3EHTA

Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1) in complex with crf
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
452
structure length
452
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPETWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFSLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND MBP
publication title Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1.
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2008-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehtA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ehtA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3ehtA03
2FYIA 3FD3A 4QSEA 2I3WA 3GZGA 1LCTA 2X7PA 3SDFA 2VD2A 5K2YA 3K00A 4ZE9A 3V8XB 5KZTA 3G3JA 1B4HA 3OO7A 2UVJA 2F34A 1FQEA 4KHZE 4PQJA 3O6IA 4IB2A 3MP8A 3K4UA 4H65A 5CMKA 4LA9A 4Q5TA 2PMSA 2GH9A 4NF6B 4G8HA 1A55A 2YLNA 4IO3A 1US4A 2O7UA 5II0A 3PUVE 1O63A 5ITOA 3Q27A 1NNTA 2E1SA 1ELJA 2O7IA 1MS7A 2ALUA 2Y7PA 2VHAA 2DOJA 3O66A 4HJ0A 2R71A 4MFIA 4EDPA 1IXIA 1B58A 2QPQA 3KN8A 4YMBA 4UACA 3PPNA 1HSEA 3JV9A 3SEUA 3O97A 5FHNA 4YKIA 2FNCA 1URDA 3IOLA 2HFBA 4OFLA 2RCBA 4U23A 3C4MA 4F2OA 4IO2A 2DSFA 2ONSA 3K6VA 3EHUA 2RKMA 1Y1ZA 1BLFA 1B46A 4ND9A 3VXCA 1B3LA 3H3GA 3FIRA 3GBAA 5BUUA 3KZGA 1SDXA 1OVBA 2R9JA 1FQCA 1MY0A 1TXFA 4GVOA 4OVJA 4NF5B 4H8JA 3W9VA 2NXOA 3KN7A 4G2ZA 2Q88A 2A5SA 1ZBMA 3PUYE 3CVGA 2XXPA 5I57B 3FV1A 1MQJA 2CZLA 1LFHA 2OLBA 3S2VA 1EZPA 4ZGMA 2AL5A 5TP9B 1B3GA 1A7LA 4U2RA 1MY2A 3MBPA 3CSBA 5AE4A 2B3FA 1URSA 2HEUA 1TT1A 5EYFA 3S9LC 1EZOA 1Q1KA 4I8CA 2YPNA 1QUIA 4ZEIA 2QRYA 2I6EA 4WEPA 2RC8A 3MZ1A 4ZZEA 1A8EA 1ZJLA 1B1XA 3UGWA 3K02A 4OHNA 3RPWA 3PPQA 2PT2A 3GXAA 4F29A 5B70A 2YJPA 3IR1A 1B7UA 5FTIA 2DE2A 3N7RA 1KWHA 4DE8A 1QULA 4F3PA 4PP0A 2QJEA 5IAIA 3T93B 1LB9A 1P99A 3UK4A 3MZ9A 4X1BA 2ZNUA 3TODA 4F1UA 2DE4A 5F7VA 2ABHA 2O6AA 5ICTA 1EZ9A 3K1PA 1DTZA 2VGQA 4ZEBA 4NF4A 4Q8RA 3S9EA 4Z7EA 1FTKA 3HPIA 5I56A 1NNPA 4ZEKA 5CI5A 4G8NA 3IB0A 3T9VA 5H8QA 3KJTA 4GOTA 4R9FA 1XVYA 3T9XB 4ZEDA 3PPRA 4C0RA 4EF1A 4M1VA 3U8QA 2H9BA 4AB5A 4RK9A 4NTLA 1ZMGA 3EHSA 1OVTA 4F2QA 4FAJA 3UORA 1B7HA 2HAUA 3FXRA 4LQ5A 2QSXA 4R74A 3SESA 2ONRA 3TPAA 1RYXA 1GTKA 2D21A 2QMWA 2Z8DA 3E4RA 3H6VA 3QIMA 1MPCA 4XKPA 3CR9A 4EQ9A 2O1MA 4TLMB 2M8CA 4BDLA 2V3TA 5I59B 3OO8A 1LBBA 3RLFE 5H8FA 3DP6A 2RCAA 3KGCA 2XXHA 1OLCA 2F5XA 1XT8A 4M4GA 3C31A 3SEVA 4OTEA 1SW5A 3MP6A 2RINA 3M3LA 1TFAA 4JSOA 3CIJA 3D4GA 3EF7A 1JQFA 5I58A 1TFDA 3K0VA 4XIGQ 5IKBA 1JNFA 2GHAA 2Q89A 3P7IA 1MQDA 3KJ7A 2HCAA 4XKQA 3IK6B 1USYH 5ISUA 1LGBC 3H4ZA 4HCWA 3T66A 3RTWB 3LR1A 3H03A 3PUZE 3LSLA 4PFTA 2O51A 2XD3A 2UVGA 1HSJA 2I0BA 4THIA 4OESA 2UYEA 1MH3A 3USDA 1AH5A 4P0GA 2NUVA 1FQDA 2CMOA 4LZ5A 1D9YA 2QS2A 4H5GA 5AA2D 5A5XB 4F31B 1VFEA 1P1NA 5I2NA 2F6GA 3B7DA 1AMFA 2V3QA 4RK2A 1PB7A 3E9XA 1AIVA 5CBSA 3CFLA 3IX1A 1MXYA 2P0SA 3Q26A 4H67A 2OWSA 3IORA 3JZJA 4YU0A 3BKIB 1LAXA 3K1NA 1QW0A 3IOUA 3MW0A 1QVSA 1WDNA 1XC1A 4IGTA 1Y20A 4KCDA 3RY3A 3QSLA 1EH3A 1RKMA 4F18A 1DOTA 5AA4A 4QSCA 4LZ7A 3BBRA 2HQ0A 3AXFA 3Q28A 4G68A 4YB5A 1O7TA 1JEVA 4Q0CA 4R2BA 1U34A 3V89B 3EPEA 1H44A 1OMPA 2DXYA 3G3GA 1IXCA 3HHFA 3SEYA 3QXMA 5EHMA 1II5A 3AQFB 1R1NA 4LZ8A 1MXUA 3K6UA 1MH4A 3IOVA 3R26A 3SERA 2I49A 4ZZAA 3K2DA 3PD8A 3OELA 4G8MA 2XX9A 2R6GE 1MXXA 4N13A 4O3CA 4R72A 3ECRA 3MVYA 5I84A 3PMVA 4ELOA 2ONKE 1XS5A 4TOZA 5K2XA 3VVEA 4NE4A 1B0HA 1GV8A 4NF4B 3TELA 1IITA 2G29A 4RYAA 5LOMA 4PFUA 2DWAA 5H8QB 4HTGA 4GIZA 1Q35A 4ZS9A 1PC3A 3UP9A 2XXQA 1B32A 2PT1A 3PD9A 2QMXA 2REJA 2RC9A 3G3FA 1H3DA 3MWBA 4DXUA 3MPKA 1IEJA 4OETA 1JW5A 3LSXA 4FECA 1J1NA 2DQVA 3D4CA 1R9QA 2ZXTA 1RYOA 1H43A 1P1WA 4F1VA 3H6TA 2H4IA 4QF9A 4JSDA 3B6TA 1Y4TA 4XKRA 3G7WA 4EQBA 1MQGA 4R2FA 1BTJA 1N04A 2IA4A 3B6WA 5I2KA 1WVJA 1QUJA 1MXVA 1Y3QA 3QAXA 2ZNSA 1DPPA 2P2AA 1MRPA 3OXNA 3QUFA 3V5AA 1I6QA 3FASA 4OWDA 4KR5A 1NNFA 1FQBA 4MLQA 2ZMBA 4C1UA 5CRYA 4ESWA 4H1XA 1LSTA 4POWA 4LF3C 1SBPA 4FJPA 1S7YA 3KOSA 3TZAA 3N26A 1Y9UA 2W7YA 4C1TA 5I2NB 4GXSB 4KYEA 3FJGA 3FUZA 4BLAA 5AA2B 5H8NA 3TTRA 3O29A 3LBSA 5DVJA 1NMUA 2XXVA 2I0CA 1XOCA 2HAVA 3WAEA 3FVKA 4DCYA 3RN8A 5CMBA 1OLAA 5AA4B 1M5EA 3IJOB 4BDMA 1B0LA 1JETA 1POTA 4Q30B 3M8UA 3VVDA 4DLQA 1MDP1 2XXIA 1D4NA 3FXUA 1FTLA 3MUQA 4P11A 3U1OA 1N3WA 3TCGA 1MM7A 2OBGA 4OFJA 1FTJA 3O28A 2D3IA 1JW1A 3OSRA 4RA1A 1D9VA 2DVCA 1P1QA 4QSDA 2QKHA 3IO4A 3OENA 3OEMA 1PB9A 5JTYA 3RT8A 3TQLA 1N0TA 1POY1 4OYVA 1SVXB 4NWCA 2DXRA 2ZNTA 4JDFA 1Y3PA 3MVZA 3N7SA 3ZKKA 1UQWA 2DP8A 2Z22A 4QFOA 4JBZA 1AL3A 5AA1A 3VVFA 3IO6A 1TWYA 3TFLA 1IUDA 4BDOA 3MVXA 5TPAA 4GQOA 3RGYA 1UIVA 4NF8B 3THIA 1NKXA 3PPOA 1SW1A 4MF3A 1LAFE 3HN0A 4FEDA 1ZU0A 4KD5A 2DWJA 1SYHA 1QUKA 3T96B 1QKAA 3TUSA 2DWHA 4JWOA 2HZKA 4ZE8A 3TCHA 5DYHA 4EUOA 1B5IA 4QHQA 1US5A 1GVCA 3W15C 4OQOA 1H76A 1SW2A 4HS7A 1M5DA 3QYTA 1LAGE 4R6KA 1B2HA 5HPQA 3VLUA 4YKJA 1M5FA 5L9MA 1GR2A 4H5FA 4PETA 1L5TA 3C32A 2X26A 1T0KA 4LONB 4JB7A 3O6GA 3DLNA 2DS9A 2XHDA 2X7QA 4GXAA 3LC8A 4KPTA 3SETA 2H5YA 2ZYKA 4R9GA 4GRKA 2PX1A 1MQHA 4GD5A 1USYE 5CMMA 4KCCA 2O84X 3FJMA 1VSOA 1UTBA 2GFEA 5L9SA 5CC2A 4NF6A 1R9LA 3MC2A 1ZIUA 3WAFA 4YICA 3T22A 3H7MA 2ZYMA 3IL1B 2XX8A 3DP4A 4H0WA 3Q25A 3CRBA 2NOOA 1MXZA 3C36A 3TAJA 4QFNA 2F36A 4OEVA 3R7XA 2O68A 4DZ1A 3OSQA 3RT6B 3DELB 2GHBA 1EU8A 1JVXA 5KCJA 3ODBA 2HXWA 2RC7A 3GBBA 3B6QA 4U1OA 4WXJA 4GL0A 3PV0E 4F19A 1N76A 1I6AA 2I4CA 2QS3A 4G68C 1UTHA 4FEBA 1IXGA 1S50A 5H8NB 2I4BA 1B40A 1Y3NA 1BP5A 2B65A 3TYHA 1DMBA 1Y1MA 1ANFA 1N7WA 3FXQA 1DSNA 2H99A 3IJXB 3TDJA 4IY5A 2L27A 2V84A 1N3XA 5ICQA 1SI1A 1A99A 1FQAA 4RJZA 4H8IA 3C59A 1MPBA 2F7BA 2Y84A 2QS1A 2UVHA 2F35A 3IB1A 4LP2B 5I57A 4KFQA 4BDQA 2FA7A 2Q2AA 1WODA 3C5TA 4XXUA 1ATGA 3KSXA 2JNDA 2P1SA 1B6HA 2OK2A 2DVZA 1VFDA 2F6PA 1I6BA 5JTYB 4H6DA 1UIUA 4O3BA 2THIA 2F8DA 1B52A 4I62A 4ELRA 5L9OA 4N6PA 3TCFA 2GRVA 2Y7KA 1LFIA 1CE2A 4OEUA 3U92A 3OD7A 3O6HA 3ONMA 4NEDA 2AIXA 1A54A 3ZSFA 5CM6A 3FV2A 1XVXA 3MAMA 5TPAB 4N07A 1D3KA 3V83A 4F39A 5L8DA 5DEXA 1YCJA 2XX7A 4TLLB 4RPNA 3CFZA 5I56B 4E0XA 2XXRA 2V93A 1CB6A 1JEUA 1ZKBA 4ONYA 4O3AA 1SQYA 3KBRA 2Z23A 3N94A 3U93A 4UA8A 3PMXA 2F97A 3ZKLA 4AB6A 1I69A 3CFXA 4QFPA 3UN6A 3FATA 1MDQA 3DP8A 1LFGA 4U22A 4GF8A 1OQGA 3FVNA 3PU5A 5DT6A 5HM4B 3A09A 3QUJA 2I3VA 4DXCA 2ESNA 3VLVA 2Z8FA 2XD2A 3T9HB 5JEIA 3HSTA 5KDTA 3I5OA 4YB6A 4PFWA 1Z7NE 1B5HA 5H8FB 2WKYA 3TQWA 4RXLA 4ERSA 2UYFA 1YAEA 4PFYA 1F9BA 4R6YA 2Q8JA 3W9WA 4YMAA 3S9MC 2AYSA 1HSLA 5I59A 4DXBA 1A8FA 4IO5A 5I58B 1MG1A 1UTBB 4HCYA 4DLDA 1LAHE 1FQFA 4P0IA 3TEPA 1P1UA 4OZ9A 3I6VA 4POXA 3OEKA 3QK6A 4I9DA 4ELQA 4AQ4A 5ITPA 4EQ7A 3BFTA 1N7XA 2VOZA 4EF2A 3S9NC 3T9UA 4RY1A 5DTBA 2OJTA 4WKMA 2I58A 2XXWA 4F3BA 3F11A 5KCJB 4U1ZA 3MZBA 1B3HA 3M3FA 3U94A 2UVIA 4EXLA 4YKPA 4F3SA 4DIGA 1UTHB 3RQTA 3S4UA 4FIMA 3KOTA 1S9TA 3K1MA 4X1DA 1NH8A 4FORA 3A3CA 3TKDA 1PB8A 4LATA 1BKAA 5CBRA 3K01A 1QKBA 1MQIA 3SEXA 4KYDA 5A5XA 4ZDMA 2DWIA 4ESXA 3PGFA 1LLSA 3PPPA 3G3IA 2V3UA 4JWXA 1B7ZA 4G68B 1A40A 3EHTA 4F3GA 4LVQA 2H98A 3HHGA 2A5TA 3LSWA 1DPEA 5DVIA 2LAOA 4KYSA 3R6UA 3L6GA 2ZYOA 1FTMA 3E3KA 2JNCA 4OENA 3K6XA 3MP1A 2OZZA 1LBCA 2XDGA 3ILTB 5B7DA 4R75A 1NFTA 1LCFA 1JVYA 3SKPA 4DDDA 1BIYA 1VR5A 5FTHA 3KFMA 1MM6A 4F1YA 1SYIA 1PBQA 4X9TA 1IIWA 1YPNA 2D5WA 4YB7A 3N7PA 1Z7ME 3FGSA 3E13X 4MBPA 4QFLA 1OIBA 1FTOA 1B3FA 3IAZA 2O1LA 4OERA 4I1DA 3HO7A 3K6WA 3TTKA 4DLOA 2B3BA 5DEXB 3PUXE 4QRZA 5H8HA 4L17A 5ELVA 2I48A 4LQ2A 2ANJA 5BWJA 2KLFA 4MH5A 2V25A 4NMYA 3VXBA 1VE4A 5J1DA 4IO6A 3RNNA 4MLVA 1FCKA 1OQHA 4PE5B 2BJJX 3UIFA 3CI8A 2NWJA 2Q2CA 3KEIA 3IB2A 1MY4A 1H45A 4OMBA 4GLIA 5DVFA 3O2AA 3CG1A 4ISUA 1SW4A 2DE3A 3G3HA 2VD3A 1SD3A 3EQ1A 1IXHA 4KI0E 2G93A 1NL5A 5M2VA 5KDTB 2Y7WA 4NWDA 5AA3A 2XXUA 3ILUB 3FZVA 3KN3A 3C34A 4TQUQ 4KQPA 1JW4A 1B51A 1PBPA 1M5BA 4U4SA 1Y4CA 3MQ9A 4R6HA 1B4ZA 4ZEFA 2F78A 5I2KB 2UXAA 4OFOA 4ECFA 2F7CA 5FHMA 5JK4A 1ZLQA 3IOTA 3H6UA 4U4XA 1NH7A 5F1QA 3H6WA 4FATA 1FW0A 3M3KA 4IGRA 1MY1A 3TTMA 5FHOA 1GGGA 2PBWA 2QL3A 3VE1B 3LUYA 4JXIA 1URGA 1IZ1A 1PDAA 3CG3A 2QS4A 5TU0A 4F22A 3VV5A 4WEDA 4XTCQ 4RPOA 4EXKA 1B5JA 3A3UA 1PEBA 1M5CA 4ELPA 3VDFA 4IO4A 1IQ7A 3U72A 2DYXA 4G77A 4R73A 2REGA 4G4PA 4FE8A 2NVUB 2Q9TA 3BFUA 1NNKA 3JYRA 1B3EA 1DTGA 5HBCA 1MXWA 4E0WA 2VP1A 2PYYA 3LSFB 2OCUA 3FVOA 1O64A 4XKNA 1LB8A 3TTLA 4JWYA 5AA2A 4NF5A 2O69A 3N6UA 4K3FA 3KSJA 3MJNA 3PUWE 3L6HA 3H06B 4Z0IA 3G3KA 3N6TA 2A5TB 3VFJA 3DM0A 3HCQA 3KG2A 3CSGA 3OMBA 3I3VA 3TTNA 2PVUA 3C33A 3MPLA 3Q29A 2Y7RA 3TMGA 2E0SA 4RNSA 1B1HA 2Y7IA 3FVGA 3C9HA 1ZTYA 5TP9A 4IY6A 2XXTA 5CMCA 3MVWA 1R6ZA 3RUMA 4HW8A 3PMWA 2Z8EA 4X48A 3ZS6A 1XHYA 2ZYNA 4YAHX 1MY3A 1MPDA 1SI0A 1YTVA 2JODA 4GFRA 3OO6A 2XXXA 2HZLA 1B05A 2F7AA 3N5LA 3GLBA 3RTFB 2XXYA 4YKKA 3EN3A 3OO9A 3C35A 4BDNA 4IO7A 2IEEA 5H8HB 2RF1A 1B9JA 3IOWA 1P1OA 3HV1A 4NF8A 1AOVA 2H25A 4GWOA 3FJ7A 4QFKA 2AL4A 3O9PA 5EHSA 4DCXA 4LUBA 5H8SA 2OWTA 1QJMA 3OOAA 4YZZA 3L2JA 4OXVA 3SEWA 4BDRA 3UA8A 4ZECA 4U21A 3VLWA 4GL8A 1N84A
