3OEMA 3IOUA 1OQHA 4PFTA 2DP8A 2R6GE 4KHZE 3DP4A 3BFUA 1ELJA 4YB5A 4KI0E 4DCXA 1LFHA 3FJ7A 2G93A 1Z7ME 5CMCA 1P1UA 4GQOA 3TTRA 4KR5A 3E4RA 3TCHA 2ZYOA 3L2JA 4OFOA 1LAXA 3T9XB 3KN7A 3TQWA 4OETA 4LZ5A 2XXXA 2NVUB 3T66A 3PPRA 4NF6A 2UVJA 2NUVA 2M8CA 2NWJA 4NTLA 3RTWB 3ZSFA 3CRBA 1POTA 3ZS6A 1AMFA 2H98A 4R2FA 4EF2A 4F2QA 2DYXA 1IXIA 1XVXA 1H44A 3TQLA 3SEWA 3K01A 1T0KA 1QKAA 3MZBA 4U4XA 4LQ2A 5CM6A 1MY2A 4FAJA 4YKKA 3FVNA 1JEVA 3AXFA 3VLUA 1MPDA 3T96B 2OCUA 1P1NA 3I3VA 3SERA 1JVXA 3OEKA 5H8FA 5DEXA 2RINA 3K6XA 2QSXA 4ZDMA 1NNPA 3K2DA 1VFEA 5CMBA 5IKBA 3SEVA 1B1HA 4RK2A 4LP2B 4I1DA 1B1XA 3VLVA 3FVGA 4IGRA 4RA1A 1LAGE 4ZZAA 2I6EA 5F7VA 2X26A 3TTMA 4IGTA 3RT8A 5M2VA 2A5SA 4XKNA 3PUYE 5EYFA 2PT2A 4MF3A 2CZLA 3KOSA 2RCBA 3TELA 1YCJA 2H99A 3JZJA 3T9UA 2V84A 4NWDA 2YJPA 3O66A 4NF6B 4H65A 5K2YA 4DCYA 1A8FA 5KDTA 3S2VA 4OEVA 1R6ZA 2YPNA 1LSTA 3TEPA 1JVYA 2DWJA 4PP0A 1LB8A 1VSOA 2WKYA 2AIXA 1FTLA 2D3IA 4GIZA 4KCDA 1UTBA 2GHAA 2W7YA 4PFYA 3C59A 2Z8DA 4TLLB 1BIYA 1XT8A 2O6AA 3GBAA 2RC9A 2Z8EA 4R6HA 3TUSA 2XXQA 3H6UA 3TYHA 3R7XA 2DWIA 5H8FB 1II5A 1LBCA 5DEXB 2F34A 3ECRA 5I57A 1JETA 2I3VA 4LZ8A 5I2KA 3RLFE 1YTVA 3K00A 2ZXTA 1MPBA 2ONKE 2QPQA 1O64A 3N6UA 5AA4A 1I6AA 3IO6A 4OERA 4QHQA 4NEDA 4C0RA 1D9YA 2O1LA 3IJOB 4X1DA 1FQFA 1PEBA 1PC3A 4JSDA 3ODBA 4EUOA 1N04A 3VVDA 2XXWA 3EHUA 4I62A 3E3KA 2F6PA 1QVSA 4BDQA 3RUMA 4KYEA 3G3FA 3H6WA 4QFNA 3UIFA 2HEUA 3MAMA 2OZZA 3O28A 5KDTB 1YAEA 4GWOA 1MXUA 4ELQA 3Q29A 1B2HA 5DVFA 3OSQA 1B3HA 1P1WA 1AIVA 4M1VA 4G8MA 2F7CA 3N7PA 3ZKKA 3QXMA 3O9PA 4YB7A 5JEIA 4ELPA 2ANJA 2RCAA 1MM6A 5ICTA 1B5HA 2DWAA 4FATA 4H6DA 1MY0A 1SW2A 3V8XB 2HZKA 2Z8FA 2PVUA 3KJ7A 3Q27A 4L17A 1B3GA 1I69A 4IO4A 5IAIA 5I57B 3R6UA 2F7BA 5I2KB 1VFDA 2XXHA 4R6KA 1UIUA 1O63A 2GH9A 3MZ1A 5JK4A 3N6TA 4NMYA 5AA4B 3VFJA 2JODA 4QSDA 2F78A 1LFGA 5I2NA 1PDAA 1ZMGA 4XTCQ 1MQHA 4KPTA 4JXIA 3QAXA 1B5JA 3SEYA 1FTOA 5CBSA 4OMBA 1ATGA 3WAEA 2O1MA 4F19A 3E13X 2UVHA 4ZEFA 3IL1B 3CFLA 3RPWA 1PB9A 4ESXA 3LSLA 3BKIB 4EQ9A 3USDA 1DTZA 1S7YA 3MPKA 3OOAA 1FQBA 4UACA 3KSJA 3O29A 4GXAA 3OENA 1J1NA 3C35A 5DTBA 1MQDA 4ECFA 3FXQA 4IO7A 1H76A 3DLNA 3FGSA 3VV5A 2FA7A 1DOTA 3CFXA 2IEEA 3T22A 4QFOA 3QUFA 1H43A 4P11A 2I4CA 4QF9A 4NF5A 5HM4B 2Y7PA 3A3UA 3MVYA 3PUVE 5H8NA 5F1QA 3BBRA 4FORA 4YMAA 3WAFA 4MLVA 2DXYA 4ZEBA 4Q8RA 3IB1A 1PB8A 3RY3A 1NNFA 1B40A 3C31A 2XX7A 2XXRA 1URSA 2B3FA 4H8JA 4OTEA 1Y1MA 4BDRA 5I2NB 3BFTA 1TXFA 2XXPA 3U94A 5ICQA 3OELA 1AH5A 3F11A 3FUZA 2PMSA 3QUJA 2F97A 4YU0A 4MLQA 3KEIA 1NH8A 2QJEA 4F39A 4G77A 3LSFB 2F8DA 3UGWA 1FCKA 4FJPA 4O3AA 1TFAA 1P1OA 3VXBA 4ZEKA 1WDNA 4QSEA 1P99A 4E0WA 1FQEA 3T93B 4OZ9A 3KSXA 5FHNA 2UYEA 2H4IA 3C34A 1B4HA 3Q26A 4FIMA 3HHFA 4TQUQ 3FD3A 4DLOA 4EQ7A 3MWBA 1N84A 4R2BA 3TTNA 4P0IA 4RXLA 1N7XA 3VE1B 4NF5B 3CI8A 3KN8A 3C5TA 1QUIA 1JW5A 3ONMA 4FEBA 4U21A 5H8NB 3S9LC 3TCGA 4ZE9A 3N7SA 1LGBC 4DLDA 1SDXA 1SD3A 4BDNA 2F7AA 1MXVA 3U92A 4F1VA 1P1QA 3LSWA 4LATA 3M3KA 1MQJA 3IO4A 3CFZA 1B7HA 4HS7A 4F3BA 2PX1A 1ZBMA 2Y84A 4F1UA 3K1MA 4DE8A 1A55A 2X7QA 4HCWA 1Y4TA 2HAVA 4DIGA 2P1SA 3FV1A 1BKAA 3IOWA 2PT1A 2REJA 1RYOA 3B6TA 1IXGA 4IO5A 1MY3A 2GRVA 4E0XA 5EHMA 4MBPA 2GFEA 3I5OA 1B3LA 1QULA 4EDPA 4XKPA 2Y7KA 1B32A 4KD5A 4ISUA 1FQDA 1TT1A 3H6VA 2VD2A 4ZS9A 1B3FA 3C36A 1GR2A 3G3HA 2QS1A 3KBRA 4XKRA 3HCQA 3FJGA 3IOVA 4H5GA 2CMOA 3L6HA 4G68A 2O68A 1IZ1A 1IIWA 1BTJA 4F2OA 1VE4A 5TPAA 1JW4A 3K0VA 1UQWA 4DXUA 4NF4A 4LUBA 5CBRA 4G8NA 4YAHX 1SYHA 1OVBA 2QKHA 2I0BA 1M5BA 2VD3A 2XXVA 2RKMA 1N76A 2OWTA 1NH7A 2ZMBA 1GV8A 3QIMA 4KFQA 1SW1A 1MH4A 2R71A 3OMBA 1Y20A 1MS7A 2P0SA 2I3WA 1H45A 5CC2A 1R9QA 1NKXA 4H0WA 2O7IA 3CG3A 4F18A 2AL5A 1ZU0A 4YZZA 2VP1A 3QSLA 4LA9A 4R9FA 1XOCA 4N6PA 4ZEIA 2PBWA 2OLBA 1S9TA 2PYYA 3P7IA 3W9VA 3SEUA 1QKBA 1URDA 4PETA 1L5TA 4YKPA 4NWCA 2XXIA 3GBBA 4YKJA 3JYRA 3PD8A 1NMUA 4KYSA 1IXCA 5AE4A 1QJMA 4KYDA 4G68B 1OMPA 3UN6A 5L8DA 4TLMB 5TPAB 1PBQA 3ILTB 3IX1A 4NF4B 2DE3A 1I6BA 3L6GA 1DPEA 3K4UA 1PB7A 5BWJA 1UTHA 5DT6A 1NL5A 1USYH 3HSTA 4OVJA 3FVKA 3AQFB 3HV1A 3K02A 3N7RA 1EH3A 4ZE8A 3SDFA 4HW8A 3PPPA 4K3FA 4OWDA 4JDFA 4C1TA 2B3BA 2OWSA 3H06B 3OSRA 1TWYA 3SETA 4Q0CA 3D4CA 3E9XA 3CR9A 3OO8A 4TOZA 4JWYA 1ZIUA 4N07A 1OIBA 1ZKBA 3W9WA 3RNNA 5JTYA 4I8CA 4OFLA 3DELB 3TODA 4WXJA 1MH3A 2LAOA 1QUKA 2F35A 3MJNA 3V89B 2DOJA 4R6YA 2REGA 2H5YA 1B7UA 4FE8A 4H8IA 1LBBA 3OO9A 4R75A 1Q35A 4XKQA 4JWXA 3FIRA 5LOMA 3FASA 4QFKA 4EQBA 2ZNUA 4YMBA 2QL3A 1F9BA 1DTGA 3T9HB 1N3WA 5B7DA 1I6QA 3QYTA 1OLCA 2X7PA 1LAFE 2QMWA 4GL8A 2THIA 1A7LA 3PV0E 4U4SA 4QSCA 3S9EA 1FQCA 5AA3A 1UTHB 2OJTA 3Q25A 4EXLA 3VDFA 4QRZA 3MBPA 4MFIA 5CMKA 4IO6A 1NNKA 2AYSA 1EU8A 4O3CA 2I4BA 4DZ1A 2Q8JA 1FW0A 2ZNSA 3EPEA 5I59A 2DE4A 1MXXA 1OQGA 4LONB 1M5EA 1M5DA 4RPOA 3PD9A 3KFMA 4G8HA 4R74A 2Q2AA 3B7DA 3UP9A 5KZTA 1CE2A 2ESNA 3A09A 4QFLA 4OENA 3TDJA 5JTYB 3MP8A 5J1DA 2DWHA 1R1NA 2IA4A 3OXNA 1B51A 1TFDA 1WODA 4GVOA 3V5AA 4NF8A 1FTMA 5I84A 3LBSA 2Y7RA 3PUWE 3OO7A 3PGFA 1LCFA 1MY4A 2ZNTA 3S4UA 3G3KA 1B3EA 3KN3A 2AL4A 5II0A 4F3SA 2O7UA 4ZZEA 1D4NA 1SI1A 5ITOA 4ZECA 1LAHE 1A8EA 2Q88A 3CG1A 4GF8A 4F31B 1SI0A 2ABHA 2V3UA 3KJTA 3LR1A 1NNTA 3A3CA 2D5WA 3IAZA 1HSJA 2B65A 4RYAA 1QUJA 3MP6A 3MVWA 4F22A 4U1ZA 1AOVA 3W15C 2L27A 5L9MA 1BLFA 2VHAA 1D3KA 1B9JA 4WKMA 3K6UA 3R26A 1Y1ZA 1B6HA 5I59B 3RTFB 4M4GA 5ITPA 4AQ4A 3SKPA 4LF3C 1CB6A 1JQFA 2A5TA 2RC8A 1SW4A 3Q28A 1Y3NA 3JV9A 4RY1A 1DMBA 4NE4A 1IITA 4JWOA 4KQPA 5FHOA 1VR5A 3TFLA 5L9SA 3MVXA 4G2ZA 1M5FA 1ANFA 1GVCA 2QS2A 3LUYA 4U23A 5I56A 5ISUA 2ONRA 3LC8A 4NF8B 4F3PA 5CMMA 1M5CA 2XXTA 4GXSB 1B46A 1RYXA 2R9JA 3RGYA 4X1BA 3HN0A 1O7TA 2DVCA 1AL3A 4C1UA 5FTIA 4X48A 4HCYA 4N13A 2V93A 5AA2D 3C33A 4F1YA 2V3TA 4F29A 3RT6B 3OD7A 2VOZA 3MZ9A 4I9DA 4POXA 1MXZA 2Z23A 1HSEA 3M3LA 2UVGA 1A54A 3DM0A 1IXHA 1YPNA 2XDGA 3G3GA 2OBGA 2E0SA 