2PFRA

Human n-acetyltransferase 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
290
Chain Sequence
b'SDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase 2
publication title The Crystal Structure of Human N-acetyltransferase 2 in complex with CoA
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2140.20 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase fold 2pfrA00
2PFRA 3LNBA 4DMOA 2PQTA 2IJAA
chains in the Genus database with same CATH superfamily
3D9WA 4NV7A 4BGFA 4NV8A 4C5PA 4DMOA 2PQTA 4GUZA 1W6FA 2BSZA 2IJAA 2PFRA 1W4TA 3LTWA 4B55A 2VFCA 1GX3A 3LNBA 2VFBA 1W5RA
chains in the Genus database with same CATH topology
2PFRA 3LNBA 4DMOA 2PQTA 2IJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFR A;  3LNB A;  4DMO A;  2PQT A;  2IJA A; 
#chains in the Genus database with same CATH topology
 3D9W A;  4NV7 A;  4BGF A;  4NV8 A;  4C5P A;  4DMO A;  2PQT A;  4GUZ A;  1W6F A;  2BSZ A;  2IJA A;  2PFR A;  1W4T A;  3LTW A;  4B55 A;  2VFC A;  1GX3 A;  3LNB A;  2VFB A;  1W5R A; 
#chains in the Genus database with same CATH homology
 2PFR A;  3LNB A;  4DMO A;  2PQT A;  2IJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...