chains in the Genus database with same CATH superfamily
2FYIA 3FD3A 4QSEA 2I3WA 3GZGA 1LCTA 2X7PA 3SDFA 2VD2A 5K2YA 3K00A 4ZE9A 3V8XB 5KZTA 3G3JA 1B4HA 3OO7A 2UVJA 2F34A 1FQEA 1D9QA 2PFZA 4KHZE 4PQJA 3O6IA 4IB2A 3MP8A 3K4UA 4H65A 5CMKA 4LA9A 4Q5TA 2PMSA 2GH9A 4NF6B 4G8HA 1A55A 2YLNA 4IO3A 1US4A 2O7UA 5II0A 3PUVE 1O63A 5ITOA 3Q27A 1NNTA 2E1SA 1ELJA 2O7IA 1MS7A 2ALUA 2Y7PA 4PE3A 3RYDA 2VHAA 2DOJA 3O66A 4HJ0A 2R71A 4MFIA 5EQAA 2OWZA 4EDPA 1NV5A 4GX6A 1IXIA 1B58A 2QPQA 3KN8A 4YMBA 3T1BA 4UACA 3PPNA 1HSEA 2L5VA 3JV9A 3SEUA 3O97A 5FHNA 4X8RA 4YKIA 2FNCA 1URDA 3IOLA 2HFBA 4OFLA 2RCBA 4U23A 4NN3A 3C4MA 4F2OA 4IO2A 1IMFA 2DSFA 2ONSA 3EHUA 2RKMA 3K6VA 1Y1ZA 1LBYA 1BLFA 1B46A 4ND9A 3MSTA 3VXCA 1B3LA 3H3GA 3FIRA 1FPJA 3GBAA 3IFCA 5BUUA 3KZGA 1SDXA 1OVBA 2R9JA 1FQCA 1MY0A 1TXFA 4GVOA 4OVJA 4NF5B 4H8JA 3W9VA 2JJKA 2NXOA 4OVRA 3KN7A 4G2ZA 2Q88A 2A5SA 1ZBMA 4O7MA 3PUYE 3CVGA 2XXPA 5I57B 4OVSA 3FV1A 1MQJA 2CZLA 1LFHA 2OLBA 3S2VA 1EZPA 4ZGMA 2AL5A 5TP9B 1B3GA 1A7LA 4U2RA 1MY2A 3MBPA 3CSBA 5AE4A 1RDXA 2B3FA 1URSA 4N15A 2HEUA 1TT1A 5EYFA 3S9LC 1EZOA 1Q1KA 2XA5A 3RPLB 4I8CA 5F24A 2YPNA 1QUIA 4ZEIA 2QRYA 2I6EA 4WEPA 2RC8A 3MZ1A 2XXKA 4ZZEA 1A8EA 1ZJLA 1B1XA 3UGWA 3SZPA 3K02A 4OHNA 3RPWA 3PPQA 2PT2A 3GXAA 4F29A 5B70A 2YJPA 3IR1A 1B7UA 1FPDA 5FTIA 2DE2A 3N7RA 1KWHA 4DE8A 1QULA 2QVUA 4F3PA 4PP0A 2QJEA 5IAIA 3FXBA 3T93B 1LB9A 1P99A 5EQ9A 3UK4A 3MZ9A 4X1BA 2ZNUA 3TODA 4F1UA 2DE4A 5F7VA 3KC1A 2ABHA 2O6AA 5EQ8A 5ICTA 1EZ9A 1FPBA 3K1PA 1DTZA 2VGQA 4ZEBA 4NF4A 4Q8RA 3S9EA 4Z7EA 1FTKA 3HPIA 5I56A 1NNPA 4ZEKA 5CI5A 4G8NA 3IB0A 3T9VA 5H8QA 3KJTA 4GOTA 4R9FA 1XVYA 1FTAA 3T9XB 4ZEDA 3PPRA 4C0RA 4EF1A 4M1VA 3U8QA 2H9BA 4AB5A 2CZIA 4RK9A 2WYPA 4NTLA 1ZMGA 3EHSA 1OVTA 4F2QA 3UORA 4PBQA 4FAJA 1B7HA 2HAUA 2FVZA 3FXRA 4LQ5A 5IZ3B 2QSXA 4R74A 3SESA 2ONRA 2WBBA 3TPAA 1KA1A 1RYXA 1GTKA 2D21A 2QMWA 2Z8DA 3E4RA 1NV7A 3H6VA 3QIMA 1MPCA 4XKPA 3CR9A 4EQ9A 2O1MA 4TLMB 2M8CA 1K9YA 4BDLA 2V3TA 5I59B 3OO8A 1LBBA 3KBZA 3RLFE 5H8FA 3DP6A 4NAPA 2RCAA 3KGCA 4HE0A 2XXHA 4OVPA 1OLCA 2F5XA 3U65A 1XT8A 4M4GA 3C31A 3SEVA 4OTEA 1SW5A 3MP6A 2RINA 3M3LA 1TFAA 4JSOA 3CIJA 3D4GA 3EF7A 2QFLA 1JQFA 5I58A 1TFDA 3K0VA 4XIGQ 5IKBA 1JNFA 2GHAA 1IMCA 2Q89A 3P7IA 1IMAA 1MQDA 3KJ7A 2HCAA 4XKQA 5IM2A 3IK6B 1USYH 5ISUA 1LGBC 3H4ZA 4HCWA 3T66A 3RTWB 3LR1A 3H03A 4GBWA 3PUZE 3LSLA 4PFTA 2O51A 2XD3A 2UVGA 1HSJA 2I0BA 4N6KA 2V4CA 4THIA 4OESA 2UYEA 1MH3A 3USDA 2FHYA 1AH5A 3FBPA 4NF0A 4P0GA 5ET8A 4GWYA 2NUVA 1FQDA 2CMOA 4LZ5A 1D9YA 2QS2A 4H5GA 5AA2D 5A5XB 4F31B 1VFEA 1P1NA 5I2NA 2F6GA 3B7DA 1AMFA 4MMPA 2V3QA 3B8BA 4RK2A 3MYUA 1PB7A 1FBPA 3E9XA 1AIVA 5CBSA 3CFLA 3IX1A 1MXYA 2P0SA 3Q26A 4H67A 2OWSA 3IORA 3JZJA 4YU0A 4GWSA 3BKIB 1LAXA 3E79A 3K1NA 4PAKA 1QW0A 3IOUA 3MW0A 1QVSA 1WDNA 1XC1A 4IGTA 2OX3A 1Y20A 4KCDA 2F3DA 3QSLA 3RY3A 1EH3A 1RKMA 4F18A 1DOTA 5AA4A 4QSCA 4LZ7A 3BBRA 2HPGA 2HQ0A 3AXFA 3Q28A 4G68A 4YB5A 1O7TA 4N81A 1JEVA 4Q0CA 4R2BA 1U34A 3V89B 3EPEA 1H44A 1OMPA 2DXYA 3G3GA 1IXCA 3HHFA 3SEYA 3QXMA 1CNQA 5EHMA 1II5A 3AQFB 1R1NA 1DBZA 4LZ8A 1MXUA 3K6UA 1MH4A 5ET5A 2XWKA 3IOVA 3R26A 3SERA 1FPFA 2I49A 4ZZAA 3K2DA 3PD8A 3OELA 4G8MA 1FBHA 2XX9A 2R6GE 1FJ6A 3IFAA 1MXXA 5ET6A 4N13A 2VPNA 2F3BA 4O3CA 4R72A 3ECRA 3MVYA 5I84A 3PMVA 4ELOA 2ONKE 1NV6A 1XS5A 4TOZA 5K2XA 3ISPA 3VVEA 4NE4A 1B0HA 4JVDA 1GV8A 4NF4B 3TELA 1IITA 2G29A 4RYAA 4X04A 5LOMA 5EYHA 4PFUA 3A29A 1FBFA 2DWAA 5H8QB 1FBCA 4HTGA 4GIZA 1Q35A 1FSAA 4ZS9A 1PC3A 2B4MA 3UP9A 4DI3D 2XXQA 4XFEA 1B32A 2PT1A 4N91A 3PD9A 2ZZWA 2QMXA 2REJA 2RC9A 3G3FA 1H3DA 3MWBA 4GWUA 1G0HA 4DXUA 3MPKA 1IEJA 4OETA 1JW5A 1EYIA 3LSXA 4FECA 1J1NA 2DQVA 4G61A 3D4CA 1R9QA 2ZXTA 1RYOA 5J16A 1H43A 1P1WA 4F1VA 3H6TA 2H4IA 4QF9A 4GX4A 4JSDA 4NHBA 3B6TA 1Y4TA 4N8GA 4XKRA 3G7WA 4NGUA 4EQBA 1MQGA 3BIGA 4PFBA 4PDHA 5FBPA 4R2FA 1BTJA 1N04A 2IA4A 3B6WA 5I2KA 1WVJA 1QUJA 4DI4B 1MXVA 1Y3QA 3QAXA 2ZNSA 1DPPA 2P2AA 1MRPA 3OXNA 3QUFA 3V5AA 1I6QA 3FASA 4OWDA 4KR5A 1NNFA 1FQBA 4MLQA 4PGPA 4N4UA 2ZMBA 4GWZA 4C1UA 5CRYA 4ESWA 4H1XA 1LSTA 4POWA 4LF3C 4QBAA 1SBPA 4FJPA 1S7YA 1INPA 4AS4A 3KOSA 3TZAA 3N26A 4NG7A 1QGXA 1Y9UA 2W7YA 4C1TA 5I2NB 4JVCA 4GXSB 4KYEA 2FIEA 3FJGA 3FUZA 4BLAA 5AA2B 5H8NA 3TTRA 3O29A 3LBSA 5DVJA 1NMUA 2XXVA 2I0CA 1XOCA 2HAVA 3WAEA 3FVKA 1EYJA 4DCYA 3RN8A 5CMBA 1OLAA 4NQ8A 5AA4B 1M5EA 2XWIA 3IJOB 4BDMA 1FPGA 1B0LA 1JETA 1POTA 4Q30B 3M8UA 3VVDA 4DLQA 1MDP1 2XXIA 1D4NA 3FXUA 1FTLA 3MUQA 4P11A 3BIHA 4LN5A 3U1OA 1N3WA 3TCGA 1MM7A 2OBGA 4PTKA 4OFJA 4N6DA 1FTJA 3O28A 2D3IA 1JW1A 3OSRA 2GQ1A 4RA1A 1D9VA 4PBHA 4O94A 2DVCA 1P1QA 4QSDA 2QKHA 3IO4A 3OENA 3OEMA 1PB9A 5JTYA 3RT8A 3TQLA 1N0TA 1POY1 4OYVA 1SVXB 4NWCA 2DXRA 2ZNTA 4JDFA 1Y3PA 3MVZA 3N7SA 3ZKKA 2B4LA 1UQWA 2DP8A 2Z22A 2ZZXA 4QFOA 4JBZA 5I5PA 1AL3A 2FBPA 5AA1A 4MNIA 3VVFA 3IO6A 1TWYA 4MIJA 3TFLA 1NUWA 1IUDA 4BDOA 3MVXA 5TPAA 4GQOA 3RGYA 1UIVA 4OVQA 4NF8B 3THIA 4PC9A 1NKXA 3PPOA 1SW1A 4MF3A 1LAFE 3HN0A 4FEDA 1ZU0A 4KD5A 2DWJA 1SYHA 1QUKA 3T96B 4P47A 1QKAA 3TUSA 2DWHA 2XWOA 2HZKA 4JWOA 4ZE8A 3TCHA 4GBVA 5DYHA 4EUOA 1B5IA 4PF6A 4UABA 2WX9A 4QHQA 1US5A 4HE1A 1GVCA 2MKZA 4OVTA 3W15C 4OQOA 1H76A 1SW2A 2ZZVA 4GX3A 2VPOA 4HS7A 5ESYA 1M5DA 3QYTA 1LAGE 1NV1A 4R6KA 1B2HA 5HPQA 3VLUA 2HXRA 4OA4A 4YKJA 1M5FA 5L9MA 1GR2A 4H5FA 4PETA 1L5TA 3C32A 2X26A 1T0KA 4P1EA 2XWVA 4LONB 4JB7A 3O6GA 3DLNA 4KXPA 2DS9A 2XHDA 2X7QA 4IR8A 4GXAA 3LC8A 4KPTA 5LTCA 3SETA 2H5YA 2Y5LA 2ZYKA 4R9GA 4GRKA 2PX1A 1MQHA 4GD5A 1USYE 5CMMA 4KCCA 2O84X 3FJMA 1VSOA 1UTBA 2GFEA 5L9SA 5CC2A 4P1LA 4PF8A 4NF6A 1R9LA 3MC2A 1ZIUA 3WAFA 4YICA 3T22A 3H7MA 2ZYMA 3IL1B 2XX8A 3DP4A 2HHMA 4H0WA 3Q25A 3CRBA 2NOOA 1MXZA 3C36A 3TAJA 4QFNA 3LV0A 2F36A 4OEVA 3R7XA 2O68A 4DZ1A 3OSQA 3RT6B 3DELB 2GHBA 1EU8A 5LDZA 1JVXA 5KCJA 3ODBA 2HXWA 2RC7A 3GBBA 3CHGA 3B6QA 4U1OA 4WXJA 1DK4A 4GL0A 3PV0E 4F19A 1N76A 1I6AA 2I4CA 2QS3A 4G68C 1UTHA 1BK4A 4FEBA 4I3YA 4XF5A 1IXGA 1S50A 3B50A 5H8NB 2I4BA 1NUZA 1B40A 1Y3NA 1BP5A 2B65A 3TYHA 1DMBA 1Y1MA 1ANFA 1N7WA 3FXQA 3D1RA 1DSNA 2H99A 3IJXB 3TDJA 2P3NA 4IY5A 2L27A 2V84A 1VDWA 1FBGA 1N3XA 5ICQA 1SI1A 1A99A 1Q9DA 1FQAA 4RJZA 4H8IA 3C59A 1MPBA 2F7BA 2Y84A 1LBVA 1FPLA 2QS1A 2UVHA 2F35A 3QMFA 3IB1A 4PAFA 1FBDA 1SPIA 4LP2B 5I57A 4KFQA 4BDQA 2FA7A 2Q2AA 1WODA 3C5TA 4XXUA 1ATGA 4MNPA 4HE2A 3T0JA 3KSXA 2JNDA 2P1SA 1B6HA 4FBPA 2OK2A 2DVZA 1VFDA 2F6PA 1I6BA 1LBWA 4MX6A 5JTYB 3RPLA 4H6DA 1UIUA 4O3BA 2THIA 2F8DA 4XEQA 2P3VA 1B52A 4I62A 4ELRA 5L9OA 4N6PA 3TCFA 2GRVA 2Y7KA 1LFIA 1CE2A 4OEUA 3U92A 3OD7A 3O6HA 3ONMA 4NEDA 2AIXA 1A54A 3ZSFA 5CM6A 3FV2A 1XVXA 3MAMA 5TPAB 4N07A 1D3KA 3V83A 4F39A 5L8DA 5DEXA 1YCJA 2XX7A 4TLLB 4RPNA 3CFZA 5I56B 4E0XA 1RDZA 2XXRA 2V93A 1LBZA 1CB6A 1JEUA 1ZKBA 4PGNA 4ONYA 4O3AA 1SQYA 3KBRA 2Z23A 3N94A 1XI6A 3U93A 4JVIA 4UA8A 3PMXA 2F97A 3ZKLA 4AB6A 1I69A 3CFXA 4QFPA 1EYKA 1NV3A 3UN6A 3FATA 1MDQA 3DP8A 1LFGA 4U22A 4O7IA 2CEYA 1OQGA 4GF8A 3FVNA 4GWWA 3PU5A 5DT6A 5HM4B 1AWBA 3A09A 3QUJA 2I3VA 4DXCA 2ESNA 3VLVA 2Z8FA 2XD2A 5DW8A 3T9HB 3HSTA 5JEIA 5KDTA 3I5OA 4YB6A 4PFWA 4N17A 2Y5KA 1Z7NE 1B5HA 2WKYA 1NV2A 5H8FB 3TQWA 4RXLA 5IZ3A 4P3LA 4ERSA 2UYFA 1YAEA 4PFYA 1F9BA 4R6YA 2Q74A 2Q8JA 3W9WA 4YMAA 3S9MC 2AYSA 1HSLA 5I59A 4DXBA 4MJOA 1A8FA 2VT5A 4IO5A 3LUZA 5I58B 1DCUA 1MG1A 1UTBB 4HCYA 4DLDA 1LAHE 1FQFA 4P0IA 4P8BA 3TEPA 5I3SA 1P1UA 4OZ9A 3I6VA 2DDKA 4POXA 3OEKA 3QK6A 4I9DA 4PFIA 4ELQA 4AQ4A 5ITPA 4EQ7A 3BFTA 1N7XA 2VOZA 4EF2A 3S9NC 1FPIA 4H46A 1YXIA 5T3JA 3T9UA 4RY1A 5DTBA 2OJTA 4WKMA 2I58A 2XXWA 4F3BA 3F11A 5KCJB 4PAIA 4U1ZA 2CEXA 3MZBA 1B3HA 3M3FA 3U94A 2UVIA 4EXLA 4YKPA 4F3SA 4DIGA 5IGAA 1UTHB 3RQTA 3S4UA 4FIMA 3HFUA 3KOTA 1S9TA 3K1MA 4X1DA 1NH8A 4FORA 3A3CA 3TKDA 1PB8A 4LATA 1BKAA 3KC0A 5CBRA 3K01A 1QKBA 1MQIA 3SEXA 4KYDA 5A5XA 4ZDMA 1FJ9A 1IMEA 2DWIA 1RDYA 4MNCA 4ESXA 3PGFA 1LLSA 4I3EA 3PPPA 3G3IA 2V3UA 4JWXA 4NX1A 1NV0A 1B7ZA 4G68B 1A40A 3EHTA 4F3GA 4LVQA 2H98A 3HHGA 2A5TA 3LSWA 1DPEA 5DVIA 2LAOA 4KYSA 3R6UA 3L6GA 2ZYOA 1FTMA 3E3KA 2Q8MA 1NI9A 2JNCA 4OENA 4AS5A 1FPKA 3K6XA 