1OLAA 3FVOA 5AA1A 4YICA 5DYHA 2ZYKA 1B0LA 4LQ5A 4ND9A 2Q89A 4F3GA 3UA8A 4OQOA 4P0GA 3MQ9A 3GZGA 3QK6A 4FEDA 1EZOA 4FECA 4BDOA 3KOTA 1KWHA 3TTLA 1R9LA 2NOOA 4PFWA 3U1OA 2JNCA 3MW0A 4GL0A 1H3DA 3CSBA 4U2RA 2A5TB 4XXUA 1LCTA 4PQJA 3H03A 4GRKA 2BJJX 2HAUA 3IJXB 2V25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCF A;  3TZA A;  2G29 A;  1FQA A;  1IQ7 A;  2ONS A;  1MDP 1;  1N7W A;  3IB2 A;  2DXR A;  3KGC A;  2XX8 A;  1JNF A;  3TPA A;  5I56 B;  1U34 A;  1B52 A;  3N26 A;  3PMV A;  5A5X A;  4YB6 A;  1WVJ A;  2H25 A;  1MDQ A;  2Q9T A;  4OYV A;  1SBP A;  2O51 A;  4BDL A;  2QS4 A;  3C4M A;  3IB0 A;  4DXB A;  1LFI A;  4O3B A;  4AB6 A;  3EHS A;  2RC7 A;  2XXU A;  1JEU A;  3IR1 A;  4AB5 A;  2Y7I A;  4OES A;  3VVE A;  3EQ1 A;  4RPN A;  4EXK A;  3KZG A;  3H3G A;  1IEJ A;  1EZP A;  4PFU A;  4IB2 A;  5H8H A;  1ZLQ A;  1URG A;  4RK9 A;  3MC2 A;  5TU0 A;  1MY1 A;  4GOT A;  2Q2C A;  1EZ9 A;  5BUU A;  1FTK A;  3RQT A;  1UIV A;  3GXA A;  1DSN A;  3THI A;  3H4Z A;  5HPQ A;  1US4 A;  4JBZ A;  3DP8 A;  3VVF A;  2DVZ A;  1OVT A;  4H5F A;  3PUX E;  5H8Q A;  1JW1 A;  3PPO A;  1Z7N E;  3LSX A;  4KCC A;  5B70 A;  1HSL A;  4GFR A;  5KCJ A;  2Y7W A;  4POW A;  4GD5 A;  3OO6 A;  1FTJ A;  3RN8 A;  2Z22 A;  5H8S A;  4IO3 A;  2V3Q A;  1SVX B;  1PBP A;  5L9O A;  4Q5T A;  4OFJ A;  3N94 A;  1MQG A;  5TP9 A;  3HPI A;  1QW0 A;  2F5X A;  5I58 A;  3C9H A;  1ZTY A;  5ELV A;  4ZGM A;  1S50 A;  1XS5 A;  3K1N A;  3UK4 A;  5A5X B;  4Z7E A;  2E1S A;  3MP1 A;  2I58 A;  2DQV A;  2KLF A;  4LVQ A;  3S9N C;  3O2A A;  3EHT A;  3H7M A;  3UOR A;  2XHD A;  2I49 A;  1SYI A;  3K1P A;  3CVG A;  1BP5 A;  4Z0I A;  3KG2 A;  2FYI A;  4X9T A;  3U93 A;  2H9B A;  2F36 A;  3PUZ E;  3ZKL A;  3FXR A;  4PE5 B;  5HBC A;  5DVJ A;  4OXV A;  3PMX A;  1XVY A;  1Q1K A;  3K6V A;  3I6V A;  3V83 A;  4H67 A;  3U8Q A;  5H8H B;  1NFT A;  3FAT A;  4ELR A;  1B4Z A;  4G4P A;  3FXU A;  2HCA A;  1ZJL A;  2D21 A;  2OK2 A;  1MXY A;  3SES A;  4ERS A;  5DVI A;  1LB9 A;  2O84 X;  5K2X A;  3S9M C;  1MM7 A;  5H8Q B;  3DP6 A;  4R72 A;  3TTK A;  1MG1 A;  2VGQ A;  3N5L A;  1UTB B;  3FV2 A;  2ZYM A;  2XXY A;  4OHN A;  2QRY A;  2HZL A;  3O97 A;  5KCJ B;  1N3X A;  5CI5 A;  2FNC A;  1N0T A;  4GLI A;  1USY E;  4QFP A;  2HFB A;  2XD2 A;  4OEU A;  1B58 A;  2JND A;  1Y3P A;  3MUQ A;  1MRP A;  3EF7 A;  5TP9 B;  3CIJ A;  3C32 A;  4H1X A;  4BDM A;  1GGG A;  4ZED A;  4EF1 A;  5I58 B;  2ZYN A;  4WED A;  3G7W A;  3IOR A;  4ELO A;  4XIG Q;  4R9G A;  3G3J A;  3VLW A;  5FHM A;  4HTG A;  4ONY A;  3G3I A;  4IY5 A;  1Y4C A;  3FZV A;  2DSF A;  5CRY A;  2QS3 A;  1SW5 A;  3K6W A;  1DPP A;  3PU5 A;  4Q30 B;  1Y3Q A;  1B0H A;  1A40 A;  3PMW A;  3TMG A;  5FTH A;  1A99 A;  4JB7 A;  3B6W A;  1Y9U A;  2DE2 A;  3O6I A;  1MPC A;  1US5 A;  5AA2 A;  2I48 A;  1LLS A;  4IO2 A;  1XC1 A;  3HO7 A;  4MH5 A;  2UVI A;  2QMX A;  2UYF A;  4LZ7 A;  2XX9 A;  2RF1 A;  1B05 A;  4HJ0 A;  1B5I A;  3GLB A;  1D9V A;  4RNS A;  4U22 A;  3U72 A;  1SQY A;  3EN3 A;  4DXC A;  4RJZ A;  3MPL A;  2F6G A;  3M3F A;  2HXW A;  4DDD A;  2I0C A;  1RKM A;  4JSO A;  1IUD A;  2NXO A;  3PPN A;  3VXC A;  4BLA A;  1B7Z A;  2YLN A;  3ILU B;  3PPQ A;  3B6Q A;  3MVZ A;  3TKD A;  4U1O A;  3CSG A;  2P2A A;  3D4G A;  2DS9 A;  2O69 A;  3FJM A;  4ESW A;  1XHY A;  3SEX A;  1POY 1;  2UXA A;  4UA8 A;  4YKI A;  4THI A;  2ALU A;  4DLQ A;  3T9V A;  3H6T A;  1MXW A;  3HHG A;  4IY6 A;  3O6G A;  4R73 A;  3IK6 B;  2XD3 A;  1GTK A;  4WEP A;  3M8U A;  3O6H A;  3IOT A;  4G68 C;  3TAJ A;  2HQ0 A;  3IOL A;  5EHS A;  1MQI A;  5AA2 B;  2GHB A;  3OEM A;  3IOU A;  1OQH A;  4PFT A;  2DP8 A;  2R6G E;  4KHZ E;  3DP4 A;  3BFU A;  1ELJ A;  4YB5 A;  4KI0 E;  4DCX A;  1LFH A;  3FJ7 A;  2G93 A;  1Z7M E;  5CMC A;  1P1U A;  4GQO A;  3TTR A;  4KR5 A;  3E4R A;  3TCH A;  2ZYO A;  3L2J A;  4OFO A;  1LAX A;  3T9X B;  3KN7 A;  3TQW A;  4OET A;  4LZ5 A;  2XXX A;  2NVU B;  3T66 A;  3PPR A;  4NF6 A;  2UVJ A;  2NUV A;  2M8C A;  2NWJ A;  4NTL A;  3RTW B;  3ZSF A;  3CRB A;  1POT A;  3ZS6 A;  1AMF A;  2H98 A;  4R2F A;  4EF2 A;  4F2Q A;  2DYX A;  1IXI A;  1XVX A;  1H44 A;  3TQL A;  3SEW A;  3K01 A;  1T0K A;  1QKA A;  3MZB A;  4U4X A;  4LQ2 A;  5CM6 A;  1MY2 A;  4FAJ A;  4YKK A;  3FVN A;  1JEV A;  3AXF A;  3VLU A;  1MPD A;  3T96 B;  2OCU A;  1P1N A;  3I3V A;  3SER A;  1JVX A;  3OEK A;  5H8F A;  5DEX A;  2RIN A;  3K6X A;  2QSX A;  4ZDM A;  1NNP A;  3K2D A;  1VFE A;  5CMB A;  5IKB A;  3SEV A;  1B1H A;  4RK2 A;  4LP2 B;  4I1D A;  1B1X A;  3VLV A;  3FVG A;  4IGR A;  4RA1 A;  1LAG E;  4ZZA A;  2I6E A;  5F7V A;  2X26 A;  3TTM A;  4IGT A;  3RT8 A;  5M2V A;  2A5S A;  4XKN A;  3PUY E;  5EYF A;  2PT2 A;  4MF3 A;  2CZL A;  3KOS A;  2RCB A;  3TEL A;  1YCJ A;  2H99 A;  3JZJ A;  3T9U A;  2V84 A;  4NWD A;  2YJP A;  3O66 A;  4NF6 B;  4H65 A;  5K2Y A;  4DCY A;  1A8F A;  5KDT A;  3S2V A;  4OEV A;  1R6Z A;  2YPN A;  1LST A;  3TEP A;  1JVY A;  2DWJ A;  4PP0 A;  1LB8 A;  1VSO A;  2WKY A;  2AIX A;  1FTL A;  2D3I A;  4GIZ A;  4KCD A;  1UTB A;  2GHA A;  2W7Y A;  4PFY A;  3C59 A;  2Z8D A;  4TLL B;  1BIY A;  1XT8 A;  2O6A A;  3GBA A;  2RC9 A;  2Z8E A;  4R6H A;  3TUS A;  2XXQ A;  3H6U A;  3TYH A;  3R7X A;  2DWI A;  5H8F B;  1II5 A;  1LBC A;  5DEX B;  2F34 A;  3ECR A;  5I57 A;  1JET A;  2I3V A;  4LZ8 A;  5I2K A;  3RLF E;  1YTV A;  3K00 A;  2ZXT A;  1MPB A;  2ONK E;  2QPQ A;  1O64 A;  3N6U A;  5AA4 A;  1I6A A;  3IO6 A;  4OER A;  4QHQ A;  4NED A;  4C0R A;  1D9Y A;  2O1L A;  3IJO B;  4X1D A;  1FQF A;  1PEB A;  1PC3 A;  4JSD A;  3ODB A;  4EUO A;  1N04 A;  3VVD A;  2XXW A;  3EHU A;  4I62 A;  3E3K A;  2F6P A;  1QVS A;  4BDQ A;  3RUM A;  4KYE A;  3G3F A;  3H6W A;  4QFN A;  3UIF A;  2HEU A;  3MAM A;  2OZZ A;  3O28 A;  5KDT B;  1YAE