3MP1A 2OZZA 5EYGA 1LBCA 2XDGA 4HXVA 3ILTB 5B7DA 4R75A 1NFTA 1LCFA 1JVYA 3SKPA 3PTYA 4DDDA 1BIYA 1VR5A 1FPEA 5FTHA 3KFMA 1MM6A 4PFRA 4F1YA 1SYIA 1PBQA 2CZKA 4X9TA 1IIWA 1YPNA 4P56A 1YZ0A 2D5WA 4YB7A 3N7PA 1Z7ME 3FGSA 3E13X 4MBPA 4PDDA 4QFLA 1OIBA 5IZ1A 1FTOA 1B3FA 3IAZA 2O1LA 4OERA 4I1DA 3HO7A 3K6WA 3TTKA 4DLOA 2B3BA 5DEXB 3PUXE 4QRZA 5H8HA 4L17A 5ELVA 2I48A 4LQ2A 2ANJA 5BWJA 2KLFA 4MH5A 2V25A 4NMYA 3VXBA 1VE4A 5J1DA 4IO6A 3RNNA 4MLVA 1FCKA 5A5LA 1OQHA 1K9ZA 4MAGA 4PE5B 2BJJX 3UIFA 3CI8A 2NWJA 2Q2CA 3KEIA 1NV4A 3IB2A 1MY4A 1H45A 2BJIA 4OMBA 2CZHA 4GLIA 5DVFA 3O2AA 3CG1A 4ISUA 1SW4A 2DE3A 2FIXA 3G3HA 2VD3A 1SD3A 2WYKA 3EQ1A 2WEFA 1IXHA 4KI0E 2G93A 1NL5A 5M2VA 1IMBA 5KDTB 2Y7WA 4NWDA 5AA3A 2XXUA 3ILUB 3FZVA 3KN3A 3C34A 1NUYA 4TQUQ 4KQPA 1JW4A 1B51A 1PBPA 4QXDA 1M5BA 4U4SA 1Y4CA 1FRPA 3MQ9A 4R6HA 1B4ZA 4ZEFA 1NUXA 2F78A 5I2KB 2UXAA 4OFOA 4ECFA 2F7CA 5FHMA 5JK4A 1ZLQA 3IOTA 3H6UA 1G0IA 4U4XA 4PCDA 4H45A 1JP4A 1NH7A 5F1QA 3H6WA 4FATA 1FW0A 3EKIA 3M3KA 4IGRA 1MY1A 3TTMA 5FHOA 1GGGA 2PBWA 2QL3A 2KR0A 3VE1B 3LUYA 4JXIA 3NOHA 1URGA 4O8MA 1IZ1A 3ROJA 5ET7A 1PDAA 3CG3A 5IZZA 2QS4A 5TU0A 4F22A 4MEVA 3VV5A 4WEDA 4XTCQ 4RPOA 4EXKA 1B5JA 1LEVA 3A3UA 1PEBA 1M5CA 4ELPA 3VDFA 4IO4A 1IQ7A 3U72A 2DYXA 4G77A 4R73A 2REGA 4G4PA 4FE8A 2NVUB 2Q9TA 3BFUA 1NNKA 3JYRA 1B3EA 1DTGA 5HBCA 1MXWA 4E0WA 2VP1A 2PYYA 3LSFB 2OCUA 3FVOA 1O64A 4XKNA 1LB8A 3TTLA 4JWYA 5AA2A 2QVVA 4NF5A 2O69A 3N6UA 4K3FA 3KSJA 3MJNA 3PUWE 3L6HA 3H06B 4Z0IA 3G3KA 3N6TA 2A5TB 3VFJA 3DM0A 3HCQA 3KG2A 1KZ8A 3CSGA 3OMBA 3I3VA 3TTNA 2PCRA 4GWXA 2PVUA 3C33A 3MPLA 3Q29A 2Y7RA 3TMGA 1YYZA 2E0SA 4RNSA 1B1HA 2Y7IA 1IMDA 3FVGA 3C9HA 1ZTYA 5TP9A 4IY6A 2XXTA 5CMCA 3MVWA 1FBEA 1R6ZA 3RUMA 4HW8A 3PMWA 2Z8EA 4X48A 3ZS6A 1XHYA 2R8TA 2ZYNA 4YAHX 1MY3A 4MCOA 1MPDA 1SI0A 1YTVA 2JODA 4GFRA 3OO6A 2XXXA 2HZLA 2QVRA 1B05A 2F7AA 2PFYA 2WBDA 4N8YA 3N5LA 3GLBA 3RTFB 2XXYA 4MHFA 4P9KA 4YKKA 3EN3A 3OO9A 3C35A 2KQZA 4BDNA 1LBXA 4IO7A 2IEEA 5H8HB 4I40A 3E78A 2RF1A 1B9JA 3IOWA 1P1OA 3HV1A 5EQ7A 4NF8A 1AOVA 2H25A 4GWOA 3FJ7A 4QFKA 2AL4A 3O9PA 4OANA 5EHSA 4DCXA 4LUBA 5H8SA 1KA0A 2OWTA 1QJMA 3OOAA 5I7IA 4YZZA 3L2JA 4OXVA 3SEWA 4BDRA 3GYYA 3UA8A 3VLWA 4U21A 4ZECA 4GL8A 1N84A
chains in the Genus database with same CATH topology
2FYIA 3FD3A 4QSEA 2I3WA 3GZGA 1LCTA 2X7PA 3SDFA 2VD2A 5K2YA 3K00A 4ZE9A 3V8XB 5KZTA 3G3JA 1B4HA 3OO7A 2UVJA 2F34A 1FQEA 4KHZE 4PQJA 3O6IA 4IB2A 3MP8A 3K4UA 4H65A 5CMKA 4LA9A 4Q5TA 2PMSA 2GH9A 4NF6B 4G8HA 1A55A 2YLNA 4IO3A 1US4A 2O7UA 5II0A 3PUVE 1O63A 5ITOA 3Q27A 1NNTA 2E1SA 1ELJA 2O7IA 1MS7A 2ALUA 2Y7PA 2VHAA 2DOJA 3O66A 4HJ0A 2R71A 4MFIA 4EDPA 1IXIA 1B58A 2QPQA 3KN8A 4YMBA 4UACA 3PPNA 1HSEA 3JV9A 3SEUA 3O97A 5FHNA 4YKIA 2FNCA 1URDA 3IOLA 2HFBA 4OFLA 2RCBA 4U23A 3C4MA 4F2OA 4IO2A 2DSFA 2ONSA 3K6VA 3EHUA 2RKMA 1Y1ZA 1BLFA 1B46A 4ND9A 3VXCA 1B3LA 3H3GA 3FIRA 3GBAA 5BUUA 3KZGA 1SDXA 1OVBA 2R9JA 1FQCA 1MY0A 1TXFA 4GVOA 4OVJA 4NF5B 4H8JA 3W9VA 2NXOA 3KN7A 4G2ZA 2Q88A 2A5SA 1ZBMA 3PUYE 3CVGA 2XXPA 5I57B 3FV1A 1MQJA 2CZLA 1LFHA 2OLBA 3S2VA 1EZPA 4ZGMA 2AL5A 5TP9B 1B3GA 1A7LA 4U2RA 1MY2A 3MBPA 3CSBA 5AE4A 2B3FA 1URSA 2HEUA 1TT1A 5EYFA 3S9LC 1EZOA 1Q1KA 4I8CA 2YPNA 1QUIA 4ZEIA 2QRYA 2I6EA 4WEPA 2RC8A 3MZ1A 4ZZEA 1A8EA 1ZJLA 1B1XA 3UGWA 3K02A 4OHNA 3RPWA 3PPQA 2PT2A 3GXAA 4F29A 5B70A 2YJPA 3IR1A 1B7UA 5FTIA 2DE2A 3N7RA 1KWHA 4DE8A 1QULA 4F3PA 4PP0A 2QJEA 5IAIA 3T93B 1LB9A 1P99A 3UK4A 3MZ9A 4X1BA 2ZNUA 3TODA 4F1UA 2DE4A 5F7VA 2ABHA 2O6AA 5ICTA 1EZ9A 3K1PA 1DTZA 2VGQA 4ZEBA 4NF4A 4Q8RA 3S9EA 4Z7EA 1FTKA 3HPIA 5I56A 1NNPA 4ZEKA 5CI5A 4G8NA 3IB0A 3T9VA 5H8QA 3KJTA 4GOTA 4R9FA 1XVYA 3T9XB 4ZEDA 3PPRA 4C0RA 4EF1A 4M1VA 3U8QA 2H9BA 4AB5A 4RK9A 4NTLA 1ZMGA 3EHSA 1OVTA 4F2QA 4FAJA 3UORA 1B7HA 2HAUA 3FXRA 4LQ5A 2QSXA 4R74A 3SESA 2ONRA 3TPAA 1RYXA 1GTKA 2D21A 2QMWA 2Z8DA 3E4RA 3H6VA 3QIMA 1MPCA 4XKPA 3CR9A 4EQ9A 2O1MA 4TLMB 2M8CA 4BDLA 2V3TA 5I59B 3OO8A 1LBBA 3RLFE 5H8FA 3DP6A 2RCAA 3KGCA 2XXHA 1OLCA 2F5XA 1XT8A 4M4GA 3C31A 3SEVA 4OTEA 1SW5A 3MP6A 2RINA 3M3LA 1TFAA 4JSOA 3CIJA 3D4GA 3EF7A 1JQFA 5I58A 1TFDA 3K0VA 4XIGQ 5IKBA 1JNFA 2GHAA 2Q89A 3P7IA 1MQDA 3KJ7A 2HCAA 4XKQA 3IK6B 1USYH 5ISUA 1LGBC 3H4ZA 4HCWA 3T66A 3RTWB 3LR1A 3H03A 3PUZE 3LSLA 4PFTA 2O51A 2XD3A 2UVGA 1HSJA 2I0BA 4THIA 4OESA 2UYEA 1MH3A 3USDA 1AH5A 4P0GA 2NUVA 1FQDA 2CMOA 4LZ5A 1D9YA 2QS2A 4H5GA 5AA2D 5A5XB 4F31B 1VFEA 1P1NA 5I2NA 2F6GA 3B7DA 1AMFA 2V3QA 4RK2A 1PB7A 3E9XA 1AIVA 5CBSA 3CFLA 3IX1A 1MXYA 2P0SA 3Q26A 4H67A 2OWSA 3IORA 3JZJA 4YU0A 3BKIB 1LAXA 3K1NA 1QW0A 3IOUA 3MW0A 1QVSA 1WDNA 1XC1A 4IGTA 1Y20A 4KCDA 3RY3A 3QSLA 1EH3A 1RKMA 4F18A 1DOTA 5AA4A 4QSCA 4LZ7A 3BBRA 2HQ0A 3AXFA 3Q28A 4G68A 4YB5A 1O7TA 1JEVA 4Q0CA 4R2BA 1U34A 3V89B 3EPEA 1H44A 1OMPA 2DXYA 3G3GA 1IXCA 3HHFA 3SEYA 3QXMA 5EHMA 1II5A 3AQFB 1R1NA 4LZ8A 1MXUA 3K6UA 1MH4A 3IOVA 3R26A 3SERA 2I49A 4ZZAA 3K2DA 3PD8A 3OELA 4G8MA 2XX9A 2R6GE 1MXXA 4N13A 4O3CA 4R72A 3ECRA 3MVYA 5I84A 3PMVA 4ELOA 2ONKE 1XS5A 4TOZA 5K2XA 3VVEA 4NE4A 1B0HA 1GV8A 4NF4B 3TELA 1IITA 2G29A 4RYAA 5LOMA 4PFUA 2DWAA 5H8QB 4HTGA 4GIZA 1Q35A 4ZS9A 1PC3A 3UP9A 2XXQA 1B32A 2PT1A 3PD9A 2QMXA 2REJA 2RC9A 3G3FA 1H3DA 3MWBA 4DXUA 3MPKA 1IEJA 4OETA 1JW5A 3LSXA 4FECA 1J1NA 2DQVA 3D4CA 1R9QA 2ZXTA 1RYOA 1H43A 1P1WA 4F1VA 3H6TA 2H4IA 4QF9A 4JSDA 3B6TA 1Y4TA 4XKRA 3G7WA 4EQBA 1MQGA 4R2FA 1BTJA 1N04A 2IA4A 3B6WA 5I2KA 1WVJA 1QUJA 1MXVA 1Y3QA 3QAXA 2ZNSA 1DPPA 2P2AA 1MRPA 3OXNA 3QUFA 3V5AA 1I6QA 3FASA 4OWDA 4KR5A 1NNFA 1FQBA 4MLQA 2ZMBA 4C1UA 5CRYA 4ESWA 4H1XA 1LSTA 4POWA 4LF3C 1SBPA 4FJPA 1S7YA 3KOSA 3TZAA 3N26A 1Y9UA 2W7YA 4C1TA 5I2NB 4GXSB 4KYEA 3FJGA 3FUZA 4BLAA 5AA2B 5H8NA 3TTRA 3O29A 3LBSA 5DVJA 1NMUA 2XXVA 2I0CA 1XOCA 2HAVA 3WAEA 3FVKA 4DCYA 3RN8A 5CMBA 1OLAA 5AA4B 1M5EA 3IJOB 4BDMA 1B0LA 1JETA 1POTA 4Q30B 3M8UA 3VVDA 4DLQA 1MDP1 2XXIA 1D4NA 3FXUA 1FTLA 3MUQA 4P11A 3U1OA 1N3WA 3TCGA 1MM7A 2OBGA 4OFJA 1FTJA 3O28A 2D3IA 1JW1A 3OSRA 4RA1A 1D9VA 2DVCA 1P1QA 4QSDA 2QKHA 3IO4A 3OENA 3OEMA 1PB9A 5JTYA 3RT8A 3TQLA 1N0TA 1POY1 4OYVA 1SVXB 4NWCA 2DXRA 2ZNTA 4JDFA 1Y3PA 3MVZA 3N7SA 3ZKKA 1UQWA 2DP8A 2Z22A 4QFOA 4JBZA 1AL3A 5AA1A 3VVFA 3IO6A 1TWYA 3TFLA 1IUDA 4BDOA 3MVXA 5TPAA 4GQOA 3RGYA 1UIVA 4NF8B 3THIA 1NKXA 3PPOA 1SW1A 4MF3A 1LAFE 3HN0A 4FEDA 1ZU0A 4KD5A 2DWJA 1SYHA 1QUKA 3T96B 1QKAA 3TUSA 2DWHA 4JWOA 2HZKA 4ZE8A 3TCHA 5DYHA 4EUOA 1B5IA 4QHQA 1US5A 1GVCA 3W15C 4OQOA 1H76A 1SW2A 4HS7A 1M5DA 3QYTA 1LAGE 4R6KA 1B2HA 5HPQA 3VLUA 4YKJA 1M5FA 5L9MA 1GR2A 4H5FA 4PETA 1L5TA 3C32A 2X26A 1T0KA 4LONB 4JB7A 3O6GA 3DLNA 2DS9A 2XHDA 2X7QA 4GXAA 3LC8A 4KPTA 3SETA 2H5YA 2ZYKA 4R9GA 4GRKA 2PX1A 1MQHA 4GD5A 1USYE 5CMMA 4KCCA 2O84X 3FJMA 1VSOA 1UTBA 2GFEA 5L9SA 5CC2A 4NF6A 1R9LA 3MC2A 1ZIUA 3WAFA 4YICA 3T22A 3H7MA 2ZYMA 3IL1B 2XX8A 3DP4A 4H0WA 3Q25A 3CRBA 2NOOA 1MXZA 3C36A 3TAJA 4QFNA 2F36A 4OEVA 3R7XA 2O68A 4DZ1A 3OSQA 3RT6B 3DELB 2GHBA 1EU8A 1JVXA 5KCJA 3ODBA 2HXWA 2RC7A 3GBBA 3B6QA 4U1OA 4WXJA 4GL0A 3PV0E 4F19A 1N76A 1I6AA 2I4CA 2QS3A 4G68C 1UTHA 4FEBA 1IXGA 1S50A 5H8NB 2I4BA 1B40A 1Y3NA 1BP5A 2B65A 3TYHA 1DMBA 1Y1MA 1ANFA 1N7WA 3FXQA 1DSNA 2H99A 3IJXB 3TDJA 4IY5A 2L27A 2V84A 1N3XA 5ICQA 1SI1A 1A99A 1FQAA 4RJZA 4H8IA 3C59A 1MPBA 2F7BA 2Y84A 2QS1A 2UVHA 2F35A 3IB1A 4LP2B 5I57A 4KFQA 4BDQA 2FA7A 2Q2AA 1WODA 3C5TA 4XXUA 1ATGA 3KSXA 2JNDA 2P1SA 1B6HA 2OK2A 2DVZA 1VFDA 2F6PA 1I6BA 5JTYB 4H6DA 1UIUA 4O3BA 2THIA 2F8DA 1B52A 4I62A 4ELRA 5L9OA 4N6PA 3TCFA 2GRVA 2Y7KA 1LFIA 1CE2A 4OEUA 3U92A 3OD7A 3O6HA 3ONMA 4NEDA 2AIXA 1A54A 3ZSFA 5CM6A 3FV2A 1XVXA 3MAMA 5TPAB 4N07A 1D3KA 3V83A 4F39A 5L8DA 5DEXA 1YCJA 2XX7A 4TLLB 4RPNA 3CFZA 5I56B 4E0XA 2XXRA 2V93A 1CB6A 1JEUA 1ZKBA 4ONYA 4O3AA 1SQYA 3KBRA 2Z23A 3N94A 3U93A 4UA8A 3PMXA 2F97A 3ZKLA 4AB6A 1I69A 3CFXA 4QFPA 3UN6A 3FATA 1MDQA 3DP8A 1LFGA 4U22A 4GF8A 1OQGA 3FVNA 3PU5A 5DT6A 5HM4B 3A09A 3QUJA 2I3VA 4DXCA 2ESNA 3VLVA 2Z8FA 2XD2A 3T9HB 5JEIA 3HSTA 5KDTA 3I5OA 4YB6A 4PFWA 1Z7NE 1B5HA 5H8FB 2WKYA 3TQWA 4RXLA 4ERSA 2UYFA 1YAEA 4PFYA 1F9BA 4R6YA 2Q8JA 3W9WA 4YMAA 3S9MC 2AYSA 1HSLA 5I59A 4DXBA 1A8FA 4IO5A 5I58B 1MG1A 1UTBB 4HCYA 4DLDA 1LAHE 1FQFA 4P0IA 3TEPA 1P1UA 4OZ9A 3I6VA 4POXA 3OEKA 3QK6A 4I9DA 4ELQA 4AQ4A 5ITPA 4EQ7A 3BFTA 1N7XA 2VOZA 4EF2A 3S9NC 3T9UA 4RY1A 5DTBA 2OJTA 4WKMA 2I58A 2XXWA 4F3BA 3F11A 5KCJB 4U1ZA 3MZBA 1B3HA 3M3FA 3U94A 2UVIA 4EXLA 4YKPA 4F3SA 4DIGA 1UTHB 3RQTA 3S4UA 4FIMA 3KOTA 1S9TA 3K1MA 4X1DA 1NH8A 4FORA 3A3CA 3TKDA 1PB8A 4LATA 1BKAA 5CBRA 3K01A 1QKBA 1MQIA 3SEXA 4KYDA 5A5XA 4ZDMA 2DWIA 4ESXA 3PGFA 1LLSA 3PPPA 3G3IA 2V3UA 4JWXA 1B7ZA 4G68B 1A40A 3EHTA 4F3GA 4LVQA 2H98A 3HHGA 2A5TA 3LSWA 1DPEA 5DVIA 2LAOA 4KYSA 3R6UA 3L6GA 2ZYOA 1FTMA 3E3KA 2JNCA 4OENA 3K6XA 3MP1A 2OZZA 1LBCA 2XDGA 3ILTB 5B7DA 4R75A 1NFTA 1LCFA 1JVYA 3SKPA 4DDDA 1BIYA 1VR5A 5FTHA 3KFMA 1MM6A 4F1YA 1SYIA 1PBQA 4X9TA 1IIWA 1YPNA 2D5WA 4YB7A 3N7PA 1Z7ME 3FGSA 3E13X 4MBPA 4QFLA 1OIBA 1FTOA 1B3FA 3IAZA 2O1LA 4OERA 4I1DA 3HO7A 3K6WA 3TTKA 4DLOA 2B3BA 5DEXB 3PUXE 4QRZA 5H8HA 4L17A 5ELVA 2I48A 4LQ2A 2ANJA 5BWJA 2KLFA 4MH5A 2V25A 4NMYA 3VXBA 1VE4A 5J1DA 4IO6A 3RNNA 4MLVA 1FCKA 1OQHA 4PE5B 2BJJX 3UIFA 3CI8A 2NWJA 2Q2CA 3KEIA 3IB2A 1MY4A 1H45A 4OMBA 4GLIA 5DVFA 3O2AA 3CG1A 4ISUA 1SW4A 2DE3A 3G3HA 2VD3A 1SD3A 3EQ1A 1IXHA 4KI0E 2G93A 1NL5A 5M2VA 5KDTB 2Y7WA 4NWDA 5AA3A 2XXUA 3ILUB 3FZVA 3KN3A 3C34A 4TQUQ 4KQPA 1JW4A 1B51A 1PBPA 1M5BA 4U4SA 1Y4CA 3MQ9A 4R6HA 1B4ZA 4ZEFA 2F78A 5I2KB 2UXAA 4OFOA 4ECFA 2F7CA 5FHMA 5JK4A 1ZLQA 3IOTA 3H6UA 4U4XA 1NH7A 5F1QA 3H6WA 4FATA 1FW0A 3M3KA 4IGRA 1MY1A 3TTMA 5FHOA 1GGGA 2PBWA 2QL3A 3VE1B 3LUYA 4JXIA 1URGA 1IZ1A 1PDAA 3CG3A 2QS4A 5TU0A 4F22A 3VV5A 4WEDA 4XTCQ 4RPOA 4EXKA 1B5JA 3A3UA 1PEBA 1M5CA 4ELPA 3VDFA 4IO4A 1IQ7A 3U72A 2DYXA 4G77A 4R73A 2REGA 4G4PA 4FE8A 2NVUB 2Q9TA 3BFUA 1NNKA 3JYRA 1B3EA 1DTGA 5HBCA 1MXWA 4E0WA 2VP1A 2PYYA 3LSFB 2OCUA 3FVOA 1O64A 4XKNA 1LB8A 3TTLA 4JWYA 5AA2A 4NF5A 2O69A 3N6UA 4K3FA 3KSJA 3MJNA 3PUWE 3L6HA 3H06B 4Z0IA 3G3KA 3N6TA 2A5TB 3VFJA 3DM0A 3HCQA 3KG2A 3CSGA 3OMBA 3I3VA 3TTNA 2PVUA 3C33A 3MPLA 3Q29A 2Y7RA 3TMGA 2E0SA 4RNSA 1B1HA 2Y7IA 3FVGA 3C9HA 1ZTYA 5TP9A 4IY6A 2XXTA 5CMCA 3MVWA 1R6ZA 3RUMA 4HW8A 3PMWA 2Z8EA 4X48A 3ZS6A 1XHYA 2ZYNA 4YAHX 1MY3A 1MPDA 1SI0A 1YTVA 2JODA 4GFRA 3OO6A 2XXXA 2HZLA 1B05A 2F7AA 3N5LA 3GLBA 3RTFB 2XXYA 4YKKA 3EN3A 3OO9A 3C35A 4BDNA 4IO7A 2IEEA 5H8HB 2RF1A 1B9JA 3IOWA 1P1OA 3HV1A 4NF8A 1AOVA 2H25A 4GWOA 3FJ7A 4QFKA 2AL4A 3O9PA 5EHSA 4DCXA 4LUBA 5H8SA 2OWTA 1QJMA 3OOAA 4YZZA 3L2JA 4OXVA 3SEWA 4BDRA 3UA8A 4ZECA 4U21A 3VLWA 4GL8A 1N84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYI A;  3FD3 A;  4QSE A;  2I3W A;  3GZG A;  1LCT A;  2X7P A;  3SDF A;  2VD2 A;  5K2Y A;  3K00 A;  4ZE9 A;  3V8X B;  5KZT A;  3G3J A;  1B4H A;  3OO7 A;  2UVJ A;  2F34 A;  1FQE A;  4KHZ E;  4PQJ A;  3O6I A;  4IB2 A;  3MP8 A;  3K4U A;  4H65 A;  5CMK A;  4LA9 A;  4Q5T A;  2PMS A;  2GH9 A;  4NF6 B;  4G8H A;  1A55 A;  2YLN A;  4IO3 A;  1US4 A;  2O7U A;  5II0 A;  3PUV E;  1O63 A;  5ITO A;  3Q27 A;  1NNT A;  2E1S A;  1ELJ A;  2O7I A;  1MS7 A;  2ALU A;  2Y7P A;  2VHA A;  2DOJ A;  3O66 A;  4HJ0 A;  2R71 A;  4MFI A;  4EDP A;  1IXI A;  1B58 A;  2QPQ A;  3KN8 A;  4YMB A;  4UAC A;  3PPN A;  1HSE A;  3JV9 A;  3SEU A;  3O97 A;  5FHN A;  4YKI A;  2FNC A;  1URD A;  3IOL A;  2HFB A;  4OFL A;  2RCB A;  4U23 A;  3C4M A;  4F2O A;  4IO2 A;  2DSF A;  2ONS A;  3K6V A;  3EHU A;  2RKM A;  1Y1Z A;  1BLF A;  1B46 A;  4ND9 A;  3VXC A;  1B3L A;  3H3G A;  3FIR A;  3GBA A;  5BUU A;  3KZG A;  1SDX A;  1OVB A;  2R9J A;  1FQC A;  1MY0 A;  1TXF A;  4GVO A;  4OVJ A;  4NF5 B;  4H8J A;  3W9V A;  2NXO A;  3KN7 A;  4G2Z A;  2Q88 A;  2A5S A;  1ZBM A;  3PUY E;  3CVG A;  2XXP A;  5I57 B;  3FV1 A;  1MQJ A;  2CZL A;  1LFH A;  2OLB A;  3S2V A;  1EZP A;  4ZGM A;  2AL5 A;  5TP9 B;  1B3G A;  1A7L A;  4U2R A;  1MY2 A;  3MBP A;  3CSB A;  5AE4 A;  2B3F A;  1URS A;  2HEU A;  1TT1 A;  5EYF A;  3S9L C;  1EZO A;  1Q1K A;  4I8C A;  2YPN A;  1QUI A;  4ZEI A;  2QRY A;  2I6E A;  4WEP A;  2RC8 A;  3MZ1 A;  4ZZE A;  1A8E A;  1ZJL A;  1B1X A;  3UGW A;  3K02 A;  4OHN A;  3RPW A;  3PPQ A;  2PT2 A;  3GXA A;  4F29 A;  5B70 A;  2YJP A;  3IR1 A;  1B7U A;  5FTI A;  2DE2 A;  3N7R A;  1KWH A;  4DE8 A;  1QUL A;  4F3P A;  4PP0 A;  2QJE A;  5IAI A;  3T93 B;  1LB9 A;  1P99 A;  3UK4 A;  3MZ9 A;  4X1B A;  2ZNU A;  3TOD A;  4F1U A;  2DE4 A;  5F7V A;  2ABH A;  2O6A A;  5ICT A;  1EZ9 A;  3K1P A;  1DTZ A;  2VGQ A;  4ZEB A;  4NF4 A;  4Q8R A;  3S9E A;  4Z7E A;  1FTK A;  3HPI A;  5I56 A;  1NNP A;  4ZEK A;  5CI5 A;  4G8N A;  3IB0 A;  3T9V A;  5H8Q A;  3KJT A;  4GOT A;  4R9F A;  1XVY A;  3T9X B;  4ZED A;  3PPR A;  4C0R A;  4EF1 A;  4M1V A;  3U8Q A;  2H9B A;  4AB5 A;  4RK9 A;  4NTL A;  1ZMG A;  3EHS A;  1OVT A;  4F2Q A;  4FAJ A;  3UOR A;  1B7H A;  2HAU A;  3FXR A;  4LQ5 A;  2QSX A;  4R74 A;  3SES A;  2ONR A;  3TPA A;  1RYX A;  1GTK A;  2D21 A;  2QMW A;  2Z8D A;  3E4R A;  3H6V A;  3QIM A;  1MPC A;  4XKP A;  3CR9 A;  4EQ9 A;  2O1M A;  4TLM B;  2M8C A;  4BDL A;  2V3T A;  5I59 B;  3OO8 A;  1LBB A;  3RLF E;  5H8F A;  3DP6 A;  2RCA A;  3KGC A;  2XXH A;  1OLC A;  2F5X A;  1XT8 A;  4M4G A;  3C31 A;  3SEV A;  4OTE A;  1SW5 A;  3MP6 A;  2RIN A;  3M3L A;  1TFA A;  4JSO A;  3CIJ A;  3D4G A;  3EF7 A;  1JQF A;  5I58 A;  1TFD A;  3K0V A;  4XIG Q;  5IKB A;  1JNF A;  2GHA A;  2Q89 A;  3P7I A;  1MQD A;  3KJ7 A;  2HCA A;  4XKQ A;  3IK6 B;  1USY H;  5ISU A;  1LGB C;  3H4Z A;  4HCW A;  3T66 A;  3RTW B;  3LR1 A;  3H03 A;  3PUZ E;  3LSL A;  4PFT A;  2O51 A;  2XD3 A;  2UVG A;  1HSJ A;  2I0B A;  4THI A;  4OES A;  2UYE A;  1MH3 A;  3USD A;  1AH5 A;  4P0G A;  2NUV A;  1FQD A;  2CMO A;  4LZ5 A;  1D9Y A;  2QS2 A;  4H5G A;  5AA2 D;  5A5X B;  4F31 B;  1VFE A;  1P1N A;  5I2N A;  2F6G A;  3B7D A;  1AMF A;  2V3Q A;  4RK2 A;  1PB7 A;  3E9X A;  1AIV A;  5CBS A;  3CFL A;  3IX1 A;  1MXY A;  2P0S A;  3Q26 A;  4H67 A;  2OWS A;  3IOR A;  3JZJ A;  4YU0 A;  3BKI B;  1LAX A;  3K1N A;  1QW0 A;  3IOU A;  3MW0 A;  1QVS A;  1WDN A;  1XC1 A;  4IGT A;  1Y20 A;  4KCD A;  3RY3 A;  3QSL A;  1EH3 A;  1RKM A;  4F18 A;  1DOT A;  5AA4 A;  4QSC A;  4LZ7 A;  3BBR A;  2HQ0 A;  3AXF A;  3Q28 A;  4G68 A;  4YB5 A;  1O7T A;  1JEV A;  4Q0C A;  4R2B A;  1U34 A;  3V89 B;  3EPE A;  1H44 A;  1OMP A;  2DXY A;  3G3G A;  1IXC A;  3HHF A;  3SEY A;  3QXM A;  5EHM A;  1II5 A;  3AQF B;  1R1N A;  4LZ8 A;  1MXU A;  3K6U A;  1MH4 A;  3IOV A;  3R26 A;  3SER A;  2I49 A;  4ZZA A;  3K2D A;  3PD8 A;  3OEL A;  4G8M A;  2XX9 A;  2R6G E;  1MXX A;  4N13 A;  4O3C A;  4R72 A;  3ECR A;  3MVY A;  5I84 A;  3PMV A;  4ELO A;  2ONK E;  1XS5 A;  4TOZ A;  5K2X A;  3VVE A;  4NE4 A;  1B0H A;  1GV8 A;  4NF4 B;  3TEL A;  1IIT A;  2G29 A;  4RYA A;  5LOM A;  4PFU A;  2DWA A;  5H8Q B;  4HTG A;  4GIZ A;  1Q35 A;  4ZS9 A;  1PC3 A;  3UP9 A;  2XXQ A;  1B32 A;  2PT1 A;  3PD9 A;  2QMX A;  2REJ A;  2RC9 A;  3G3F A;  1H3D A;  3MWB A;  4DXU A;  3MPK A;  1IEJ A;  4OET A;  1JW5 A;  3LSX A;  4FEC A;  1J1N A;  2DQV A;  3D4C A;  1R9Q A;  2ZXT A;  1RYO A;  1H43 A;  1P1W A;  4F1V A;  3H6T A;  2H4I A;  4QF9 A;  4JSD A;  3B6T A;  1Y4T A;  4XKR A;  3G7W A;  4EQB A;  1MQG A;  4R2F A;  1BTJ A;  1N04 A;  2IA4 A;  3B6W A;  5I2K A;  1WVJ A;  1QUJ A;  1MXV A;  1Y3Q A;  3QAX A;  2ZNS A;  1DPP A;  2P2A A;  1MRP A;  3OXN A;  3QUF A;  3V5A A;  1I6Q A;  3FAS A;  4OWD A;  4KR5 A;  1NNF A;  1FQB A;  4MLQ A;  2ZMB A;  4C1U A;  5CRY A;  4ESW A;  4H1X A;  1LST A;  4POW A;  4LF3 C;  1SBP A;  4FJP A;  1S7Y A;  3KOS A;  3TZA A;  3N26 A;  1Y9U A;  2W7Y A;  4C1T A;  5I2N B;  4GXS B;  4KYE A;  3FJG A;  3FUZ A;  4BLA A;  5AA2 B;  5H8N A;  3TTR A;  3O29 A;  3LBS A;  5DVJ A;  1NMU A;  2XXV A;  2I0C A;  1XOC A;  2HAV A;  3WAE A;  3FVK A;  4DCY A;  3RN8 A;  5CMB A;  1OLA A;  5AA4 B;  1M5E A;  3IJO B;  4BDM A;  1B0L A;  1JET A;  1POT A;  4Q30 B;  3M8U A;  3VVD A;  4DLQ A;  1MDP 1;  2XXI A;  1D4N A;  3FXU A;  1FTL A;  3MUQ A;  4P11 A;  3U1O A;  1N3W A;  3TCG A;  1MM7 A;  2OBG A;  4OFJ A;  1FTJ A;  3O28 A;  2D3I A;  1JW1 A;  3OSR A;  4RA1 A;  1D9V A;  2DVC A;  1P1Q A;  4QSD A;  2QKH A;  3IO4 A;  3OEN A;  3OEM A;  1PB9 A;  5JTY A;  3RT8 A;  3TQL A;  1N0T A;  1POY 1;  4OYV A;  1SVX B;  4NWC A;  2DXR A;  2ZNT A;  4JDF A;  1Y3P A;  3MVZ A;  3N7S A;  3ZKK A;  1UQW A;  2DP8 A;  2Z22 A;  4QFO A;  4JBZ A;  1AL3 A;  5AA1 A;  3VVF A;  3IO6 A;  1TWY A;  3TFL A;  1IUD A;  4BDO A;  3MVX A;  5TPA A;  4GQO A;  3RGY A;  1UIV A;  4NF8 B;  3THI A;  1NKX A;  3PPO A;  1SW1 A;  4MF3 A;  1LAF E;  3HN0 A;  4FED A;  1ZU0 A;  4KD5 A;  2DWJ A;  1SYH A;  1QUK A;  3T96 B;  1QKA A;  3TUS A;  2DWH A;  4JWO A;  2HZK A;  4ZE8 A;  3TCH A;  5DYH A;  4EUO A;  1B5I A;  4QHQ A;  1US5 A;  1GVC A;  3W15 C;  4OQO A;  1H76 A;  1SW2 A;  4HS7 A;  1M5D A;  3QYT A;  1LAG E;  4R6K A;  1B2H A;  5HPQ A;  3VLU A;  4YKJ A;  1M5F A;  5L9M A;  1GR2 A;  4H5F A;  4PET A;  1L5T A;  