A;  4GWO A;  1MXU A;  4ELQ A;  3Q29 A;  1B2H A;  5DVF A;  3OSQ A;  1B3H A;  1P1W A;  1AIV A;  4M1V A;  4G8M A;  2F7C A;  3N7P A;  3ZKK A;  3QXM A;  3O9P A;  4YB7 A;  5JEI A;  4ELP A;  2ANJ A;  2RCA A;  1MM6 A;  5ICT A;  1B5H A;  2DWA A;  4FAT A;  4H6D A;  1MY0 A;  1SW2 A;  3V8X B;  2HZK A;  2Z8F A;  2PVU A;  3KJ7 A;  3Q27 A;  4L17 A;  1B3G A;  1I69 A;  4IO4 A;  5IAI A;  5I57 B;  3R6U A;  2F7B A;  5I2K B;  1VFD A;  2XXH A;  4R6K A;  1UIU A;  1O63 A;  2GH9 A;  3MZ1 A;  5JK4 A;  3N6T A;  4NMY A;  5AA4 B;  3VFJ A;  2JOD A;  4QSD A;  2F78 A;  1LFG A;  5I2N A;  1PDA A;  1ZMG A;  4XTC Q;  1MQH A;  4KPT A;  4JXI A;  3QAX A;  1B5J A;  3SEY A;  1FTO A;  5CBS A;  4OMB A;  1ATG A;  3WAE A;  2O1M A;  4F19 A;  3E13 X;  2UVH A;  4ZEF A;  3IL1 B;  3CFL A;  3RPW A;  1PB9 A;  4ESX A;  3LSL A;  3BKI B;  4EQ9 A;  3USD A;  1DTZ A;  1S7Y A;  3MPK A;  3OOA A;  1FQB A;  4UAC A;  3KSJ A;  3O29 A;  4GXA A;  3OEN A;  1J1N A;  3C35 A;  5DTB A;  1MQD A;  4ECF A;  3FXQ A;  4IO7 A;  1H76 A;  3DLN A;  3FGS A;  3VV5 A;  2FA7 A;  1DOT A;  3CFX A;  2IEE A;  3T22 A;  4QFO A;  3QUF A;  1H43 A;  4P11 A;  2I4C A;  4QF9 A;  4NF5 A;  5HM4 B;  2Y7P A;  3A3U A;  3MVY A;  3PUV E;  5H8N A;  5F1Q A;  3BBR A;  4FOR A;  4YMA A;  3WAF A;  4MLV A;  2DXY A;  4ZEB A;  4Q8R A;  3IB1 A;  1PB8 A;  3RY3 A;  1NNF A;  1B40 A;  3C31 A;  2XX7 A;  2XXR A;  1URS A;  2B3F A;  4H8J A;  4OTE A;  1Y1M A;  4BDR A;  5I2N B;  3BFT A;  1TXF A;  2XXP A;  3U94 A;  5ICQ A;  3OEL A;  1AH5 A;  3F11 A;  3FUZ A;  2PMS A;  3QUJ A;  2F97 A;  4YU0 A;  4MLQ A;  3KEI A;  1NH8 A;  2QJE A;  4F39 A;  4G77 A;  3LSF B;  2F8D A;  3UGW A;  1FCK A;  4FJP A;  4O3A A;  1TFA A;  1P1O A;  3VXB A;  4ZEK A;  1WDN A;  4QSE A;  1P99 A;  4E0W A;  1FQE A;  3T93 B;  4OZ9 A;  3KSX A;  5FHN A;  2UYE A;  2H4I A;  3C34 A;  1B4H A;  3Q26 A;  4FIM A;  3HHF A;  4TQU Q;  3FD3 A;  4DLO A;  4EQ7 A;  3MWB A;  1N84 A;  4R2B A;  3TTN A;  4P0I A;  4RXL A;  1N7X A;  3VE1 B;  4NF5 B;  3CI8 A;  3KN8 A;  3C5T A;  1QUI A;  1JW5 A;  3ONM A;  4FEB A;  4U21 A;  5H8N B;  3S9L C;  3TCG A;  4ZE9 A;  3N7S A;  1LGB C;  4DLD A;  1SDX A;  1SD3 A;  4BDN A;  2F7A A;  1MXV A;  3U92 A;  4F1V A;  1P1Q A;  3LSW A;  4LAT A;  3M3K A;  1MQJ A;  3IO4 A;  3CFZ A;  1B7H A;  4HS7 A;  4F3B A;  2PX1 A;  1ZBM A;  2Y84 A;  4F1U A;  3K1M A;  4DE8 A;  1A55 A;  2X7Q A;  4HCW A;  1Y4T A;  2HAV A;  4DIG A;  2P1S A;  3FV1 A;  1BKA A;  3IOW A;  2PT1 A;  2REJ A;  1RYO A;  3B6T A;  1IXG A;  4IO5 A;  1MY3 A;  2GRV A;  4E0X A;  5EHM A;  4MBP A;  2GFE A;  3I5O A;  1B3L A;  1QUL A;  4EDP A;  4XKP A;  2Y7K A;  1B32 A;  4KD5 A;  4ISU A;  1FQD A;  1TT1 A;  3H6V A;  2VD2 A;  4ZS9 A;  1B3F A;  3C36 A;  1GR2 A;  3G3H A;  2QS1 A;  3KBR A;  4XKR A;  3HCQ A;  3FJG A;  3IOV A;  4H5G A;  2CMO A;  3L6H A;  4G68 A;  2O68 A;  1IZ1 A;  1IIW A;  1BTJ A;  4F2O A;  1VE4 A;  5TPA A;  1JW4 A;  3K0V A;  1UQW A;  4DXU A;  4NF4 A;  4LUB A;  5CBR A;  4G8N A;  4YAH X;  1SYH A;  1OVB A;  2QKH A;  2I0B A;  1M5B A;  2VD3 A;  2XXV A;  2RKM A;  1N76 A;  2OWT A;  1NH7 A;  2ZMB A;  1GV8 A;  3QIM A;  4KFQ A;  1SW1 A;  1MH4 A;  2R71 A;  3OMB A;  1Y20 A;  1MS7 A;  2P0S A;  2I3W A;  1H45 A;  5CC2 A;  1R9Q A;  1NKX A;  4H0W A;  2O7I A;  3CG3 A;  4F18 A;  2AL5 A;  1ZU0 A;  4YZZ A;  2VP1 A;  3QSL A;  4LA9 A;  4R9F A;  1XOC A;  4N6P A;  4ZEI A;  2PBW A;  2OLB A;  1S9T A;  2PYY A;  3P7I A;  3W9V A;  3SEU A;  1QKB A;  1URD A;  4PET A;  1L5T A;  4YKP A;  4NWC A;  2XXI A;  3GBB A;  4YKJ A;  3JYR A;  3PD8 A;  1NMU A;  4KYS A;  1IXC A;  5AE4 A;  1QJM A;  4KYD A;  4G68 B;  1OMP A;  3UN6 A;  5L8D A;  4TLM B;  5TPA B;  1PBQ A;  3ILT B;  3IX1 A;  4NF4 B;  2DE3 A;  1I6B A;  3L6G A;  1DPE A;  3K4U A;  1PB7 A;  5BWJ A;  1UTH A;  5DT6 A;  1NL5 A;  1USY H;  3HST A;  4OVJ A;  3FVK A;  3AQF B;  3HV1 A;  3K02 A;  3N7R A;  1EH3 A;  4ZE8 A;  3SDF A;  4HW8 A;  3PPP A;  4K3F A;  4OWD A;  4JDF A;  4C1T A;  2B3B A;  2OWS A;  3H06 B;  3OSR A;  1TWY A;  3SET A;  4Q0C A;  3D4C A;  3E9X A;  3CR9 A;  3OO8 A;  4TOZ A;  4JWY A;  1ZIU A;  4N07 A;  1OIB A;  1ZKB A;  3W9W A;  3RNN A;  5JTY A;  4I8C A;  4OFL A;  3DEL B;  3TOD A;  4WXJ A;  1MH3 A;  2LAO A;  1QUK A;  2F35 A;  3MJN A;  3V89 B;  2DOJ A;  4R6Y A;  2REG A;  2H5Y A;  1B7U A;  4FE8 A;  4H8I A;  1LBB A;  3OO9 A;  4R75 A;  1Q35 A;  4XKQ A;  4JWX A;  3FIR A;  5LOM A;  3FAS A;  4QFK A;  4EQB A;  2ZNU A;  4YMB A;  2QL3 A;  1F9B A;  1DTG A;  3T9H B;  1N3W A;  5B7D A;  1I6Q A;  3QYT A;  1OLC A;  2X7P A;  1LAF E;  2QMW A;  4GL8 A;  2THI A;  1A7L A;  3PV0 E;  4U4S A;  4QSC A;  3S9E A;  1FQC A;  5AA3 A;  1UTH B;  2OJT A;  3Q25 A;  4EXL A;  3VDF A;  4QRZ A;  3MBP A;  4MFI A;  5CMK A;  4IO6 A;  1NNK A;  2AYS A;  1EU8 A;  4O3C A;  2I4B A;  4DZ1 A;  2Q8J A;  1FW0 A;  2ZNS A;  3EPE A;  5I59 A;  2DE4 A;  1MXX A;  1OQG A;  4LON B;  1M5E A;  1M5D A;  4RPO A;  3PD9 A;  3KFM A;  4G8H A;  4R74 A;  2Q2A A;  3B7D A;  3UP9 A;  5KZT A;  1CE2 A;  2ESN A;  3A09 A;  4QFL A;  4OEN A;  3TDJ A;  5JTY B;  3MP8 A;  5J1D A;  2DWH A;  1R1N A;  2IA4 A;  3OXN A;  1B51 A;  1TFD A;  1WOD A;  4GVO A;  3V5A A;  4NF8 A;  1FTM A;  5I84 A;  3LBS A;  2Y7R A;  3PUW E;  3OO7 A;  3PGF A;  1LCF A;  1MY4 A;  2ZNT A;  3S4U A;  3G3K A;  1B3E A;  3KN3 A;  2AL4 A;  5II0 A;  4F3S A;  2O7U A;  4ZZE A;  1D4N A;  1SI1 A;  5ITO A;  4ZEC A;  1LAH E;  1A8E A;  2Q88 A;  3CG1 A;  4GF8 A;  4F31 B;  1SI0 A;  2ABH A;  2V3U A;  3KJT A;  3LR1 A;  1NNT A;  3A3C A;  2D5W A;  3IAZ A;  1HSJ A;  2B65 A;  4RYA A;  1QUJ A;  3MP6 A;  3MVW A;  4F22 A;  4U1Z A;  1AOV A;  3W15 C;  2L27 A;  5L9M A;  1BLF A;  2VHA A;  1D3K A;  1B9J A;  4WKM A;  3K6U A;  3R26 A;  1Y1Z A;  1B6H A;  5I59 B;  3RTF B;  4M4G A;  5ITP A;  4AQ4 A;  3SKP A;  4LF3 C;  1CB6 A;  1JQF A;  2A5T A;  2RC8 A;  1SW4 A;  3Q28 A;  1Y3N A;  3JV9 A;  4RY1 A;  1DMB A;  4NE4 A;  1IIT A;  4JWO A;  4KQP A;  5FHO A;  1VR5 A;  3TFL A;  5L9S A;  3MVX A;  4G2Z A;  1M5F A;  1ANF A;  1GVC A;  2QS2 A;  3LUY A;  4U23 A;  5I56 A;  5ISU A;  2ONR A;  3LC8 A;  4NF8 B;  4F3P A;  5CMM A;  1M5C A;  2XXT A;  4GXS B;  1B46 A;  1RYX A;  2R9J A;  3RGY A;  4X1B A;  3HN0 A;  1O7T A;  2DVC A;  1AL3 A;  4C1U A;  5FTI A;  4X48 A;  4HCY A;  4N13 A;  2V93 A;  5AA2 D;  3C33 A;  4F1Y A;  2V3T A;  4F29 A;  3RT6 B;  3OD7 A;  2VOZ A;  3MZ9 A;  4I9D A;  4POX A;  1MXZ A;  2Z23 A;  1HSE A;  3M3L A;  2UVG A;  1A54 A;  3DM0 A;  1IXH A;  1YPN A;  2XDG A;  3G3G A;  2OBG A;  2E0S A;  1OLA A;  3FVO A;  5AA1 A;  4YIC A;  5DYH A;  2ZYK A;  1B0L A;  4LQ5 A;  4ND9 A;  2Q89 A;  4F3G A;  3UA8 A;  4OQO A;  4P0G A;  3MQ9 A;  3GZG A;  3QK6 A;  4FED A;  1EZO A;  4FEC A;  4BDO A;  3KOT A;  1KWH A;  3TTL A;  1R9L A;  2NOO A;  4PFW A;  3U1O A;  2JNC A;  3MW0 A;  4GL0 A;  1H3D A;  3CSB A;  4U2R A;  2A5T B;  4XXU A;  1LCT A;  4PQJ A;  3H03 A;  4GRK A;  2BJJ X;  2HAU A;  3IJX B;  2V25 A; 
#chains in the Genus database with same CATH topology
 3TCF A;  3TZA A;  2G29 A;  1FQA A;  1IQ7 A;  2ONS A;  1MDP 1;  1N7W A;  3IB2 A;  2DXR A;  3KGC A;  2XX8 A;  1JNF A;  2XA5 A;  2QVR A;  5ET8 A;  3TPA A;  5I56 B;  1U34 A;  1B52 A;  3N26 A;  3PMV A;  5A5X A;  4YB6 A;  4O7M A;  2WEF A;  1WVJ A;  2H25 A;  1MDQ A;  2Q9T A;  4OYV A;  1SBP A;  2O51 A;  1QGX A;  4BDL A;  2QS4 A;  3C4M A;  3IB0 A;  4DXB A;  1LFI A;  4O3B A;  4AB6 A;  3EHS A;  1FTA A;  2RC7 A;  2XXU A;  1JEU A;  3IR1 A;  4AB5 A;  2Y7I A;  4OES A;  3VVE A;  3EQ1 A;  4RPN A;  4EXK A;  3KZG A;  3H3G A;  4KXP A;  1IEJ A;  1EZP A;  4HE0 A;  4GWS A;  1NV3 A;  4PFU A;  4IB2 A;  5H8H A;  1ZLQ A;  1URG A;  4RK9 A;  3MC2 A;  5TU0 A;  1MY1 A;  4GOT A;  2Q2C A;  1EZ9 A;  5BUU A;  1FTK A;  3RQT A;  1UIV A;  3GXA A;  1DSN A;  3THI A;  3H4Z A;  5HPQ A;  1US4 A;  2HPG A;  3E79 A;  3DP8 A;  4JBZ A;  3VVF A;  2DVZ A;  3GYY A;  1OVT A;  3KBZ A;  4H5F A;  3PUX E;  1KA1 A;  5ET5 A;  5H8Q A;  1JW1 A;  5LDZ A;  3PPO A;  1Z7N E;  1CNQ A;  3LSX A;  2B4L A;  4KCC A;  5B70 A;  1HSL A;  4GFR A;  5KCJ A;  2Y7W A;  4POW A;  4GD5 A;  3OO6 A;  1FTJ A;  3RN8 A;  2Z22 A;  5H8S A;  1FBD A;  4IO3 A;  2V3Q A;  1SVX B;  1PBP A;  5L9O A;  4Q5T A;  2QFL A;  4OFJ A;  1NV5 A;  3N94 A;  4PAF A;  1MQG A;  5TP9 A;  3HPI A;  4NHB A;  1QW0 A;  2CZH A;  2F5X A;  5I58 A;  3MYU A;  3C9H A;  2XWO A;  4MAG A;  4OVQ A;  1ZTY A;  5ELV A;  4ZGM A;  1K9Y A;  1S50 A;  1XS5 A;  3K1N A;  3UK4 A;  5A5X B;  4Z7E A;  2E1S A;  3MP1 A;  2I58 A;  4P1L A;  2DQV A;  2KLF A;  4LVQ A;  3S9N C;  3O2A A;  3EHT A;  3H7M A;  3UOR A;  2XHD A;  2I49 A;  1SYI A;  3K1P A;  3CVG A;  1BP5 A;  3ROJ A;  4Z0I A;  3KG2 A;  2FYI A;  4X9T A;  3U93 A;  2H9B A;  2F36 A;  4FBP A;  3PUZ E;  3ZKL A;  2ZZW A;  3FXR A;  4PE5 B;  5HBC A;  5DVJ A;  4OXV A;  3ISP A;  3PMX A;  1XVY A;  1Q1K A;  3K6V A;  3I6V A;  3V83 A;  4H67 A;  3U8Q A;  5J16 A;  5H8H B;  1NFT A;  3FAT A;  4ELR A;  1B4Z A;  4PAK A;  4G4P A;  4NAP A;  3FXU A;  2HCA A;  1ZJL A;  2D21 A;  2OK2 A;  1MXY A;  3FXB A;  4N15 A;  4XFE A;  4NGU A;  3SES A;  4ERS A;  5DVI A;  1LB9 A;  4PTK A;  2OWZ A;  1Q9D A;  2O84 X;  5K2X A;  3S9M C;  1MM7 A;  5H8Q B;  3DP6 A;  4R72 A;  3TTK A;  1MG1 A;  2VGQ A;  1FBP A;  3N5L A;  1UTB B;  3FV2 A;  2ZYM A;  2XXY A;  4OHN A;  2QRY A;  2HZL A;  3O97 A;  5KCJ B;  1N3X A;  2FNC A;  5CI5 A;  5I5P A;  1N0T A;  4GLI A;  1USY E;  4QFP A;  2HFB A;  1RDX A;  2XD2 A;  4OEU A;  1B58 A;  2JND A;  1Y3P A;  3MUQ A;  4PFR A;  5IZ3 A;  1MRP A;  3EF7 A;  5TP9 B;  3CIJ A;  3C32 A;  4H1X A;  4BDM A;  1GGG A;  4ZED A;  4EF1 A;  5I58 B;  2XWV A;  2ZYN A;  4WED A;  3G7W A;  3IOR A;  3RYD A;  4ELO A;  4XIG Q;  4R9G A;  2XWK A;  3G3J A;  3VLW A;  5FHM A;  4HTG A;  4ONY A;  3G3I A;  3NOH A;  4MNP A;  4IY5 A;  3E78 A;  1Y4C A;  4N6K A;  3FZV A;  2DSF A;  5CRY A;  2QS3 A;  1NI9 A;  1SPI A;  1SW5 A;  3D1R A;  3K6W A;  4PDH A;  1DPP A;  3PU5 A;  4Q30 B;  1Y3Q A;  1B0H A;  1A40 A;  3PMW A;  3TMG A;  5FTH A;  1A99 A;  4JB7 A;  3B6W A;  1Y9U A;  2DE2 A;  3O6I A;  1MPC A;  1NUY A;  1US5 A;  5AA2 A;  2I48 A;  1IME A;  1LLS A;  4NQ8 A;  4GWZ A;  4IO2 A;  1FBH A;  1XC1 A;  3HO7 A;  4MH5 A;  2UVI A;  2QMX A;  4PC9 A;  2XWI A;  1LBV A;  2UYF A;  4LZ7 A;  2XX9 A;  2RF1 A;  1B05 A;  4HJ0 A;  1B5I A;  4N4U A;  3GLB A;  5A5L A;  1D9V A;  4RNS A;  4PFI A;  4U22 A;  3U72 A;  1SQY A;  3EN3 A;  4DXC A;  4RJZ A;  2Q8M A;  3MPL A;  2F6G A;  3M3F A;  1NV0 A;  2HXW A;  4DDD A;  2I0C A;  1RKM A;  4JSO A;  1IUD A;  2NXO A;  3PPN A;  3VXC A;  4BLA A;  2ZZV A;  5IZ3 B;  1B7Z A;  2YLN A;  5IM2 A;  3ILU B;  3PPQ A;  3B6Q A;  3MVZ A;  3TKD A;  4U1O A;  2FIE A;  3CSG A;  2HXR A;  4GWW A;  2P2A A;  4PF6 A;  3D4G A;  2DS9 A;  2O69 A;  3FJM A;  4ESW A;  1XHY A;  3SEX A;  1POY 1;  2UXA A;  4UA8 A;  4YKI A;  4THI A;  2ALU A;  4DLQ A;  3T9V A;  3H6T A;  1MXW A;  3HHG A;  4IY6 A;  4PCD A;  3O6G A;  4R73 A;  3IK6 B;  2XD3 A;  1GTK A;  4GWU A;  2WBD A;  4WEP A;  3M8U A;  3O6H A;  3IOT A;  4G68 C;  3TAJ A;  2HQ0 A;  2FVZ A;  1G0I A;  3IOL A;  5EQ7 A;  1JP4 A;  5EHS A;  1MQI A;  5AA2 B;  2GHB A;  3OEM A;  3IOU A;  1OQH A;  4N91 A;  4PFT A;  2DP8 A;  1IMD A;  2R6G E;  3B8B A;  4KHZ E;  3DP4 A;  3BFU A;  1ELJ A;  4YB5 A;  4KI0 E;  4DCX A;  1LFH A;  3FJ7 A;  2G93 A;  1Z7M E;  5CMC A;  1FJ9 A;  2HHM A;  1P1U A;  4GQO A;  5I7I A;  3TTR A;  4KR5 A;  4GBV A;  3E4R A;  3TCH A;  5DW8 A;  2ZYO A;  3L2J A;  4OFO A;  1LAX A;  3T9X B;  3KN7 A;  4MEV A;  3TQW A;  4OET A;  4LZ5 A;  2XXX A;  2NVU B;  3T66 A;  4P56 A;  3PPR A;  4NF6 A;  2UVJ A;  2NUV A;  