3C32 A;  2X26 A;  1T0K A;  4LON B;  4JB7 A;  3O6G A;  3DLN A;  2DS9 A;  2XHD A;  2X7Q A;  4GXA A;  3LC8 A;  4KPT A;  3SET A;  2H5Y A;  2ZYK A;  4R9G A;  4GRK A;  2PX1 A;  1MQH A;  4GD5 A;  1USY E;  5CMM A;  4KCC A;  2O84 X;  3FJM A;  1VSO A;  1UTB A;  2GFE A;  5L9S A;  5CC2 A;  4NF6 A;  1R9L A;  3MC2 A;  1ZIU A;  3WAF A;  4YIC A;  3T22 A;  3H7M A;  2ZYM A;  3IL1 B;  2XX8 A;  3DP4 A;  4H0W A;  3Q25 A;  3CRB A;  2NOO A;  1MXZ A;  3C36 A;  3TAJ A;  4QFN A;  2F36 A;  4OEV A;  3R7X A;  2O68 A;  4DZ1 A;  3OSQ A;  3RT6 B;  3DEL B;  2GHB A;  1EU8 A;  1JVX A;  5KCJ A;  3ODB A;  2HXW A;  2RC7 A;  3GBB A;  3B6Q A;  4U1O A;  4WXJ A;  4GL0 A;  3PV0 E;  4F19 A;  1N76 A;  1I6A A;  2I4C A;  2QS3 A;  4G68 C;  1UTH A;  4FEB A;  1IXG A;  1S50 A;  5H8N B;  2I4B A;  1B40 A;  1Y3N A;  1BP5 A;  2B65 A;  3TYH A;  1DMB A;  1Y1M A;  1ANF A;  1N7W A;  3FXQ A;  1DSN A;  2H99 A;  3IJX B;  3TDJ A;  4IY5 A;  2L27 A;  2V84 A;  1N3X A;  5ICQ A;  1SI1 A;  1A99 A;  1FQA A;  4RJZ A;  4H8I A;  3C59 A;  1MPB A;  2F7B A;  2Y84 A;  2QS1 A;  2UVH A;  2F35 A;  3IB1 A;  4LP2 B;  5I57 A;  4KFQ A;  4BDQ A;  2FA7 A;  2Q2A A;  1WOD A;  3C5T A;  4XXU A;  1ATG A;  3KSX A;  2JND A;  2P1S A;  1B6H A;  2OK2 A;  2DVZ A;  1VFD A;  2F6P A;  1I6B A;  5JTY B;  4H6D A;  1UIU A;  4O3B A;  2THI A;  2F8D A;  1B52 A;  4I62 A;  4ELR A;  5L9O A;  4N6P A;  3TCF A;  2GRV A;  2Y7K A;  1LFI A;  1CE2 A;  4OEU A;  3U92 A;  3OD7 A;  3O6H A;  3ONM A;  4NED A;  2AIX A;  1A54 A;  3ZSF A;  5CM6 A;  3FV2 A;  1XVX A;  3MAM A;  5TPA B;  4N07 A;  1D3K A;  3V83 A;  4F39 A;  5L8D A;  5DEX A;  1YCJ A;  2XX7 A;  4TLL B;  4RPN A;  3CFZ A;  5I56 B;  4E0X A;  2XXR A;  2V93 A;  1CB6 A;  1JEU A;  1ZKB A;  4ONY A;  4O3A A;  1SQY A;  3KBR A;  2Z23 A;  3N94 A;  3U93 A;  4UA8 A;  3PMX A;  2F97 A;  3ZKL A;  4AB6 A;  1I69 A;  3CFX A;  4QFP A;  3UN6 A;  3FAT A;  1MDQ A;  3DP8 A;  1LFG A;  4U22 A;  4GF8 A;  1OQG A;  3FVN A;  3PU5 A;  5DT6 A;  5HM4 B;  3A09 A;  3QUJ A;  2I3V A;  4DXC A;  2ESN A;  3VLV A;  2Z8F A;  2XD2 A;  3T9H B;  5JEI A;  3HST A;  5KDT A;  3I5O A;  4YB6 A;  4PFW A;  1Z7N E;  1B5H A;  5H8F B;  2WKY A;  3TQW A;  4RXL A;  4ERS A;  2UYF A;  1YAE A;  4PFY A;  1F9B A;  4R6Y A;  2Q8J A;  3W9W A;  4YMA A;  3S9M C;  2AYS A;  1HSL A;  5I59 A;  4DXB A;  1A8F A;  4IO5 A;  5I58 B;  1MG1 A;  1UTB B;  4HCY A;  4DLD A;  1LAH E;  1FQF A;  4P0I A;  3TEP A;  1P1U A;  4OZ9 A;  3I6V A;  4POX A;  3OEK A;  3QK6 A;  4I9D A;  4ELQ A;  4AQ4 A;  5ITP A;  4EQ7 A;  3BFT A;  1N7X A;  2VOZ A;  4EF2 A;  3S9N C;  3T9U A;  4RY1 A;  5DTB A;  2OJT A;  4WKM A;  2I58 A;  2XXW A;  4F3B A;  3F11 A;  5KCJ B;  4U1Z A;  3MZB A;  1B3H A;  3M3F A;  3U94 A;  2UVI A;  4EXL A;  4YKP A;  4F3S A;  4DIG A;  1UTH B;  3RQT A;  3S4U A;  4FIM A;  3KOT A;  1S9T A;  3K1M A;  4X1D A;  1NH8 A;  4FOR A;  3A3C A;  3TKD A;  1PB8 A;  4LAT A;  1BKA A;  5CBR A;  3K01 A;  1QKB A;  1MQI A;  3SEX A;  4KYD A;  5A5X A;  4ZDM A;  2DWI A;  4ESX A;  3PGF A;  1LLS A;  3PPP A;  3G3I A;  2V3U A;  4JWX A;  1B7Z A;  4G68 B;  1A40 A;  3EHT A;  4F3G A;  4LVQ A;  2H98 A;  3HHG A;  2A5T A;  3LSW A;  1DPE A;  5DVI A;  2LAO A;  4KYS A;  3R6U A;  3L6G A;  2ZYO A;  1FTM A;  3E3K A;  2JNC A;  4OEN A;  3K6X A;  3MP1 A;  2OZZ A;  1LBC A;  2XDG A;  3ILT B;  5B7D A;  4R75 A;  1NFT A;  1LCF A;  1JVY A;  3SKP A;  4DDD A;  1BIY A;  1VR5 A;  5FTH A;  3KFM A;  1MM6 A;  4F1Y A;  1SYI A;  1PBQ A;  4X9T A;  1IIW A;  1YPN A;  2D5W A;  4YB7 A;  3N7P A;  1Z7M E;  3FGS A;  3E13 X;  4MBP A;  4QFL A;  1OIB A;  1FTO A;  1B3F A;  3IAZ A;  2O1L A;  4OER A;  4I1D A;  3HO7 A;  3K6W A;  3TTK A;  4DLO A;  2B3B A;  5DEX B;  3PUX E;  4QRZ A;  5H8H A;  4L17 A;  5ELV A;  2I48 A;  4LQ2 A;  2ANJ A;  5BWJ A;  2KLF A;  4MH5 A;  2V25 A;  4NMY A;  3VXB A;  1VE4 A;  5J1D A;  4IO6 A;  3RNN A;  4MLV A;  1FCK A;  1OQH A;  4PE5 B;  2BJJ X;  3UIF A;  3CI8 A;  2NWJ A;  2Q2C A;  3KEI A;  3IB2 A;  1MY4 A;  1H45 A;  4OMB A;  4GLI A;  5DVF A;  3O2A A;  3CG1 A;  4ISU A;  1SW4 A;  2DE3 A;  3G3H A;  2VD3 A;  1SD3 A;  3EQ1 A;  1IXH A;  4KI0 E;  2G93 A;  1NL5 A;  5M2V A;  5KDT B;  2Y7W A;  4NWD A;  5AA3 A;  2XXU A;  3ILU B;  3FZV A;  3KN3 A;  3C34 A;  4TQU Q;  4KQP A;  1JW4 A;  1B51 A;  1PBP A;  1M5B A;  4U4S A;  1Y4C A;  3MQ9 A;  4R6H A;  1B4Z A;  4ZEF A;  2F78 A;  5I2K B;  2UXA A;  4OFO A;  4ECF A;  2F7C A;  5FHM A;  5JK4 A;  1ZLQ A;  3IOT A;  3H6U A;  4U4X A;  1NH7 A;  5F1Q A;  3H6W A;  4FAT A;  1FW0 A;  3M3K A;  4IGR A;  1MY1 A;  3TTM A;  5FHO A;  1GGG A;  2PBW A;  2QL3 A;  3VE1 B;  3LUY A;  4JXI A;  1URG A;  1IZ1 A;  1PDA A;  3CG3 A;  2QS4 A;  5TU0 A;  4F22 A;  3VV5 A;  4WED A;  4XTC Q;  4RPO A;  4EXK A;  1B5J A;  3A3U A;  1PEB A;  1M5C A;  4ELP A;  3VDF A;  4IO4 A;  1IQ7 A;  3U72 A;  2DYX A;  4G77 A;  4R73 A;  2REG A;  4G4P A;  4FE8 A;  2NVU B;  2Q9T A;  3BFU A;  1NNK A;  3JYR A;  1B3E A;  1DTG A;  5HBC A;  1MXW A;  4E0W A;  2VP1 A;  2PYY A;  3LSF B;  2OCU A;  3FVO A;  1O64 A;  4XKN A;  1LB8 A;  3TTL A;  4JWY A;  5AA2 A;  4NF5 A;  2O69 A;  3N6U A;  4K3F A;  3KSJ A;  3MJN A;  3PUW E;  3L6H A;  3H06 B;  4Z0I A;  3G3K A;  3N6T A;  2A5T B;  3VFJ A;  3DM0 A;  3HCQ A;  3KG2 A;  3CSG A;  3OMB A;  3I3V A;  3TTN A;  2PVU A;  3C33 A;  3MPL A;  3Q29 A;  2Y7R A;  3TMG A;  2E0S A;  4RNS A;  1B1H A;  2Y7I A;  3FVG A;  3C9H A;  1ZTY A;  5TP9 A;  4IY6 A;  2XXT A;  5CMC A;  3MVW A;  1R6Z A;  3RUM A;  4HW8 A;  3PMW A;  2Z8E A;  4X48 A;  3ZS6 A;  1XHY A;  2ZYN A;  4YAH X;  1MY3 A;  1MPD A;  1SI0 A;  1YTV A;  2JOD A;  4GFR A;  3OO6 A;  2XXX A;  2HZL A;  1B05 A;  2F7A A;  3N5L A;  3GLB A;  3RTF B;  2XXY A;  4YKK A;  3EN3 A;  3OO9 A;  3C35 A;  4BDN A;  4IO7 A;  2IEE A;  5H8H B;  2RF1 A;  1B9J A;  3IOW A;  1P1O A;  3HV1 A;  4NF8 A;  1AOV A;  2H25 A;  4GWO A;  3FJ7 A;  4QFK A;  2AL4 A;  3O9P A;  5EHS A;  4DCX A;  4LUB A;  5H8S A;  2OWT A;  1QJM A;  3OOA A;  4YZZ A;  3L2J A;  4OXV A;  3SEW A;  4BDR A;  3UA8 A;  4ZEC A;  4U21 A;  3VLW A;  4GL8 A;  1N84 A; 
#chains in the Genus database with same CATH topology
 2FYI A;  3FD3 A;  4QSE A;  2I3W A;  3GZG A;  1LCT A;  2X7P A;  3SDF A;  2VD2 A;  5K2Y A;  3K00 A;  4ZE9 A;  3V8X B;  5KZT A;  3G3J A;  1B4H A;  3OO7 A;  2UVJ A;  2F34 A;  1FQE A;  1D9Q A;  2PFZ A;  4KHZ E;  4PQJ A;  3O6I A;  4IB2 A;  3MP8 A;  3K4U A;  4H65 A;  5CMK A;  4LA9 A;  4Q5T A;  2PMS A;  2GH9 A;  4NF6 B;  4G8H A;  1A55 A;  2YLN A;  4IO3 A;  1US4 A;  2O7U A;  5II0 A;  3PUV E;  1O63 A;  5ITO A;  3Q27 A;  1NNT A;  2E1S A;  1ELJ A;  2O7I A;  1MS7 A;  2ALU A;  2Y7P A;  4PE3 A;  3RYD A;  2VHA A;  2DOJ A;  3O66 A;  4HJ0 A;  2R71 A;  4MFI A;  5EQA A;  2OWZ A;  4EDP A;  1NV5 A;  4GX6 A;  1IXI A;  1B58 A;  2QPQ A;  3KN8 A;  4YMB A;  3T1B A;  4UAC A;  3PPN A;  1HSE A;  2L5V A;  3JV9 A;  3SEU A;  3O97 A;  5FHN A;  4X8R A;  4YKI A;  2FNC A;  1URD A;  3IOL A;  2HFB A;  4OFL A;  2RCB A;  4U23 A;  4NN3 A;  3C4M A;  4F2O A;  4IO2 A;  1IMF A;  2DSF A;  2ONS A;  3EHU A;  2RKM A;  3K6V A;  1Y1Z A;  1LBY A;  1BLF A;  1B46 A;  4ND9 A;  3MST A;  3VXC A;  1B3L A;  3H3G A;  3FIR A;  1FPJ A;  3GBA A;  3IFC A;  5BUU A;  3KZG A;  1SDX A;  1OVB A;  2R9J A;  1FQC A;  1MY0 A;  1TXF A;  4GVO A;  4OVJ A;  4NF5 B;  4H8J A;  3W9V A;  2JJK A;  2NXO A;  4OVR A;  3KN7 A;  4G2Z A;  2Q88 A;  2A5S A;  1ZBM A;  4O7M A;  3PUY E;  3CVG A;  2XXP A;  5I57 B;  4OVS A;  3FV1 A;  1MQJ A;  2CZL A;  1LFH A;  2OLB A;  3S2V A;  1EZP A;  4ZGM A;  2AL5 A;  5TP9 B;  1B3G A;  1A7L A;  4U2R A;  1MY2 A;  3MBP A;  3CSB A;  5AE4 A;  1RDX A;  2B3F A;  1URS A;  4N15 A;  2HEU A;  1TT1 A;  5EYF A;  3S9L C;  1EZO A;  1Q1K A;  2XA5 A;  3RPL B;  4I8C A;  5F24 A;  2YPN A;  1QUI A;  4ZEI A;  2QRY A;  2I6E A;  4WEP A;  2RC8 A;  3MZ1 A;  2XXK A;  4ZZE A;  1A8E A;  1ZJL A;  1B1X A;  3UGW A;  3SZP A;  3K02 A;  4OHN A;  3RPW A;  3PPQ A;  2PT2 A;  3GXA A;  4F29 A;  5B70 A;  2YJP A;  3IR1 A;  1B7U A;  1FPD A;  5FTI A;  2DE2 A;  3N7R A;  1KWH A;  4DE8 A;  1QUL A;  2QVU A;  4F3P A;  4PP0 A;  2QJE A;  5IAI A;  3FXB A;  3T93 B;  1LB9 A;  1P99 A;  5EQ9 A;  3UK4 A;  3MZ9 A;  4X1B A;  2ZNU A;  3TOD A;  4F1U A;  2DE4 A;  5F7V A;  3KC1 A;  2ABH A;  2O6A A;  5EQ8 A;  5ICT A;  1EZ9 A;  1FPB A;  3K1P A;  1DTZ A;  2VGQ A;  4ZEB A;  4NF4 A;  4Q8R A;  3S9E A;  4Z7E A;  1FTK A;  3HPI A;  5I56 A;  1NNP A;  4ZEK A;  5CI5 A;  4G8N A;  3IB0 A;  3T9V A;  5H8Q A;  3KJT A;  4GOT A;  4R9F