2M8C A;  2NWJ A;  4NTL A;  3RTW B;  3ZSF A;  3CRB A;  1POT A;  3ZS6 A;  5FBP A;  1AMF A;  1BK4 A;  2H98 A;  4R2F A;  3QMF A;  3LV0 A;  4EF2 A;  2KQZ A;  4JVD A;  4F2Q A;  2DYX A;  4OVR A;  1IXI A;  1XVX A;  1H44 A;  3TQL A;  3SEW A;  3K01 A;  1T0K A;  1FBF A;  1QKA A;  3MZB A;  4U4X A;  4I40 A;  4LQ2 A;  5CM6 A;  1MY2 A;  4FAJ A;  4YKK A;  3FVN A;  1JEV A;  3AXF A;  3VLU A;  1MPD A;  3T96 B;  1NUW A;  2OCU A;  1P1N A;  3I3V A;  3SER A;  1JVX A;  3OEK A;  5H8F A;  5DEX A;  2RIN A;  3K6X A;  2QSX A;  4ZDM A;  1NNP A;  3K2D A;  1VFE A;  5CMB A;  5IKB A;  2VPN A;  5LTC A;  3SEV A;  1B1H A;  1XI6 A;  4DI4 B;  4NN3 A;  4RK2 A;  4LP2 B;  4I1D A;  1B1X A;  4IR8 A;  3VLV A;  3FVG A;  4IGR A;  4RA1 A;  1LAG E;  4ZZA A;  2I6E A;  5F7V A;  2X26 A;  4MIJ A;  4O94 A;  3LUZ A;  3TTM A;  4IGT A;  3RT8 A;  5M2V A;  2A5S A;  4XKN A;  2Y5L A;  3PUY E;  5EYF A;  2PT2 A;  1FPG A;  4MF3 A;  2CZL A;  3KOS A;  2RCB A;  3TEL A;  1YCJ A;  2H99 A;  3JZJ A;  4H45 A;  3T9U A;  2V84 A;  4NWD A;  1FPJ A;  2YJP A;  3O66 A;  4NF6 B;  4H65 A;  5K2Y A;  1LEV A;  4DCY A;  5EQ8 A;  1A8F A;  5KDT A;  3S2V A;  4OEV A;  2CEY A;  1R6Z A;  4PGP A;  2YPN A;  2XXK A;  1LST A;  3TEP A;  1JVY A;  2DWJ A;  4PP0 A;  1LB8 A;  1VSO A;  2WKY A;  2AIX A;  1FTL A;  2D3I A;  4GIZ A;  4KCD A;  1UTB A;  2GHA A;  4PFY A;  2W7Y A;  3C59 A;  2Z8D A;  5IZZ A;  4TLL B;  1BIY A;  1XT8 A;  2O6A A;  3GBA A;  2RC9 A;  2Z8E A;  4R6H A;  3TUS A;  2XXQ A;  3H6U A;  3TYH A;  3R7X A;  1LBY A;  2DWI A;  5H8F B;  1II5 A;  1LBC A;  5DEX B;  2F34 A;  3ECR A;  1IMC A;  5I57 A;  1JET A;  2I3V A;  4LZ8 A;  5I2K A;  1RDY A;  1D9Q A;  3RLF E;  1YTV A;  3K00 A;  2ZXT A;  1MPB A;  4NF0 A;  2ONK E;  2QPQ A;  1O64 A;  3N6U A;  5AA4 A;  1KZ8 A;  1I6A A;  5EYG A;  3IO6 A;  4OER A;  4QHQ A;  4NED A;  4C0R A;  1D9Y A;  1AWB A;  2O1L A;  3IJO B;  4X1D A;  1FQF A;  1PEB A;  1PC3 A;  4JSD A;  3ODB A;  4EUO A;  1N04 A;  3T0J A;  3VVD A;  2XXW A;  3EHU A;  4MNC A;  4I62 A;  2PFY A;  2WX9 A;  3E3K A;  2F6P A;  1QVS A;  4BDQ A;  3RUM A;  4KYE A;  1LBW A;  3G3F A;  3H6W A;  4QFN A;  3UIF A;  2HEU A;  3MAM A;  2OZZ A;  3O28 A;  5KDT B;  1YAE A;  4GWO A;  1MXU A;  4ELQ A;  3Q29 A;  1B2H A;  5DVF A;  3OSQ A;  1B3H A;  1P1W A;  1AIV A;  4M1V A;  4G8M A;  2F7C A;  3N7P A;  1FRP A;  3ZKK A;  3QXM A;  3O9P A;  4YB7 A;  5JEI A;  3PTY A;  4ELP A;  2ANJ A;  1IMA A;  2RCA A;  1MM6 A;  5ICT A;  1B5H A;  2DWA A;  4FAT A;  4H6D A;  4MHF A;  1MY0 A;  1SW2 A;  3V8X B;  2HZK A;  2Z8F A;  2PVU A;  3KJ7 A;  3Q27 A;  4O8M A;  4L17 A;  1B3G A;  1DCU A;  3RPL A;  1I69 A;  4P9K A;  4IO4 A;  5IAI A;  5I57 B;  3R6U A;  2F7B A;  5I2K B;  1VFD A;  2XXH A;  4R6K A;  1UIU A;  1O63 A;  2WYP A;  2GH9 A;  3MZ1 A;  5JK4 A;  3N6T A;  4NMY A;  2BJI A;  5AA4 B;  3VFJ A;  5ET6 A;  2JOD A;  4N6D A;  4QSD A;  2F78 A;  1LFG A;  4OVS A;  5I2N A;  3HFU A;  1PDA A;  1ZMG A;  2VT5 A;  4XTC Q;  1MQH A;  4KPT A;  4JXI A;  3QAX A;  1B5J A;  4JVC A;  3SEY A;  1FTO A;  5CBS A;  1DBZ A;  4OMB A;  1ATG A;  2QVU A;  3WAE A;  2O1M A;  4F19 A;  3E13 X;  2UVH A;  4ZEF A;  3IL1 B;  3CFL A;  3RPW A;  1PB9 A;  4ESX A;  2P3V A;  3LSL A;  3BKI B;  4EQ9 A;  3USD A;  1DTZ A;  1S7Y A;  3MPK A;  3OOA A;  4H46 A;  1FQB A;  4UAC A;  3KSJ A;  3O29 A;  3A29 A;  4GXA A;  4PAI A;  3OEN A;  1J1N A;  3C35 A;  5DTB A;  1MQD A;  4ECF A;  3FXQ A;  4IO7 A;  2ZZX A;  4GWY A;  1H76 A;  3DLN A;  4G61 A;  2PFZ A;  3FGS A;  3VV5 A;  2FA7 A;  1DOT A;  3CFX A;  2IEE A;  3T22 A;  4QFO A;  1YZ0 A;  3QUF A;  1H43 A;  4P11 A;  2I4C A;  4QF9 A;  4NF5 A;  5HM4 B;  2Y7P A;  3A3U A;  3MVY A;  3PUV E;  4P1E A;  5H8N A;  2Q74 A;  5F1Q A;  3BBR A;  4FOR A;  4YMA A;  3WAF A;  4MLV A;  2DXY A;  3RPL B;  4ZEB A;  4Q8R A;  3IB1 A;  1PB8 A;  3RY3 A;  1NNF A;  1B40 A;  3C31 A;  2XX7 A;  2XXR A;  1G0H A;  1URS A;  4PE3 A;  2B3F A;  4H8J A;  4OTE A;  1Y1M A;  4BDR A;  5I2N B;  3BFT A;  1TXF A;  2XXP A;  3U94 A;  2VPO A;  5ICQ A;  1NV4 A;  1NV7 A;  3OEL A;  1AH5 A;  3F11 A;  3FUZ A;  2PMS A;  3QUJ A;  4DI3 D;  2F97 A;  4P8B A;  4YU0 A;  4MLQ A;  3KEI A;  1NH8 A;  2QJE A;  3MST A;  4F39 A;  4G77 A;  2KR0 A;  3LSF B;  2F8D A;  3UGW A;  1FCK A;  4FJP A;  4O3A A;  1TFA A;  1P1O A;  3VXB A;  4ZEK A;  1WDN A;  4QSE A;  1P99 A;  1FPL A;  4E0W A;  1FQE A;  4HE1 A;  3T93 B;  4OZ9 A;  3KSX A;  5FHN A;  2UYE A;  2H4I A;  3C34 A;  1B4H A;  3Q26 A;  2V4C A;  4FIM A;  3HHF A;  4GX4 A;  4TQU Q;  3FD3 A;  4DLO A;  4EQ7 A;  3MWB A;  1INP A;  1N84 A;  4R2B A;  3TTN A;  1NUX A;  4QBA A;  4P0I A;  4RXL A;  1N7X A;  3VE1 B;  4NF5 B;  3CI8 A;  3KN8 A;  3C5T A;  1QUI A;  1JW5 A;  1YYZ A;  3ONM A;  4FEB A;  4U21 A;  5H8N B;  3S9L C;  3TCG A;  4ZE9 A;  3N7S A;  1FPD A;  1LGB C;  4DLD A;  1SDX A;  1SD3 A;  4BDN A;  2F7A A;  1MXV A;  4AS4 A;  3U92 A;  4F1V A;  1P1Q A;  1YXI A;  3LSW A;  4LAT A;  3M3K A;  1MQJ A;  3IO4 A;  2P3N A;  3CFZ A;  1B7H A;  4HS7 A;  4F3B A;  2PCR A;  2PX1 A;  1ZBM A;  2Y84 A;  4F1U A;  3K1M A;  4DE8 A;  1A55 A;  2X7Q A;  4HCW A;  1Y4T A;  2HAV A;  4DIG A;  2P1S A;  3FV1 A;  1BKA A;  3IOW A;  3CHG A;  2PT1 A;  2REJ A;  3KC0 A;  1RYO A;  3B6T A;  1IXG A;  4IO5 A;  1MY3 A;  2FBP A;  2GRV A;  4E0X A;  5EHM A;  4MBP A;  2GFE A;  3I5O A;  1B3L A;  1QUL A;  4EDP A;  4PDD A;  4XKP A;  2MKZ A;  4MMP A;  2Y7K A;  1B32 A;  4KD5 A;  1FPI A;  4ISU A;  1FQD A;  1TT1 A;  3H6V A;  4AS5 A;  3IFA A;  2VD2 A;  4ZS9 A;  1B3F A;  3C36 A;  1GR2 A;  3G3H A;  2QS1 A;  3KBR A;  4XKR A;  5ET7 A;  4MNI A;  1LBZ A;  1VDW A;  5IZ1 A;  4X04 A;  4GBW A;  3HCQ A;  3FJG A;  3IOV A;  4H5G A;  2CMO A;  3L6H A;  4G68 A;  4NX1 A;  2O68 A;  1IZ1 A;  1IIW A;  1BTJ A;  3U65 A;  4F2O A;  1VE4 A;  5TPA A;  1JW4 A;  3K0V A;  1UQW A;  4DXU A;  4NF4 A;  4LUB A;  5CBR A;  4G8N A;  4YAH X;  1SYH A;  1OVB A;  3SZP A;  2QKH A;  2I0B A;  1M5B A;  2VD3 A;  2XXV A;  2RKM A;  1N76 A;  1NUZ A;  1FBC A;  2OWT A;  1NH7 A;  2ZMB A;  1GV8 A;  3QIM A;  4KFQ A;  3BIH A;  1SW1 A;  1LBX A;  1MH4 A;  2R71 A;  2FIX A;  3OMB A;  1Y20 A;  4I3Y A;  1MS7 A;  2P0S A;  2I3W A;  1H45 A;  5CC2 A;  1R9Q A;  2L5V A;  1NKX A;  4H0W A;  1FSA A;  2O7I A;  3T1B A;  3CG3 A;  1FBE A;  4F18 A;  2AL5 A;  1ZU0 A;  4YZZ A;  2VP1 A;  3QSL A;  4LA9 A;  1FPE A;  1XOC A;  4R9F A;  4N6P A;  4ZEI A;  2PBW A;  2OLB A;  1S9T A;  2PYY A;  3P7I A;  5EQA A;  2R8T A;  3W9V A;  3SEU A;  1QKB A;  1URD A;  4PET A;  1L5T A;  4NWC A;  4YKP A;  2XXI A;  3GBB A;  4YKJ A;  3JYR A;  3PD8 A;  1NMU A;  1K9Z A;  4KYS A;  1IXC A;  5AE4 A;  1QJM A;  4KYD A;  4G68 B;  1OMP A;  1NV1 A;  3UN6 A;  1FPK A;  5I3S A;  2WYK A;  5L8D A;  4TLM B;  5TPA B;  1PBQ A;  3ILT B;  4HE2 A;  3IX1 A;  4NF4 B;  2DE3 A;  1I6B A;  3L6G A;  1DPE A;  3K4U A;  1PB7 A;  1NV2 A;  5BWJ A;  2QVV A;  1UTH A;  5DT6 A;  1NL5 A;  1USY H;  4N81 A;  2OX3 A;  3HST A;  4OVJ A;  3FVK A;  3AQF B;  3HV1 A;  3K02 A;  3N7R A;  2CZI A;  1EH3 A;  4ZE8 A;  3SDF A;  4HW8 A;  3PPP A;  4K3F A;  4OWD A;  4JDF A;  4N8Y A;  4C1T A;  2B3B A;  2OWS A;  3H06 B;  4HXV A;  3OSR A;  2DDK A;  1TWY A;  3B50 A;  4Q0C A;  3SET A;  3D4C A;  3E9X A;  3CR9 A;  3OO8 A;  4TOZ A;  1FJ6 A;  4P47 A;  4JWY A;  1ZIU A;  4N07 A;  4QXD A;  1OIB A;  4GX6 A;  1ZKB A;  3W9W A;  3RNN A;  4XF5 A;  2B4M A;  5JTY A;  4I8C A;  4OFL A;  3DEL B;  3TOD A;  4WXJ A;  1MH3 A;  2CZK A;  2LAO A;  1QUK A;  1EYJ A;  2F35 A;  3MJN A;  3V89 B;  2DOJ A;  4R6Y A;  2REG A;  2H5Y A;  1B7U A;  4FE8 A;  4H8I A;  1LBB A;  3OO9 A;  4R75 A;  1Q35 A;  4XKQ A;  4JWX A;  3FIR A;  5LOM A;  5EQ9 A;  5T3J A;  3FAS A;  4QFK A;  4EQB A;  2ZNU A;  1EYK A;  4YMB A;  2QL3 A;  1F9B A;  2Y5K A;  1DTG A;  3BIG A;  5ESY A;  3T9H B;  1N3W A;  5IGA A;  4OVT A;  1FBG A;  5B7D A;  4PBH A;  1I6Q A;  3QYT A;  1OLC A;  2X7P A;  1LAF E;  2QMW A;  4GL8 A;  2THI A;  1A7L A;  3PV0 E;  4U4S A;  4QSC A;  3S9E A;  4MJO A;  1FQC A;  5AA3 A;  1UTH B;  2OJT A;  3Q25 A;  4EXL A;  3VDF A;  4QRZ A;  3MBP A;  4MFI A;  5CMK A;  4IO6 A;  1NNK A;  2AYS A;  1EU8 A;  4O3C A;  2I4B A;  4DZ1 A;  2Q8J A;  1FW0 A;  2ZNS A;  3EPE A;  5I59 A;  4P3L A;  2DE4 A;  1MXX A;  1OQG A;  4LON B;  1M5E A;  1M5D A;  4RPO A;  4OVP A;  3PD9 A;  3KFM A;  4G8H A;  4R74 A;  2Q2A A;  3B7D A;  1IMF A;  3UP9 A;  5KZT A;  1CE2 A;  2ESN A;  3A09 A;  4QFL A;  4OEN A;  3TDJ A;  5JTY B;  3MP8 A;  5J1D A;  2DWH A;  1R1N A;  2IA4 A;  3OXN A;  1B51 A;  4LN5 A;  1TFD A;  1WOD A;  4GVO A;  3V5A A;  4NF8 A;  1FTM A;  5EYH A;  5I84 A;  3LBS A;  2Y7R A;  3PUW E;  3OO7 A;  1FPB A;  4UAB A;  3PGF A;  1LCF A;  1MY4 A;  2ZNT A;  3S4U A;  3G3K A;  1B3E A;  3KN3 A;  2AL4 A;  5II0 A;  4F3S A;  2O7U A;  4ZZE A;  1D4N A;  1SI1 A;  4GX3 A;  5ITO A;  4ZEC A;  1LAH E;  1A8E A;  1NV6 A;  2Q88 A;  3CG1 A;  4GF8 A;  4F31 B;  1SI0 A;  2ABH A;  2V3U A;  3KJT A;  4MCO A;  3LR1 A;  4OA4 A;  1NNT A;  2F3B A;  3A3C A;  2D5W A;  3IAZ A;  1HSJ A;  2B65 A;  4RYA A;  1QUJ A;  3MP6 A;  3MVW A;  4F22 A;  4U1Z A;  1AOV A;  3W15 C;  2L27 A;  5L9M A;  1BLF A;  2VHA A;  1D3K A;  2JJK A;  1B9J A;  4WKM A;  2F3D A;  3K6U A;  3R26 A;  1Y1Z A;  1B6H A;  5I59 B;  2FHY A;  3RTF B;  4M4G A;  5ITP A;  4AQ4 A;  3SKP A;  4LF3 C;  4PGN A;  1CB6 A;  1JQF A;  2A5T A;  2RC8 A;  1SW4 A;  3Q28 A;  1Y3N A;  1DK4 A;  3JV9 A;  4RY1 A;  1DMB A;  4PBQ A;  1FPF A;  4NE4 A;  1IIT A;  4JWO A;  4KQP A;  5FHO A;  1VR5 A;  1KA0 A;  3EKI A;  3TFL A;  5L9S A;  3MVX A;  4G2Z A;  1M5F A;  1ANF A;  1GVC A;  2CEX A;  1EYI A;  2QS2 A;  3LUY A;  4U23 A;  3IFC A;  5I56 A;  5ISU A;  2ONR A;  3LC8 A;  4NF8 B;  4F3P A;  5CMM A;  4PF8 A;  1M5C A;  2XXT A;  4GXS B;  1B46 A;  1RYX A;  2WBB A;  2R9J A;  3RGY A;  4X8R A;  4X1B A;  3HN0 A;  1O7T A;  2DVC A;  1AL3 A;  4C1U A;  5FTI A;  4X48 A;  4MX6 A;  4HCY A;  4N13 A;  2V93 A;  1IMB A;  4JVI A;  3C33 A;  4GWX A;  5AA2 D;  4F1Y A;  2V3T A;  4OAN A;  4F29 A;  3RT6 B;  3OD7 A;  2VOZ A;  3MZ9 A;  4I9D A;  4POX A;  1MXZ A;  3KC1 A;  4N8G A;  2Z23 A;  1HSE A;  3M3L A;  2UVG A;  1A54 A;  3DM0 A;  1IXH A;  3FBP A;  1YPN A;  2XDG A;  3G3G A;  2OBG A;  4PFB A;  4N17 A;  2E0S A;  1OLA A;  3FVO A;  5AA1 A;  4YIC A;  5DYH A;  2ZYK A;  1B0L A;  4LQ5 A;  4NG7 A;  4ND9 A;  2Q89 A;  4F3G A;  3UA8 A;  4I3E A;  4OQO A;  4P0G A;  3MQ9 A;  3GZG A;  4O7I A;  2GQ1 A;  3QK6 A;  4FED A;  1EZO A;  4FEC A;  4BDO A;  3KOT A;  1KWH A;  3TTL A;  4XEQ A;  1R9L A;  2NOO A;  4PFW A;  3U1O A;  2JNC A;  3MW0 A;  4GL0 A;  1RDZ A;  5F24 A;  1H3D A;  3CSB A;  4U2R A;  2A5T B;  4XXU A;  1LCT A;  4PQJ A;  3H03 A;  4GRK A;  2BJJ X;  2HAU A;  3IJX B;  2V25 A; 
#chains in the Genus database with same CATH homology