A;  1XVY A;  1FTA A;  3T9X B;  4ZED A;  3PPR A;  4C0R A;  4EF1 A;  4M1V A;  3U8Q A;  2H9B A;  4AB5 A;  2CZI A;  4RK9 A;  2WYP A;  4NTL A;  1ZMG A;  3EHS A;  1OVT A;  4F2Q A;  3UOR A;  4PBQ A;  4FAJ A;  1B7H A;  2HAU A;  2FVZ A;  3FXR A;  4LQ5 A;  5IZ3 B;  2QSX A;  4R74 A;  3SES A;  2ONR A;  2WBB A;  3TPA A;  1KA1 A;  1RYX A;  1GTK A;  2D21 A;  2QMW A;  2Z8D A;  3E4R A;  1NV7 A;  3H6V A;  3QIM A;  1MPC A;  4XKP A;  3CR9 A;  4EQ9 A;  2O1M A;  4TLM B;  2M8C A;  1K9Y A;  4BDL A;  2V3T A;  5I59 B;  3OO8 A;  1LBB A;  3KBZ A;  3RLF E;  5H8F A;  3DP6 A;  4NAP A;  2RCA A;  3KGC A;  4HE0 A;  2XXH A;  4OVP A;  1OLC A;  2F5X A;  3U65 A;  1XT8 A;  4M4G A;  3C31 A;  3SEV A;  4OTE A;  1SW5 A;  3MP6 A;  2RIN A;  3M3L A;  1TFA A;  4JSO A;  3CIJ A;  3D4G A;  3EF7 A;  2QFL A;  1JQF A;  5I58 A;  1TFD A;  3K0V A;  4XIG Q;  5IKB A;  1JNF A;  2GHA A;  1IMC A;  2Q89 A;  3P7I A;  1IMA A;  1MQD A;  3KJ7 A;  2HCA A;  4XKQ A;  5IM2 A;  3IK6 B;  1USY H;  5ISU A;  1LGB C;  3H4Z A;  4HCW A;  3T66 A;  3RTW B;  3LR1 A;  3H03 A;  4GBW A;  3PUZ E;  3LSL A;  4PFT A;  2O51 A;  2XD3 A;  2UVG A;  1HSJ A;  2I0B A;  4N6K A;  2V4C A;  4THI A;  4OES A;  2UYE A;  1MH3 A;  3USD A;  2FHY A;  1AH5 A;  3FBP A;  4NF0 A;  4P0G A;  5ET8 A;  4GWY A;  2NUV A;  1FQD A;  2CMO A;  4LZ5 A;  1D9Y A;  2QS2 A;  4H5G A;  5AA2 D;  5A5X B;  4F31 B;  1VFE A;  1P1N A;  5I2N A;  2F6G A;  3B7D A;  1AMF A;  4MMP A;  2V3Q A;  3B8B A;  4RK2 A;  3MYU A;  1PB7 A;  1FBP A;  3E9X A;  1AIV A;  5CBS A;  3CFL A;  3IX1 A;  1MXY A;  2P0S A;  3Q26 A;  4H67 A;  2OWS A;  3IOR A;  3JZJ A;  4YU0 A;  4GWS A;  3BKI B;  1LAX A;  3E79 A;  3K1N A;  4PAK A;  1QW0 A;  3IOU A;  3MW0 A;  1QVS A;  1WDN A;  1XC1 A;  4IGT A;  2OX3 A;  1Y20 A;  4KCD A;  2F3D A;  3QSL A;  3RY3 A;  1EH3 A;  1RKM A;  4F18 A;  1DOT A;  5AA4 A;  4QSC A;  4LZ7 A;  3BBR A;  2HPG A;  2HQ0 A;  3AXF A;  3Q28 A;  4G68 A;  4YB5 A;  1O7T A;  4N81 A;  1JEV A;  4Q0C A;  4R2B A;  1U34 A;  3V89 B;  3EPE A;  1H44 A;  1OMP A;  2DXY A;  3G3G A;  1IXC A;  3HHF A;  3SEY A;  3QXM A;  1CNQ A;  5EHM A;  1II5 A;  3AQF B;  1R1N A;  1DBZ A;  4LZ8 A;  1MXU A;  3K6U A;  1MH4 A;  5ET5 A;  2XWK A;  3IOV A;  3R26 A;  3SER A;  1FPF A;  2I49 A;  4ZZA A;  3K2D A;  3PD8 A;  3OEL A;  4G8M A;  1FBH A;  2XX9 A;  2R6G E;  1FJ6 A;  3IFA A;  1MXX A;  5ET6 A;  4N13 A;  2VPN A;  2F3B A;  4O3C A;  4R72 A;  3ECR A;  3MVY A;  5I84 A;  3PMV A;  4ELO A;  2ONK E;  1NV6 A;  1XS5 A;  4TOZ A;  5K2X A;  3ISP A;  3VVE A;  4NE4 A;  1B0H A;  4JVD A;  1GV8 A;  4NF4 B;  3TEL A;  1IIT A;  2G29 A;  4RYA A;  4X04 A;  5LOM A;  5EYH A;  4PFU A;  3A29 A;  1FBF A;  2DWA A;  5H8Q B;  1FBC A;  4HTG A;  4GIZ A;  1Q35 A;  1FSA A;  4ZS9 A;  1PC3 A;  2B4M A;  3UP9 A;  4DI3 D;  2XXQ A;  4XFE A;  1B32 A;  2PT1 A;  4N91 A;  3PD9 A;  2ZZW A;  2QMX A;  2REJ A;  2RC9 A;  3G3F A;  1H3D A;  3MWB A;  4GWU A;  1G0H A;  4DXU A;  3MPK A;  1IEJ A;  4OET A;  1JW5 A;  1EYI A;  3LSX A;  4FEC A;  1J1N A;  2DQV A;  4G61 A;  3D4C A;  1R9Q A;  2ZXT A;  1RYO A;  5J16 A;  1H43 A;  1P1W A;  4F1V A;  3H6T A;  2H4I A;  4QF9 A;  4GX4 A;  4JSD A;  4NHB A;  3B6T A;  1Y4T A;  4N8G A;  4XKR A;  3G7W A;  4NGU A;  4EQB A;  1MQG A;  3BIG A;  4PFB A;  4PDH A;  5FBP A;  4R2F A;  1BTJ A;  1N04 A;  2IA4 A;  3B6W A;  5I2K A;  1WVJ A;  1QUJ A;  4DI4 B;  1MXV A;  1Y3Q A;  3QAX A;  2ZNS A;  1DPP A;  2P2A A;  1MRP A;  3OXN A;  3QUF A;  3V5A A;  1I6Q A;  3FAS A;  4OWD A;  4KR5 A;  1NNF A;  1FQB A;  4MLQ A;  4PGP A;  4N4U A;  2ZMB A;  4GWZ A;  4C1U A;  5CRY A;  4ESW A;  4H1X A;  1LST A;  4POW A;  4LF3 C;  4QBA A;  1SBP A;  4FJP A;  1S7Y A;  1INP A;  4AS4 A;  3KOS A;  3TZA A;  3N26 A;  4NG7 A;  1QGX A;  1Y9U A;  2W7Y A;  4C1T A;  5I2N B;  4JVC A;  4GXS B;  4KYE A;  2FIE A;  3FJG A;  3FUZ A;  4BLA A;  5AA2 B;  5H8N A;  3TTR A;  3O29 A;  3LBS A;  5DVJ A;  1NMU A;  2XXV A;  2I0C A;  1XOC A;  2HAV A;  3WAE A;  3FVK A;  1EYJ A;  4DCY A;  3RN8 A;  5CMB A;  1OLA A;  4NQ8 A;  5AA4 B;  1M5E A;  2XWI A;  3IJO B;  4BDM A;  1FPG A;  1B0L A;  1JET A;  1POT A;  4Q30 B;  3M8U A;  3VVD A;  4DLQ A;  1MDP 1;  2XXI A;  1D4N A;  3FXU A;  1FTL A;  3MUQ A;  4P11 A;  3BIH A;  4LN5 A;  3U1O A;  1N3W A;  3TCG A;  1MM7 A;  2OBG A;  4PTK A;  4OFJ A;  4N6D A;  1FTJ A;  3O28 A;  2D3I A;  1JW1 A;  3OSR A;  2GQ1 A;  4RA1 A;  1D9V A;  4PBH A;  4O94 A;  2DVC A;  1P1Q A;  4QSD A;  2QKH A;  3IO4 A;  3OEN A;  3OEM A;  1PB9 A;  5JTY A;  3RT8 A;  3TQL A;  1N0T A;  1POY 1;  4OYV A;  1SVX B;  4NWC A;  2DXR A;  2ZNT A;  4JDF A;  1Y3P A;  3MVZ A;  3N7S A;  3ZKK A;  2B4L A;  1UQW A;  2DP8 A;  2Z22 A;  2ZZX A;  4QFO A;  4JBZ A;  5I5P A;  1AL3 A;  2FBP A;  5AA1 A;  4MNI A;  3VVF A;  3IO6 A;  1TWY A;  4MIJ A;  3TFL A;  1NUW A;  1IUD A;  4BDO A;  3MVX A;  5TPA A;  4GQO A;  3RGY A;  1UIV A;  4OVQ A;  4NF8 B;  3THI A;  4PC9 A;  1NKX A;  3PPO A;  1SW1 A;  4MF3 A;  1LAF E;  3HN0 A;  4FED A;  1ZU0 A;  4KD5 A;  2DWJ A;  1SYH A;  1QUK A;  3T96 B;  4P47 A;  1QKA A;  3TUS A;  2DWH A;  2XWO A;  2HZK A;  4JWO A;  4ZE8 A;  3TCH A;  4GBV A;  5DYH A;  4EUO A;  1B5I A;  4PF6 A;  4UAB A;  2WX9 A;  4QHQ A;  1US5 A;  4HE1 A;  1GVC A;  2MKZ A;  4OVT A;  3W15 C;  4OQO A;  1H76 A;  1SW2 A;  2ZZV A;  4GX3 A;  2VPO A;  4HS7 A;  5ESY A;  1M5D A;  3QYT A;  1LAG E;  1NV1 A;  4R6K A;  1B2H A;  5HPQ A;  3VLU A;  2HXR A;  4OA4 A;  4YKJ A;  1M5F A;  5L9M A;  1GR2 A;  4H5F A;  4PET A;  1L5T A;  3C32 A;  2X26 A;  1T0K A;  4P1E A;  2XWV A;  4LON B;  4JB7 A;  3O6G A;  3DLN A;  4KXP A;  2DS9 A;  2XHD A;  2X7Q A;  4IR8 A;  4GXA A;  3LC8 A;  4KPT A;  5LTC A;  3SET A;  2H5Y A;  2Y5L A;  2ZYK A;  4R9G A;  4GRK A;  2PX1 A;  1MQH A;  4GD5 A;  1USY E;  5CMM A;  4KCC A;  2O84 X;  3FJM A;  1VSO A;  1UTB A;  2GFE A;  5L9S A;  5CC2 A;  4P1L A;  4PF8 A;  4NF6 A;  1R9L A;  3MC2 A;  1ZIU A;  3WAF A;  4YIC A;  3T22 A;  3H7M A;  2ZYM A;  3IL1 B;  2XX8 A;  3DP4 A;  2HHM A;  4H0W A;  3Q25 A;  3CRB A;  2NOO A;  1MXZ A;  3C36 A;  3TAJ A;  4QFN A;  3LV0 A;  2F36 A;  4OEV A;  3R7X A;  2O68 A;  4DZ1 A;  3OSQ A;  3RT6 B;  3DEL B;  2GHB A;  1EU8 A;  5LDZ A;  1JVX A;  5KCJ A;  3ODB A;  2HXW A;  2RC7 A;  3GBB A;  3CHG A;  3B6Q A;  4U1O A;  4WXJ A;  1DK4 A;  4GL0 A;  3PV0 E;  4F19 A;  1N76 A;  1I6A A;  2I4C A;  2QS3 A;  4G68 C;  1UTH A;  1BK4 A;  4FEB A;  4I3Y A;  4XF5 A;  1IXG A;  1S50 A;  3B50 A;  5H8N B;  2I4B A;  1NUZ A;  1B40 A;  1Y3N A;  1BP5 A;  2B65 A;  3TYH A;  1DMB A;  1Y1M A;  1ANF A;  1N7W A;  3FXQ A;  3D1R A;  1DSN A;  2H99 A;  3IJX B;  3TDJ A;  2P3N A;  4IY5 A;  2L27 A;  2V84 A;  1VDW A;  1FBG A;  1N3X A;  5ICQ A;  1SI1 A;  1A99 A;  1Q9D A;  1FQA A;  4RJZ A;  4H8I A;  3C59 A;  1MPB A;  2F7B A;  2Y84 A;  1LBV A;  1FPL A;  2QS1 A;  2UVH A;  2F35 A;  3QMF A;  3IB1 A;  4PAF A;  1FBD A;  1SPI A;  4LP2 B;  5I57 A;  4KFQ A;  4BDQ A;  2FA7 A;  2Q2A A;  1WOD A;  3C5T A;  4XXU A;  1ATG A;  4MNP A;  4HE2 A;  3T0J A;  3KSX A;  2JND A;  2P1S A;  1B6H A;  4FBP A;  2OK2 A;  2DVZ A;  1VFD A;  2F6P A;  1I6B A;  1LBW A;  4MX6 A;  5JTY B;  3RPL A;  4H6D A;  1UIU A;  4O3B A;  2THI A;  2F8D A;  4XEQ A;  2P3V A;  1B52 A;  4I62 A;  4ELR A;  5L9O A;  4N6P A;  3TCF A;  2GRV A;  2Y7K A;  1LFI A;  1CE2 A;  4OEU A;  3U92 A;  3OD7 A;  3O6H A;  3ONM A;  4NED A;  2AIX A;  1A54 A;  3ZSF A;  5CM6 A;  3FV2 A;  1XVX A;  3MAM A;  5TPA B;  4N07 A;  1D3K A;  3V83 A;  4F39 A;  5L8D A;  5DEX A;  1YCJ A;  2XX7 A;  4TLL B;  4RPN A;  3CFZ A;  5I56 B;  4E0X A;  1RDZ A;  2XXR A;  2V93 A;  1LBZ A;  1CB6 A;  1JEU A;  1ZKB A;  4PGN A;  4ONY A;  4O3A A;  1SQY A;  3KBR A;  2Z23 A;  3N94 A;  1XI6 A;  3U93 A;  4JVI A;  4UA8 A;  3PMX A;  2F97 A;  3ZKL A;  4AB6 A;  1I69 A;  3CFX A;  4QFP A;  1EYK A;  1NV3 A;  3UN6 A;  3FAT A;  1MDQ A;  3DP8 A;  1LFG A;  4U22 A;  4O7I A;  2CEY A;  1OQG A;  4GF8 A;  3FVN A;  4GWW A;  3PU5 A;  5DT6 A;  5HM4 B;  1AWB A;  3A09 A;  3QUJ A;  2I3V A;  4DXC A;  2ESN A;  3VLV A;  2Z8F A;  2XD2 A;  5DW8 A;  3T9H B;  3HST A;  5JEI A;  5KDT A;  3I5O A;  4YB6 A;  4PFW A;  4N17 A;  2Y5K A;  1Z7N E;  1B5H A;  2WKY A;  1NV2 A;  5H8F B;  3TQW A;  4RXL A;  5IZ3 A;  4P3L A;  4ERS A;  2UYF A;  1YAE A;  4PFY A;  1F9B A;  4R6Y A;  2Q74 A;  2Q8J A;  3W9W A;  4YMA A;  3S9M C;  2AYS A;  1HSL A;  5I59 A;  4DXB A;  4MJO A;  1A8F A;  2VT5 A;  4IO5 A;  3LUZ A;  5I58 B;  1DCU A;  1MG1 A;  1UTB B;  4HCY A;  4DLD A;  1LAH E;  1FQF A;  4P0I A;  