 3TCF A;  3TZA A;  2G29 A;  1FQA A;  1IQ7 A;  2ONS A;  1MDP 1;  1N7W A;  3IB2 A;  2DXR A;  3KGC A;  2XX8 A;  1JNF A;  3TPA A;  5I56 B;  1U34 A;  1B52 A;  3N26 A;  3PMV A;  5A5X A;  4YB6 A;  1WVJ A;  2H25 A;  1MDQ A;  2Q9T A;  4OYV A;  1SBP A;  2O51 A;  4BDL A;  2QS4 A;  3C4M A;  3IB0 A;  4DXB A;  1LFI A;  4O3B A;  4AB6 A;  3EHS A;  2RC7 A;  2XXU A;  1JEU A;  3IR1 A;  4AB5 A;  2Y7I A;  4OES A;  3VVE A;  3EQ1 A;  4RPN A;  4EXK A;  3KZG A;  3H3G A;  1IEJ A;  1EZP A;  4PFU A;  4IB2 A;  5H8H A;  1ZLQ A;  1URG A;  4RK9 A;  3MC2 A;  5TU0 A;  1MY1 A;  4GOT A;  2Q2C A;  1EZ9 A;  5BUU A;  1FTK A;  3RQT A;  1UIV A;  3GXA A;  1DSN A;  3THI A;  3H4Z A;  5HPQ A;  1US4 A;  4JBZ A;  3DP8 A;  3VVF A;  2DVZ A;  1OVT A;  4H5F A;  3PUX E;  5H8Q A;  1JW1 A;  3PPO A;  1Z7N E;  3LSX A;  4KCC A;  5B70 A;  1HSL A;  4GFR A;  5KCJ A;  2Y7W A;  4POW A;  4GD5 A;  3OO6 A;  1FTJ A;  3RN8 A;  2Z22 A;  5H8S A;  4IO3 A;  2V3Q A;  1SVX B;  1PBP A;  5L9O A;  4Q5T A;  4OFJ A;  3N94 A;  1MQG A;  5TP9 A;  3HPI A;  1QW0 A;  2F5X A;  5I58 A;  3C9H A;  1ZTY A;  5ELV A;  4ZGM A;  1S50 A;  1XS5 A;  3K1N A;  3UK4 A;  5A5X B;  4Z7E A;  2E1S A;  3MP1 A;  2I58 A;  2DQV A;  2KLF A;  4LVQ A;  3S9N C;  3O2A A;  3EHT A;  3H7M A;  3UOR A;  2XHD A;  2I49 A;  1SYI A;  3K1P A;  3CVG A;  1BP5 A;  4Z0I A;  3KG2 A;  2FYI A;  4X9T A;  3U93 A;  2H9B A;  2F36 A;  3PUZ E;  3ZKL A;  3FXR A;  4PE5 B;  5HBC A;  5DVJ A;  4OXV A;  3PMX A;  1XVY A;  1Q1K A;  3K6V A;  3I6V A;  3V83 A;  4H67 A;  3U8Q A;  5H8H B;  1NFT A;  3FAT A;  4ELR A;  1B4Z A;  4G4P A;  3FXU A;  2HCA A;  1ZJL A;  2D21 A;  2OK2 A;  1MXY A;  3SES A;  4ERS A;  5DVI A;  1LB9 A;  2O84 X;  5K2X A;  3S9M C;  1MM7 A;  5H8Q B;  3DP6 A;  4R72 A;  3TTK A;  1MG1 A;  2VGQ A;  3N5L A;  1UTB B;  3FV2 A;  2ZYM A;  2XXY A;  4OHN A;  2QRY A;  2HZL A;  3O97 A;  5KCJ B;  1N3X A;  5CI5 A;  2FNC A;  1N0T A;  4GLI A;  1USY E;  4QFP A;  2HFB A;  2XD2 A;  4OEU A;  1B58 A;  2JND A;  1Y3P A;  3MUQ A;  1MRP A;  3EF7 A;  5TP9 B;  3CIJ A;  3C32 A;  4H1X A;  4BDM A;  1GGG A;  4ZED A;  4EF1 A;  5I58 B;  2ZYN A;  4WED A;  3G7W A;  3IOR A;  4ELO A;  4XIG Q;  4R9G A;  3G3J A;  3VLW A;  5FHM A;  4HTG A;  4ONY A;  3G3I A;  4IY5 A;  1Y4C A;  3FZV A;  2DSF A;  5CRY A;  2QS3 A;  1SW5 A;  3K6W A;  1DPP A;  3PU5 A;  4Q30 B;  1Y3Q A;  1B0H A;  1A40 A;  3PMW A;  3TMG A;  5FTH A;  1A99 A;  4JB7 A;  3B6W A;  1Y9U A;  2DE2 A;  3O6I A;  1MPC A;  1US5 A;  5AA2 A;  2I48 A;  1LLS A;  4IO2 A;  1XC1 A;  3HO7 A;  4MH5 A;  2UVI A;  2QMX A;  2UYF A;  4LZ7 A;  2XX9 A;  2RF1 A;  1B05 A;  4HJ0 A;  1B5I A;  3GLB A;  1D9V A;  4RNS A;  4U22 A;  3U72 A;  1SQY A;  3EN3 A;  4DXC A;  4RJZ A;  3MPL A;  2F6G A;  3M3F A;  2HXW A;  4DDD A;  2I0C A;  1RKM A;  4JSO A;  1IUD A;  2NXO A;  3PPN A;  3VXC A;  4BLA A;  1B7Z A;  2YLN A;  3ILU B;  3PPQ A;  3B6Q A;  3MVZ A;  3TKD A;  4U1O A;  3CSG A;  2P2A A;  3D4G A;  2DS9 A;  2O69 A;  3FJM A;  4ESW A;  1XHY A;  3SEX A;  1POY 1;  2UXA A;  4UA8 A;  4YKI A;  4THI A;  2ALU A;  4DLQ A;  3T9V A;  3H6T A;  1MXW A;  3HHG A;  4IY6 A;  3O6G A;  4R73 A;  3IK6 B;  2XD3 A;  1GTK A;  4WEP A;  3M8U A;  3O6H A;  3IOT A;  4G68 C;  3TAJ A;  2HQ0 A;  3IOL A;  5EHS A;  1MQI A;  5AA2 B;  2GHB A;  3OEM A;  3IOU A;  1OQH A;  4PFT A;  2DP8 A;  2R6G E;  4KHZ E;  3DP4 A;  3BFU A;  1ELJ A;  4YB5 A;  4KI0 E;  4DCX A;  1LFH A;  3FJ7 A;  2G93 A;  1Z7M E;  5CMC A;  1P1U A;  4GQO A;  3TTR A;  4KR5 A;  3E4R A;  3TCH A;  2ZYO A;  3L2J A;  4OFO A;  1LAX A;  3T9X B;  3KN7 A;  3TQW A;  4OET A;  4LZ5 A;  2XXX A;  2NVU B;  3T66 A;  3PPR A;  4NF6 A;  2UVJ A;  2NUV A;  2M8C A;  2NWJ A;  4NTL A;  3RTW B;  3ZSF A;  3CRB A;  1POT A;  3ZS6 A;  1AMF A;  2H98 A;  4R2F A;  4EF2 A;  4F2Q A;  2DYX A;  1IXI A;  1XVX A;  1H44 A;  3TQL A;  3SEW A;  3K01 A;  1T0K A;  1QKA A;  3MZB A;  4U4X A;  4LQ2 A;  5CM6 A;  1MY2 A;  4FAJ A;  4YKK A;  3FVN A;  1JEV A;  3AXF A;  3VLU A;  1MPD A;  3T96 B;  2OCU A;  1P1N A;  3I3V A;  3SER A;  1JVX A;  3OEK A;  5H8F A;  5DEX A;  2RIN A;  3K6X A;  2QSX A;  4ZDM A;  1NNP A;  3K2D A;  1VFE A;  5CMB A;  5IKB A;  3SEV A;  1B1H A;  4RK2 A;  4LP2 B;  4I1D A;  1B1X A;  3VLV A;  3FVG A;  4IGR A;  4RA1 A;  1LAG E;  4ZZA A;  2I6E A;  5F7V A;  2X26 A;  3TTM A;  4IGT A;  3RT8 A;  5M2V A;  2A5S A;  4XKN A;  3PUY E;  5EYF A;  2PT2 A;  4MF3 A;  2CZL A;  3KOS A;  2RCB A;  3TEL A;  1YCJ A;  2H99 A;  3JZJ A;  3T9U A;  2V84 A;  4NWD A;  2YJP A;  3O66 A;  4NF6 B;  4H65 A;  5K2Y A;  4DCY A;  1A8F A;  5KDT A;  3S2V A;  4OEV A;  1R6Z A;  2YPN A;  1LST A;  3TEP A;  1JVY A;  2DWJ A;  4PP0 A;  1LB8 A;  1VSO A;  2WKY A;  2AIX A;  1FTL A;  2D3I A;  4GIZ A;  4KCD A;  1UTB A;  2GHA A;  2W7Y A;  4PFY A;  3C59 A;  2Z8D A;  4TLL B;  1BIY A;  1XT8 A;  2O6A A;  3GBA A;  2RC9 A;  2Z8E A;  4R6H A;  3TUS A;  2XXQ A;  3H6U A;  3TYH A;  3R7X A;  2DWI A;  5H8F B;  1II5 A;  1LBC A;  5DEX B;  2F34 A;  3ECR A;  5I57 A;  1JET A;  2I3V A;  4LZ8 A;  5I2K A;  3RLF E;  1YTV A;  3K00 A;  2ZXT A;  1MPB A;  2ONK E;  2QPQ A;  1O64 A;  3N6U A;  5AA4 A;  1I6A A;  3IO6 A;  4OER A;  4QHQ A;  4NED A;  4C0R A;  1D9Y A;  2O1L A;  3IJO B;  4X1D A;  1FQF A;  1PEB A;  1PC3 A;  4JSD A;  3ODB A;  4EUO A;  1N04 A;  3VVD A;  2XXW A;  3EHU A;  4I62 A;  3E3K A;  2F6P A;  1QVS A;  4BDQ A;  3RUM A;  4KYE A;  3G3F A;  3H6W A;  4QFN A;  3UIF A;  2HEU A;  3MAM A;  2OZZ A;  3O28 A;  5KDT B;  1YAE A;  4GWO A;  1MXU A;  4ELQ A;  3Q29 A;  1B2H A;  5DVF A;  3OSQ A;  1B3H A;  1P1W A;  1AIV A;  4M1V A;  4G8M A;  2F7C A;  3N7P A;  3ZKK A;  3QXM A;  3O9P A;  4YB7 A;  5JEI A;  4ELP A;  2ANJ A;  2RCA A;  1MM6 A;  5ICT A;  1B5H A;  2DWA A;  4FAT A;  4H6D A;  1MY0 A;  1SW2 A;  3V8X B;  2HZK A;  2Z8F A;  2PVU A;  3KJ7 A;  3Q27 A;  4L17 A;  1B3G A;  1I69 A;  4IO4 A;  5IAI A;  5I57 B;  3R6U A;  2F7B A;  5I2K B;  1VFD A;  2XXH A;  4R6K A;  1UIU A;  1O63 A;  2GH9 A;  3MZ1 A;  5JK4 A;  3N6T A;  4NMY A;  5AA4 B;  3VFJ A;  2JOD A;  4QSD A;  2F78 A;  1LFG A;  5I2N A;  1PDA A;  1ZMG A;  4XTC Q;  1MQH A;  4KPT A;  4JXI A;  3QAX A;  1B5J A;  3SEY A;  1FTO A;  5CBS A;  4OMB A;  1ATG A;  3WAE A;  2O1M A;  4F19 A;  3E13 X;  2UVH A;  4ZEF A;  3IL1 B;  3CFL A;  3RPW A;  1PB9 A;  4ESX A;  3LSL A;  3BKI B;  4EQ9 A;  3USD A;  1DTZ A;  1S7Y A;  3MPK A;  3OOA A;  1FQB A;  4UAC A;  3KSJ A;  3O29 A;  4GXA A;  3OEN A;  1J1N A;  3C35 A;  5DTB A;  1MQD A;  4ECF A;  3FXQ A;  4IO7 A;  1H76 A;  3DLN A;  3FGS A;  3VV5 A;  2FA7 A;  1DOT A;  3CFX A;  2IEE A;  3T22 A;  4QFO A;  3QUF A;  1H43 A;  4P11 A;  2I4C A;  4QF9 A;  4NF5 A;  5HM4 B;  2Y7P A;  