4P8B A;  3TEP A;  5I3S A;  1P1U A;  4OZ9 A;  3I6V A;  2DDK A;  4POX A;  3OEK A;  3QK6 A;  4I9D A;  4PFI A;  4ELQ A;  4AQ4 A;  5ITP A;  4EQ7 A;  3BFT A;  1N7X A;  2VOZ A;  4EF2 A;  3S9N C;  1FPI A;  4H46 A;  1YXI A;  5T3J A;  3T9U A;  4RY1 A;  5DTB A;  2OJT A;  4WKM A;  2I58 A;  2XXW A;  4F3B A;  3F11 A;  5KCJ B;  4PAI A;  4U1Z A;  2CEX A;  3MZB A;  1B3H A;  3M3F A;  3U94 A;  2UVI A;  4EXL A;  4YKP A;  4F3S A;  4DIG A;  5IGA A;  1UTH B;  3RQT A;  3S4U A;  4FIM A;  3HFU A;  3KOT A;  1S9T A;  3K1M A;  4X1D A;  1NH8 A;  4FOR A;  3A3C A;  3TKD A;  1PB8 A;  4LAT A;  1BKA A;  3KC0 A;  5CBR A;  3K01 A;  1QKB A;  1MQI A;  3SEX A;  4KYD A;  5A5X A;  4ZDM A;  1FJ9 A;  1IME A;  2DWI A;  1RDY A;  4MNC A;  4ESX A;  3PGF A;  1LLS A;  4I3E A;  3PPP A;  3G3I A;  2V3U A;  4JWX A;  4NX1 A;  1NV0 A;  1B7Z A;  4G68 B;  1A40 A;  3EHT A;  4F3G A;  4LVQ A;  2H98 A;  3HHG A;  2A5T A;  3LSW A;  1DPE A;  5DVI A;  2LAO A;  4KYS A;  3R6U A;  3L6G A;  2ZYO A;  1FTM A;  3E3K A;  2Q8M A;  1NI9 A;  2JNC A;  4OEN A;  4AS5 A;  1FPK A;  3K6X A;  3MP1 A;  2OZZ A;  5EYG A;  1LBC A;  2XDG A;  4HXV A;  3ILT B;  5B7D A;  4R75 A;  1NFT A;  1LCF A;  1JVY A;  3SKP A;  3PTY A;  4DDD A;  1BIY A;  1VR5 A;  1FPE A;  5FTH A;  3KFM A;  1MM6 A;  4PFR A;  4F1Y A;  1SYI A;  1PBQ A;  2CZK A;  4X9T A;  1IIW A;  1YPN A;  4P56 A;  1YZ0 A;  2D5W A;  4YB7 A;  3N7P A;  1Z7M E;  3FGS A;  3E13 X;  4MBP A;  4PDD A;  4QFL A;  1OIB A;  5IZ1 A;  1FTO A;  1B3F A;  3IAZ A;  2O1L A;  4OER A;  4I1D A;  3HO7 A;  3K6W A;  3TTK A;  4DLO A;  2B3B A;  5DEX B;  3PUX E;  4QRZ A;  5H8H A;  4L17 A;  5ELV A;  2I48 A;  4LQ2 A;  2ANJ A;  5BWJ A;  2KLF A;  4MH5 A;  2V25 A;  4NMY A;  3VXB A;  1VE4 A;  5J1D A;  4IO6 A;  3RNN A;  4MLV A;  1FCK A;  5A5L A;  1OQH A;  1K9Z A;  4MAG A;  4PE5 B;  2BJJ X;  3UIF A;  3CI8 A;  2NWJ A;  2Q2C A;  3KEI A;  1NV4 A;  3IB2 A;  1MY4 A;  1H45 A;  2BJI A;  4OMB A;  2CZH A;  4GLI A;  5DVF A;  3O2A A;  3CG1 A;  4ISU A;  1SW4 A;  2DE3 A;  2FIX A;  3G3H A;  2VD3 A;  1SD3 A;  2WYK A;  3EQ1 A;  2WEF A;  1IXH A;  4KI0 E;  2G93 A;  1NL5 A;  5M2V A;  1IMB A;  5KDT B;  2Y7W A;  4NWD A;  5AA3 A;  2XXU A;  3ILU B;  3FZV A;  3KN3 A;  3C34 A;  1NUY A;  4TQU Q;  4KQP A;  1JW4 A;  1B51 A;  1PBP A;  4QXD A;  1M5B A;  4U4S A;  1Y4C A;  1FRP A;  3MQ9 A;  4R6H A;  1B4Z A;  4ZEF A;  1NUX A;  2F78 A;  5I2K B;  2UXA A;  4OFO A;  4ECF A;  2F7C A;  5FHM A;  5JK4 A;  1ZLQ A;  3IOT A;  3H6U A;  1G0I A;  4U4X A;  4PCD A;  4H45 A;  1JP4 A;  1NH7 A;  5F1Q A;  3H6W A;  4FAT A;  1FW0 A;  3EKI A;  3M3K A;  4IGR A;  1MY1 A;  3TTM A;  5FHO A;  1GGG A;  2PBW A;  2QL3 A;  2KR0 A;  3VE1 B;  3LUY A;  4JXI A;  3NOH A;  1URG A;  4O8M A;  1IZ1 A;  3ROJ A;  5ET7 A;  1PDA A;  3CG3 A;  5IZZ A;  2QS4 A;  5TU0 A;  4F22 A;  4MEV A;  3VV5 A;  4WED A;  4XTC Q;  4RPO A;  4EXK A;  1B5J A;  1LEV A;  3A3U A;  1PEB A;  1M5C A;  4ELP A;  3VDF A;  4IO4 A;  1IQ7 A;  3U72 A;  2DYX A;  4G77 A;  4R73 A;  2REG A;  4G4P A;  4FE8 A;  2NVU B;  2Q9T A;  3BFU A;  1NNK A;  3JYR A;  1B3E A;  1DTG A;  5HBC A;  1MXW A;  4E0W A;  2VP1 A;  2PYY A;  3LSF B;  2OCU A;  3FVO A;  1O64 A;  4XKN A;  1LB8 A;  3TTL A;  4JWY A;  5AA2 A;  2QVV A;  4NF5 A;  2O69 A;  3N6U A;  4K3F A;  3KSJ A;  3MJN A;  3PUW E;  3L6H A;  3H06 B;  4Z0I A;  3G3K A;  3N6T A;  2A5T B;  3VFJ A;  3DM0 A;  3HCQ A;  3KG2 A;  1KZ8 A;  3CSG A;  3OMB A;  3I3V A;  3TTN A;  2PCR A;  4GWX A;  2PVU A;  3C33 A;  3MPL A;  3Q29 A;  2Y7R A;  3TMG A;  1YYZ A;  2E0S A;  4RNS A;  1B1H A;  2Y7I A;  1IMD A;  3FVG A;  3C9H A;  1ZTY A;  5TP9 A;  4IY6 A;  2XXT A;  5CMC A;  3MVW A;  1FBE A;  1R6Z A;  3RUM A;  4HW8 A;  3PMW A;  2Z8E A;  4X48 A;  3ZS6 A;  1XHY A;  2R8T A;  2ZYN A;  4YAH X;  1MY3 A;  4MCO A;  1MPD A;  1SI0 A;  1YTV A;  2JOD A;  4GFR A;  3OO6 A;  2XXX A;  2HZL A;  2QVR A;  1B05 A;  2F7A A;  2PFY A;  2WBD A;  4N8Y A;  3N5L A;  3GLB A;  3RTF B;  2XXY A;  4MHF A;  4P9K A;  4YKK A;  3EN3 A;  3OO9 A;  3C35 A;  2KQZ A;  4BDN A;  1LBX A;  4IO7 A;  2IEE A;  5H8H B;  4I40 A;  3E78 A;  2RF1 A;  1B9J A;  3IOW A;  1P1O A;  3HV1 A;  5EQ7 A;  4NF8 A;  1AOV A;  2H25 A;  4GWO A;  3FJ7 A;  4QFK A;  2AL4 A;  3O9P A;  4OAN A;  5EHS A;  4DCX A;  4LUB A;  5H8S A;  1KA0 A;  2OWT A;  1QJM A;  3OOA A;  5I7I A;  4YZZ A;  3L2J A;  4OXV A;  3SEW A;  4BDR A;  3GYY A;  3UA8 A;  3VLW A;  4U21 A;  4ZEC A;  4GL8 A;  1N84 A; 
#chains in the Genus database with same CATH homology
 2FYI A;  3FD3 A;  4QSE A;  2I3W A;  3GZG A;  1LCT A;  2X7P A;  3SDF A;  2VD2 A;  5K2Y A;  3K00 A;  4ZE9 A;  3V8X B;  5KZT A;  3G3J A;  1B4H A;  3OO7 A;  2UVJ A;  2F34 A;  1FQE A;  4KHZ E;  4PQJ A;  3O6I A;  4IB2 A;  3MP8 A;  3K4U A;  4H65 A;  5CMK A;  4LA9 A;  4Q5T A;  2PMS A;  2GH9 A;  4NF6 B;  4G8H A;  1A55 A;  2YLN A;  4IO3 A;  1US4 A;  2O7U A;  5II0 A;  3PUV E;  1O63 A;  5ITO A;  3Q27 A;  1NNT A;  2E1S A;  1ELJ A;  2O7I A;  1MS7 A;  2ALU A;  2Y7P A;  2VHA A;  2DOJ A;  3O66 A;  4HJ0 A;  2R71 A;  4MFI A;  4EDP A;  1IXI A;  1B58 A;  2QPQ A;  3KN8 A;  4YMB A;  4UAC A;  3PPN A;  1HSE A;  3JV9 A;  3SEU A;  3O97 A;  5FHN A;  4YKI A;  2FNC A;  1URD A;  3IOL A;  2HFB A;  4OFL A;  2RCB A;  4U23 A;  3C4M A;  4F2O A;  4IO2 A;  2DSF A;  2ONS A;  3K6V A;  3EHU A;  2RKM A;  1Y1Z A;  1BLF A;  1B46 A;  4ND9 A;  3VXC A;  1B3L A;  3H3G A;  3FIR A;  3GBA A;  5BUU A;  3KZG A;  1SDX A;  1OVB A;  2R9J A;  1FQC A;  1MY0 A;  1TXF A;  4GVO A;  4OVJ A;  4NF5 B;  4H8J A;  3W9V A;  2NXO A;  3KN7 A;  4G2Z A;  2Q88 A;  2A5S A;  1ZBM A;  3PUY E;  3CVG A;  2XXP A;  5I57 B;  3FV1 A;  1MQJ A;  2CZL A;  1LFH A;  2OLB A;  3S2V A;  1EZP A;  4ZGM A;  2AL5 A;  5TP9 B;  1B3G A;  1A7L A;  4U2R A;  1MY2 A;  3MBP A;  3CSB A;  5AE4 A;  2B3F A;  1URS A;  2HEU A;  1TT1 A;  5EYF A;  3S9L C;  1EZO A;  1Q1K A;  4I8C A;  2YPN A;  1QUI A;  4ZEI A;  2QRY A;  2I6E A;  4WEP A;  2RC8 A;  3MZ1 A;  4ZZE A;  1A8E A;  1ZJL A;  1B1X A;  3UGW A;  3K02 A;  4OHN A;  3RPW A;  3PPQ A;  2PT2 A;  3GXA A;  4F29 A;  5B70 A;  2YJP A;  3IR1 A;  1B7U A;  5FTI A;  2DE2 A;  3N7R A;  1KWH A;  4DE8 A;  1QUL A;  4F3P A;  4PP0 A;  2QJE A;  5IAI A;  3T93 B;  1LB9 A;  1P99 A;  3UK4 A;  3MZ9 A;  4X1B A;  2ZNU A;  3TOD A;  4F1U A;  2DE4 A;  5F7V A;  2ABH A;  2O6A A;  5ICT A;  1EZ9 A;  3K1P A;  1DTZ A;  2VGQ A;  4ZEB A;  4NF4 A;  4Q8R A;  3S9E A;  4Z7E A;  1FTK A;  3HPI A;  5I56 A;  1NNP A;  4ZEK A;  5CI5 A;  4G8N A;  3IB0 A;  3T9V A;  5H8Q A;  3KJT A;  4GOT A;  4R9F A;  1XVY A;  3T9X B;  4ZED A;  3PPR A;  4C0R A;  4EF1 A;  4M1V A;  3U8Q A;  2H9B A;  4AB5 A;  4RK9 A;  4NTL A;  1ZMG A;  3EHS A;  1OVT A;  4F2Q A;  4FAJ A;  3UOR A;  1B7H A;  2HAU A;  3FXR A;  4LQ5 A;  2QSX A;  4R74 A;  3SES A;  2ONR A;  3TPA A;  1RYX A;  1GTK A;  2D21 A;  2QMW A;  2Z8D A;  3E4R A;  3H6V A;  3QIM A;  1MPC A;  4XKP A;  3CR9 A;  4EQ9 A;  2O1M A;  4TLM B;  2M8C A;  4BDL A;  2V3T A;  5I59 B;  3OO8 A;  1LBB A;  3RLF E;  5H8F A;  3DP6 A;  2RCA A;  3KGC A;  2XXH A;  1OLC A;  2F5X A;  1XT8 A;  4M4G A;  3C31 A;  3SEV A;  4OTE A;  1SW5 A;  3MP6 A;  2RIN A;  3M3L A;  1TFA A;  4JSO A;  3CIJ A;  3D4G A;  3EF7 A;  1JQF A;  5I58 A;  1TFD A;  3K0V A;  4XIG Q;  5IKB A;  1JNF A;  2GHA A;  2Q89 A;  3P7I A;  1MQD A;  3KJ7 A;  2HCA A;  4XKQ A;  3IK6 B;  1USY H;  5ISU A;  1LGB C;  3H4Z A;  4HCW A;  3T66 A;  3RTW B;  3LR1 A;  3H03 A;  3PUZ E;  3LSL A;  4PFT A;  2O51 A;  2XD3 A;  2UVG A;  1HSJ A;  2I0B A;  4THI A;  4OES A;  2UYE A;  1MH3 A;  3USD A;  1AH5 A;  4P0G A;  2NUV A;  1FQD A;  2CMO A;  4LZ5 A;  1D9Y A;  2QS2 A;  4H5G A;  5AA2 D;  5A5X B;  4F31 B;  1VFE A;  1P1N A;  5I2N A;  2F6G A;  3B7D A;  1AMF A;  2V3Q A;  4RK2 A;  1PB7 A;  3E9X A;  1AIV A;  5CBS A;  3CFL A;  3IX1 A;  1MXY A;  2P0S A;  3Q26 A;  4H67 A;  2OWS A;  3IOR A;  3JZJ A;  4YU0 A;  3BKI B;  1LAX A;  3K1N A;  1QW0 A;  3IOU A;  3MW0 A;  1QVS A;  1WDN A;  1XC1 A;  4IGT A;  1Y20 A;  4KCD A;  3RY3 A;  3QSL A;  1EH3 A;  1RKM A;  4F18 A;  1DOT A;  5AA4 A;  4QSC A;  4LZ7 A;  3BBR A;  2HQ0 A;  3AXF A;  3Q28 A;  4G68 A;  4YB5 A;  1O7T A;  1JEV A;  4Q0C A;  4R2B A;  1U34 A;  3V89 B;  3EPE A;  1H44 A;  1OMP A;  2DXY A;  3G3G A;  1IXC A;  3HHF A;  3SEY A;  3QXM A;  5EHM A;  1II5 A;  3AQF B;  1R1N A;  4LZ8 A;  1MXU A;  3K6U A;  1MH4 A;  3IOV A;  3R26 A;  3SER A;  2I49 A;  4ZZA A;  3K2D A;  3PD8 A;  3OEL A;  4G8M A;  2XX9 A;  2R6G E;  1MXX A;  4N13 A;  4O3C A;  4R72 A;  3ECR A;  3MVY A;  5I84 A;  3PMV A;  4ELO A;  2ONK E;  1XS5 A;  4TOZ A;  5K2X A;  3VVE A;  4NE4 A;  1B0H A;  1GV8 A;  4NF4 B;  3TEL A;  1IIT A;  2G29 A;  4RYA A;  5LOM A;  4PFU A;  2DWA A;  5H8Q B;  4HTG A;  4GIZ A;  1Q35 A;  4ZS9 A;  1PC3 A;  3UP9 A;  2XXQ A;  1B32 A;  2PT1 A;  3PD9 A;  2QMX A;  2REJ A;  2RC9 A;  3G3F A;  1H3D A;  3MWB A;  4DXU A;  3MPK A;  1IEJ A;  4OET A;  1JW5 A;  3LSX A;  4FEC A;  1J1N A;  2DQV A;  3D4C A;  1R9Q A;  2ZXT A;  1RYO A;  1H43 A;  1P1W A;  4F1V A;  3H6T A;  2H4I A;  4QF9 A;  4JSD A;  3B6T A;  1Y4T A;  4XKR A;  3G7W A;  4EQB A;  1MQG A;  4R2F A;  1BTJ A;  1N04 A;  2IA4 A;  3B6W A;  5I2K A;  1WVJ A;  1QUJ A;  1MXV A;  1Y3Q A;  3QAX A;  2ZNS A;  1DPP A;  2P2A A;  1MRP A;  3OXN A;  3QUF A;  3V5A A;  1I6Q A;  3FAS A;  4OWD A;  4KR5 A;  1NNF A;  1FQB A;  4MLQ A;  2ZMB A;  4C1U A;  5CRY A;  4ESW A;  4H1X A;  1LST A;  4POW A;  4LF3 C;  1SBP A;  4FJP A;  1S7Y A;  3KOS A;  3TZA A;  3N26 A;  1Y9U A;  2W7Y A;  4C1T A;  5I2N B;  4GXS B;  4KYE A;  3FJG A;  3FUZ A;  4BLA A;  5AA2 B;  5H8N A;  3TTR A;  3O29 A;  3LBS A;  5DVJ A;  1NMU A;  2XXV A;  2I0C A;  1XOC A;  2HAV A;  3WAE A;  3FVK A;  4DCY A;  3RN8 A;  5CMB A;  1OLA A;  5AA4 B;  1M5E A;  3IJO B;  4BDM A;  1B0L A;  1JET A;  1POT A;  4Q30 B;  3M8U A;  3VVD A;  4DLQ A;  1MDP 1;  2XXI A;  1D4N A;  3FXU A;  1FTL A;  3MUQ A;  4P11 A;  3U1O A;  1N3W A;  3TCG A;  1MM7 A;  2OBG A;  4OFJ A;  1FTJ A;  3O28 A;  2D3I A;  1JW1 A;  3OSR A;  4RA1 A;  1D9V A;  2DVC A;  1P1Q A;  4QSD A;  2QKH A;  3IO4 A;  3OEN A;  3OEM A;  1PB9 A;  5JTY A;  3RT8 A;  3TQL A;  1N0T A;  1POY 1;  4OYV A;  1SVX B;  4NWC A;  2DXR A;  2ZNT A;  4JDF A;  1Y3P A;  3MVZ A;  3N7S A;  3ZKK A;  1UQW A;  2DP8 A;  2Z22 A;  4QFO A;  4JBZ A;  1AL3 A;  5AA1 A;  3VVF A;  3IO6 A;  1TWY A;  3TFL A;  1IUD A;  4BDO A;  3MVX A;  5TPA A;  4GQO A;  3RGY A;  1UIV A;  4NF8 B;  3THI A;  1NKX A;  3PPO A;  1SW1 A;  4MF3 A;  1LAF E;  3HN0 A;  4FED A;  1ZU0 A;  4KD5 A;  2DWJ A;  1SYH A;  1QUK A;  3T96 B;  1QKA A;  3TUS A;  2DWH A;  4JWO A;  2HZK A;  4ZE8 A;  3TCH A;  5DYH A;  4EUO A;  1B5I A;  4QHQ A;  1US5 A;  1GVC A;  3W15 C;  4OQO A;  1H76 A;  1SW2 A;  4HS7 A;  1M5D A;  3QYT A;  1LAG E;  4R6K A;  1B2H A;  5HPQ A;  3VLU A;  4YKJ A;  1M5F A;  5L9M A;  1GR2 A;  4H5F A;  4PET A;  1L5T A;  3C32 A;  2X26 A;  1T0K A;  4LON B;  4JB7 A;  3O6G A;  3DLN A;  2DS9 A;  2XHD A;  2X7Q A;  4GXA A;  3LC8 A;  4KPT A;  3SET A;  2H5Y A;  2ZYK A;  4R9G A;  4GRK A;  2PX1 A;  1MQH A;  4GD5 A;  1USY E;  5CMM A;  4KCC A;  2O84 X;  3FJM A;  1VSO A;  1UTB A;  2GFE A;  5L9S A;  5CC2 A;  4NF6 A;  1R9L A;  3MC2 A;  1ZIU A;  3WAF A;  4YIC A;  3T22 A;  3H7M A;  2ZYM A;  3IL1 B;  2XX8 A;  3DP4 A;  4H0W A;  3Q25 A;  3CRB A;  2NOO A;  1MXZ A;  3C36 A;  3TAJ A;  4QFN A;  2F36 A;  4OEV A;  3R7X A;  2O68 A;  4DZ1 A;  3OSQ A;  3RT6 B;  3DEL B;  2GHB A;  1EU8 A;  1JVX A;  5KCJ A;  3ODB A;  2HXW A;  2RC7 A;  3GBB A;  3B6Q A;  4U1O A;  4WXJ A;  4GL0 A;  3PV0 E;  4F19 A;  1N76 A;  1I6A A;  2I4C A;  2QS3 A;  4G68 C;  1UTH A;  4FEB A;  1IXG A;  1S50 A;  5H8N B;  2I4B A;  1B40 A;  1Y3N A;  1BP5 A;  2B65 A;  3TYH A;  1DMB A;  1Y1M A;  1ANF A;  1N7W A;  3FXQ A;  1DSN A;  2H99 A;  3IJX B;  3TDJ A;  4IY5 A;  2L27 A;  2V84 A;  1N3X A;  5ICQ A;  1SI1 A;  1A99 A;  1FQA A;  4RJZ A;  4H8I A;  3C59 A;  1MPB A;  2F7B A;  2Y84 A;  2QS1 A;  2UVH A;  2F35 A;  3IB1 A;  4LP2 B;  5I57 A;  4KFQ A;  4BDQ A;  2FA7 A;  2Q2A A;  1WOD A;  3C5T A;  4XXU A;  1ATG A;  3KSX A;  2JND A;  2P1S A;  1B6H A;  2OK2 A;  2DVZ A;  1VFD A;  2F6P A;  1I6B A;  5JTY B;  4H6D A;  1UIU A;  4O3B A;  2THI A;  2F8D A;  1B52 A;  4I62 A;  4ELR A;  5L9O A;  4N6P A;  3TCF A;  2GRV A;  2Y7K A;  1LFI A;  1CE2 A;  4OEU A;  3U92 A;  3OD7 A;  3O6H A;  3ONM A;  4NED A;  2AIX A;  1A54 A;  3ZSF A;  5CM6 A;  3FV2 A;  1XVX A;  3MAM A;  5TPA B;  4N07 A;  1D3K A;  3V83 A;  4F39 A;  5L8D A;  5DEX A;  1YCJ A;  2XX7 A;  4TLL B;  4RPN A;  3CFZ A;  5I56 B;  4E0X A;  2XXR A;  2V93 A;  1CB6 A;  1JEU A;  1ZKB A;  4ONY A;  4O3A A;  1SQY A;  3KBR A;  2Z23 A;  3N94 A;  3U93 A;  4UA8 A;  3PMX A;  2F97 A;  3ZKL A;  4AB6 A;  1I69 A;  3CFX A;  4QFP A;  3UN6 A;  3FAT A;  1MDQ A;  3DP8 A;  1LFG A;  4U22 A;  4GF8 A;  1OQG A;  3FVN A;  3PU5 A;  5DT6 A;  5HM4 B;  3A09 A;  3QUJ A;  2I3V A;  4DXC A;  2ESN A;  3VLV A;  2Z8F A;  2XD2 A;  3T9H B;  5JEI A;  3HST A;  5KDT A;  3I5O A;  4YB6 A;  4PFW A;  1Z7N E;  1B5H A;  5H8F B;  2WKY A;  3TQW A;  4RXL A;  4ERS A;  2UYF A;  1YAE A;  4PFY A;  1F9B A;  4R6Y A;  2Q8J A;  3W9W A;  4YMA A;  3S9M C;  2AYS A;  1HSL A;  5I59 A;  4DXB A;  1A8F A;  4IO5 A;  5I58 B;  1MG1 A;  1UTB B;  4HCY A;  4DLD A;  1LAH E;  1FQF A;  4P0I A;  3TEP A;  1P1U A;  4OZ9 A;  3I6V A;  4POX A;  3OEK A;  3QK6 A;  4I9D A;  4ELQ A;  4AQ4 A;  5ITP A;  4EQ7 A;  3BFT A;  1N7X A;  2VOZ A;  4EF2 A;  3S9N C;  3T9U A;  4RY1 A;  5DTB A;  2OJT A;  4WKM A;  2I58 A;  2XXW A;  4F3B A;  3F11 A;  5KCJ B;  4U1Z A;  3MZB A;  1B3H A;  3M3F A;  3U94 A;  2UVI A;  4EXL A;  4YKP A;  4F3S A;  4DIG A;  1UTH B;  3RQT A;  3S4U A;  4FIM A;  3KOT A;  1S9T A;  3K1M A;  4X1D A;  1NH8 A;  4FOR A;  3A3C A;  3TKD A;  1PB8 A;  4LAT A;  1BKA A;  5CBR A;  3K01 A;  1QKB A;  1MQI A;  3SEX A;  4KYD A;  5A5X A;  4ZDM A;  2DWI A;  4ESX A;  3PGF A;  1LLS A;  3PPP A;  3G3I A;  2V3U A;  4JWX A;  1B7Z A;  4G68 B;  1A40 A;  3EHT A;  4F3G A;  4LVQ A;  2H98 A;  3HHG A;  2A5T A;  3LSW A;  1DPE A;  5DVI A;  2LAO A;  4KYS A;  3R6U A;  3L6G A;  2ZYO A;  1FTM A;  3E3K A;  2JNC A;  4OEN A;  3K6X A;  3MP1 A;  2OZZ A;  1LBC A;  2XDG A;  3ILT B;  5B7D A;  4R75 A;  1NFT A;  1LCF A;  1JVY A;  3SKP A;  4DDD A;  1BIY A;  1VR5 A;  5FTH A;  3KFM A;  1MM6 A;  4F1Y A;  1SYI A;  1PBQ A;  4X9T A;  1IIW A;  1YPN A;  2D5W A;  4YB7 A;  3N7P A;  1Z7M E;  3FGS A;  3E13 X;  4MBP A;  4QFL A;  1OIB A;  1FTO A;  1B3F A;  3IAZ A;  2O1L A;  4OER A;  4I1D A;  3HO7 A;  3K6W A;  3TTK A;  4DLO A;  2B3B A;  5DEX B;  3PUX E;  4QRZ A;  5H8H A;  4L17 A;  5ELV A;  2I48 A;  4LQ2 A;  2ANJ A;  5BWJ A;  2KLF A;  4MH5 A;  2V25 A;  4NMY A;  3VXB A;  1VE4 A;  5J1D A;  4IO6 A;  3RNN A;  4MLV A;  1FCK A;  1OQH A;  4PE5 B;  2BJJ X;  3UIF A;  3CI8 A;  2NWJ A;  2Q2C A;  3KEI A;  3IB2 A;  1MY4 A;  1H45 A;  4OMB A;  4GLI A;  5DVF A;  3O2A A;  3CG1 A;  4ISU A;  1SW4 A;  2DE3 A;  3G3H A;  2VD3 A;  1SD3 A;  3EQ1 A;  1IXH A;  4KI0 E;  2G93 A;  1NL5 A;  5M2V A;  5KDT B;  2Y7W A;  4NWD A;  5AA3 A;  2XXU A;  3ILU B;  3FZV A;  3KN3 A;  3C34 A;  4TQU Q;  4KQP A;  1JW4 A;  1B51 A;  1PBP A;  1M5B A;  4U4S A;  1Y4C A;  3MQ9 A;  4R6H A;  1B4Z A;  4ZEF A;  2F78 A;  5I2K B;  2UXA A;  4OFO A;  4ECF A;  2F7C A;  5FHM A;  5JK4 A;  1ZLQ A;  3IOT A;  3H6U A;  4U4X A;  1NH7 A;  5F1Q A;  3H6W A;  4FAT A;  1FW0 A;  3M3K A;  4IGR A;  1MY1 A;  3TTM A;  5FHO A;  1GGG A;  2PBW A;  2QL3 A;  3VE1 B;  3LUY A;  4JXI A;  1URG A;  1IZ1 A;  1PDA A;  3CG3 A;  2QS4 A;  5TU0 A;  4F22 A;  3VV5 A;  4WED A;  4XTC Q;  4RPO A;  4EXK A;  1B5J A;  3A3U A;  1PEB A;  1M5C A;  4ELP A;  3VDF A;  4IO4 A;  1IQ7 A;  3U72 A;  2DYX A;  4G77 A;  4R73 A;  2REG A;  4G4P A;  4FE8 A;  2NVU B;  2Q9T A;  3BFU A;  1NNK A;  3JYR A;  1B3E A;  1DTG A;  5HBC A;  1MXW A;  4E0W A;  2VP1 A;  2PYY A;  3LSF B;  2OCU A;  3FVO A;  1O64 A;  4XKN A;  1LB8 A;  3TTL A;  4JWY A;  5AA2 A;  4NF5 A;  2O69 A;  3N6U A;  4K3F A;  3KSJ A;  3MJN A;  3PUW E;  3L6H A;  3H06 B;  4Z0I A;  3G3K A;  3N6T A;  2A5T B;  3VFJ A;  3DM0 A;  3HCQ A;  3KG2 A;  3CSG A;  3OMB A;  3I3V A;  3TTN A;  2PVU A;  3C33 A;  3MPL A;  3Q29 A;  2Y7R A;  3TMG A;  2E0S A;  4RNS A;  1B1H A;  2Y7I A;  3FVG A;  3C9H A;  1ZTY A;  5TP9 A;  4IY6 A;  2XXT A;  5CMC A;  3MVW A;  1R6Z A;  3RUM A;  4HW8 A;  3PMW A;  2Z8E A;  4X48 A;  3ZS6 A;  1XHY A;  2ZYN A;  4YAH X;  1MY3 A;  1MPD A;  1SI0 A;  1YTV A;  2JOD A;  4GFR A;  3OO6 A;  2XXX A;  2HZL A;  1B05 A;  2F7A A;  3N5L A;  3GLB A;  3RTF B;  2XXY A;  4YKK A;  3EN3 A;  3OO9 A;  3C35 A;  4BDN A;  4IO7 A;  2IEE A;  5H8H B;  2RF1 A;  1B9J A;  3IOW A;  1P1O A;  3HV1 A;  4NF8 A;  1AOV A;  2H25 A;  4GWO A;  3FJ7 A;  4QFK A;  2AL4 A;  3O9P A;  5EHS A;  4DCX A;  4LUB A;  5H8S A;  2OWT A;  1QJM A;  3OOA A;  4YZZ A;  3L2J A;  4OXV A;  3SEW A;  4BDR A;  3UA8 A;  4ZEC A;  4U21 A;  3VLW A;  4GL8 A;  1N84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...