3A3U A;  3MVY A;  3PUV E;  5H8N A;  5F1Q A;  3BBR A;  4FOR A;  4YMA A;  3WAF A;  4MLV A;  2DXY A;  4ZEB A;  4Q8R A;  3IB1 A;  1PB8 A;  3RY3 A;  1NNF A;  1B40 A;  3C31 A;  2XX7 A;  2XXR A;  1URS A;  2B3F A;  4H8J A;  4OTE A;  1Y1M A;  4BDR A;  5I2N B;  3BFT A;  1TXF A;  2XXP A;  3U94 A;  5ICQ A;  3OEL A;  1AH5 A;  3F11 A;  3FUZ A;  2PMS A;  3QUJ A;  2F97 A;  4YU0 A;  4MLQ A;  3KEI A;  1NH8 A;  2QJE A;  4F39 A;  4G77 A;  3LSF B;  2F8D A;  3UGW A;  1FCK A;  4FJP A;  4O3A A;  1TFA A;  1P1O A;  3VXB A;  4ZEK A;  1WDN A;  4QSE A;  1P99 A;  4E0W A;  1FQE A;  3T93 B;  4OZ9 A;  3KSX A;  5FHN A;  2UYE A;  2H4I A;  3C34 A;  1B4H A;  3Q26 A;  4FIM A;  3HHF A;  4TQU Q;  3FD3 A;  4DLO A;  4EQ7 A;  3MWB A;  1N84 A;  4R2B A;  3TTN A;  4P0I A;  4RXL A;  1N7X A;  3VE1 B;  4NF5 B;  3CI8 A;  3KN8 A;  3C5T A;  1QUI A;  1JW5 A;  3ONM A;  4FEB A;  4U21 A;  5H8N B;  3S9L C;  3TCG A;  4ZE9 A;  3N7S A;  1LGB C;  4DLD A;  1SDX A;  1SD3 A;  4BDN A;  2F7A A;  1MXV A;  3U92 A;  4F1V A;  1P1Q A;  3LSW A;  4LAT A;  3M3K A;  1MQJ A;  3IO4 A;  3CFZ A;  1B7H A;  4HS7 A;  4F3B A;  2PX1 A;  1ZBM A;  2Y84 A;  4F1U A;  3K1M A;  4DE8 A;  1A55 A;  2X7Q A;  4HCW A;  1Y4T A;  2HAV A;  4DIG A;  2P1S A;  3FV1 A;  1BKA A;  3IOW A;  2PT1 A;  2REJ A;  1RYO A;  3B6T A;  1IXG A;  4IO5 A;  1MY3 A;  2GRV A;  4E0X A;  5EHM A;  4MBP A;  2GFE A;  3I5O A;  1B3L A;  1QUL A;  4EDP A;  4XKP A;  2Y7K A;  1B32 A;  4KD5 A;  4ISU A;  1FQD A;  1TT1 A;  3H6V A;  2VD2 A;  4ZS9 A;  1B3F A;  3C36 A;  1GR2 A;  3G3H A;  2QS1 A;  3KBR A;  4XKR A;  3HCQ A;  3FJG A;  3IOV A;  4H5G A;  2CMO A;  3L6H A;  4G68 A;  2O68 A;  1IZ1 A;  1IIW A;  1BTJ A;  4F2O A;  1VE4 A;  5TPA A;  1JW4 A;  3K0V A;  1UQW A;  4DXU A;  4NF4 A;  4LUB A;  5CBR A;  4G8N A;  4YAH X;  1SYH A;  1OVB A;  2QKH A;  2I0B A;  1M5B A;  2VD3 A;  2XXV A;  2RKM A;  1N76 A;  2OWT A;  1NH7 A;  2ZMB A;  1GV8 A;  3QIM A;  4KFQ A;  1SW1 A;  1MH4 A;  2R71 A;  3OMB A;  1Y20 A;  1MS7 A;  2P0S A;  2I3W A;  1H45 A;  5CC2 A;  1R9Q A;  1NKX A;  4H0W A;  2O7I A;  3CG3 A;  4F18 A;  2AL5 A;  1ZU0 A;  4YZZ A;  2VP1 A;  3QSL A;  4LA9 A;  4R9F A;  1XOC A;  4N6P A;  4ZEI A;  2PBW A;  2OLB A;  1S9T A;  2PYY A;  3P7I A;  3W9V A;  3SEU A;  1QKB A;  1URD A;  4PET A;  1L5T A;  4YKP A;  4NWC A;  2XXI A;  3GBB A;  4YKJ A;  3JYR A;  3PD8 A;  1NMU A;  4KYS A;  1IXC A;  5AE4 A;  1QJM A;  4KYD A;  4G68 B;  1OMP A;  3UN6 A;  5L8D A;  4TLM B;  5TPA B;  1PBQ A;  3ILT B;  3IX1 A;  4NF4 B;  2DE3 A;  1I6B A;  3L6G A;  1DPE A;  3K4U A;  1PB7 A;  5BWJ A;  1UTH A;  5DT6 A;  1NL5 A;  1USY H;  3HST A;  4OVJ A;  3FVK A;  3AQF B;  3HV1 A;  3K02 A;  3N7R A;  1EH3 A;  4ZE8 A;  3SDF A;  4HW8 A;  3PPP A;  4K3F A;  4OWD A;  4JDF A;  4C1T A;  2B3B A;  2OWS A;  3H06 B;  3OSR A;  1TWY A;  3SET A;  4Q0C A;  3D4C A;  3E9X A;  3CR9 A;  3OO8 A;  4TOZ A;  4JWY A;  1ZIU A;  4N07 A;  1OIB A;  1ZKB A;  3W9W A;  3RNN A;  5JTY A;  4I8C A;  4OFL A;  3DEL B;  3TOD A;  4WXJ A;  1MH3 A;  2LAO A;  1QUK A;  2F35 A;  3MJN A;  3V89 B;  2DOJ A;  4R6Y A;  2REG A;  2H5Y A;  1B7U A;  4FE8 A;  4H8I A;  1LBB A;  3OO9 A;  4R75 A;  1Q35 A;  4XKQ A;  4JWX A;  3FIR A;  5LOM A;  3FAS A;  4QFK A;  4EQB A;  2ZNU A;  4YMB A;  2QL3 A;  1F9B A;  1DTG A;  3T9H B;  1N3W A;  5B7D A;  1I6Q A;  3QYT A;  1OLC A;  2X7P A;  1LAF E;  2QMW A;  4GL8 A;  2THI A;  1A7L A;  3PV0 E;  4U4S A;  4QSC A;  3S9E A;  1FQC A;  5AA3 A;  1UTH B;  2OJT A;  3Q25 A;  4EXL A;  3VDF A;  4QRZ A;  3MBP A;  4MFI A;  5CMK A;  4IO6 A;  1NNK A;  2AYS A;  1EU8 A;  4O3C A;  2I4B A;  4DZ1 A;  2Q8J A;  1FW0 A;  2ZNS A;  3EPE A;  5I59 A;  2DE4 A;  1MXX A;  1OQG A;  4LON B;  1M5E A;  1M5D A;  4RPO A;  3PD9 A;  3KFM A;  4G8H A;  4R74 A;  2Q2A A;  3B7D A;  3UP9 A;  5KZT A;  1CE2 A;  2ESN A;  3A09 A;  4QFL A;  4OEN A;  3TDJ A;  5JTY B;  3MP8 A;  5J1D A;  2DWH A;  1R1N A;  2IA4 A;  3OXN A;  1B51 A;  1TFD A;  1WOD A;  4GVO A;  3V5A A;  4NF8 A;  1FTM A;  5I84 A;  3LBS A;  2Y7R A;  3PUW E;  3OO7 A;  3PGF A;  1LCF A;  1MY4 A;  2ZNT A;  3S4U A;  3G3K A;  1B3E A;  3KN3 A;  2AL4 A;  5II0 A;  4F3S A;  2O7U A;  4ZZE A;  1D4N A;  1SI1 A;  5ITO A;  4ZEC A;  1LAH E;  1A8E A;  2Q88 A;  3CG1 A;  4GF8 A;  4F31 B;  1SI0 A;  2ABH A;  2V3U A;  3KJT A;  3LR1 A;  1NNT A;  3A3C A;  2D5W A;  3IAZ A;  1HSJ A;  2B65 A;  4RYA A;  1QUJ A;  3MP6 A;  3MVW A;  4F22 A;  4U1Z A;  1AOV A;  3W15 C;  2L27 A;  5L9M A;  1BLF A;  2VHA A;  1D3K A;  1B9J A;  4WKM A;  3K6U A;  3R26 A;  1Y1Z A;  1B6H A;  5I59 B;  3RTF B;  4M4G A;  5ITP A;  4AQ4 A;  3SKP A;  4LF3 C;  1CB6 A;  1JQF A;  2A5T A;  2RC8 A;  1SW4 A;  3Q28 A;  1Y3N A;  3JV9 A;  4RY1 A;  1DMB A;  4NE4 A;  1IIT A;  4JWO A;  4KQP A;  5FHO A;  1VR5 A;  3TFL A;  5L9S A;  3MVX A;  4G2Z A;  1M5F A;  1ANF A;  1GVC A;  2QS2 A;  3LUY A;  4U23 A;  5I56 A;  5ISU A;  2ONR A;  3LC8 A;  4NF8 B;  4F3P A;  5CMM A;  1M5C A;  2XXT A;  4GXS B;  1B46 A;  1RYX A;  2R9J A;  3RGY A;  4X1B A;  3HN0 A;  1O7T A;  2DVC A;  1AL3 A;  4C1U A;  5FTI A;  4X48 A;  4HCY A;  4N13 A;  2V93 A;  5AA2 D;  3C33 A;  4F1Y A;  2V3T A;  4F29 A;  3RT6 B;  3OD7 A;  2VOZ A;  3MZ9 A;  4I9D A;  4POX A;  1MXZ A;  2Z23 A;  1HSE A;  3M3L A;  2UVG A;  1A54 A;  3DM0 A;  1IXH A;  1YPN A;  2XDG A;  3G3G A;  2OBG A;  2E0S A;  1OLA A;  3FVO A;  5AA1 A;  4YIC A;  5DYH A;  2ZYK A;  1B0L A;  4LQ5 A;  4ND9 A;  2Q89 A;  4F3G A;  3UA8 A;  4OQO A;  4P0G A;  3MQ9 A;  3GZG A;  3QK6 A;  4FED A;  1EZO A;  4FEC A;  4BDO A;  3KOT A;  1KWH A;  3TTL A;  1R9L A;  2NOO A;  4PFW A;  3U1O A;  2JNC A;  3MW0 A;  4GL0 A;  1H3D A;  3CSB A;  4U2R A;  2A5T B;  4XXU A;  1LCT A;  4PQJ A;  3H03 A;  4GRK A;  2BJJ X;  2HAU A;  3IJX B;  2V25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...