4BGFA

The 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
b'LDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
publication title Structure of arylamine N-acetyltransferase from Mycobacterium tuberculosis determined by cross-seeding with the homologous protein from M. marinum: triumph over adversity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 73
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4bgfA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4bgfA01
4B55A 1W5RA 1E2TA 2BSZA 4NV7A 4GUZA 2VFBA 4NV8A 2VFCA 4BGFA 1GX3A 3D9WA 1W6FA 3LTWA 4C5PA 1W4TA
chains in the Genus database with same CATH superfamily
4CPHA 4QNIA 1NDJA 2XKLA 2ZAGA 2JW1A 3PEDA 4KC8A 3RDOA 1A3YA 1SLGB 3VG7A 2AVIA 1YWAA 2RTOB 1MK5A 1LPJA 1SWAA 1XKIA 2Z4HA 4GGRA 4PJ2A 2VDFA 4NYRA 1FE3A 4FGIB 1LCWA 4RUUA 5LJDA 3TGAA 1KZWA 1ICMA 1VYOA 4EQAC 1JMZA 4GH7A 5F6ZA 2IZDB 2MM3A 1QY2A 2DJGA 3K3LA 4M6SA 4A60A 2OFMX 2AF5A 5HA0A 2OF9A 3RE6A 3TF6A 4YFQA 3V8UA 1G74A 3SZHA 4ARHA 3CWKA 2IZLB 5KHPA 1BRPA 1PBOA 3F6ZB 4LQZA 4Z27A 3BX8A 1EIOA 3U0DA 1XCAA 2PFRA 1ACDA 1FEMA 1GKAA 4TJZA 5FQ8E 2ASNX 4QYPA 3WJEA 1VWAB 1NGLA 4A8ZA 4AZPA 4IBAA 5BYPA 1QG5A 2RTEB 3DSZA 1EUOA 4TNNA 2CBSA 2KD2A 3S26A 4YMYA 4DQ4A 1LNMA 1Y52X 2JN3A 4O4UA 4YKOA 3FW5A 2LBAA 5HTEA 1KFFA 1PMPA 1LF7A 1ZRYA 1S44A 1SWFA 2VFCA 3B2KA 5F6BA 4WHIA 2RN4A 3APWA 2OVEA 4IB8A 5H9KA 3SLTA 4NV7A 5LJEA 4YBPA 3AKNA 1E2TA 2BSZA 2F73A 1VWQB 2BHVA 1Y53X 2BS5A 2CZTA 2OVSA 2RTMA 3BDRA 3OBLA 1AB0A 1HXZA 1S2PA 2BS6A 4GETA 4JHQA 3EMMA 3VG6A 1HMTA 1OPAA 1HMRA 1Y9TA 3EYCA 1IKEA 1VWGB 1JYJA 2CAMA 3HWEA 1KT4A 2R56A 1BWYA 1LCZA 2AT5X 4I95A 2RTHB 4GJVA 1MDCA 2C1QA 3KQ0A 2Q39A 3U03A 5D47A 1LELA 1B56A 3VE1A 1MX7A 4O4SA 5HA1A 5AQ6A 1T68X 3TGBA 2KT4B 5F58A 2RTKA 1OEEA 4ORWA 2HLVA 4B55A 1SRIA 4BBOA 4HWMA 3HWGA 1ZNLA 4CK4A 4Y59A 2L5PA 2PI3O 1NBXA 2IZEB 1LFOA 3CQNA 3T1DA 2MO5A 2Y32A 3E3CA 4NLIA 5D4AA 4JGLA 2A2GA 2X34A 3DTQA 3PQUA 1MOYA 5K68A 5LKFA 1HQQA 1SWGA 1VWLB 1SWCA 5DPQA 1SWEA 2RTRB 2RCQA 1EIIA 3WZOA 3EM0A 1N4JA 4U9CA 1PM1X 3NP1A 2RTNB 2WPUA 2FRSA 4HPAA 4NP1A 3AEHA 4TKBA 4GU8A 4YBUA 4BQUA 3FEKA 3NADA 3TGCA 1YWDA 3FYFA 3CBCA 2FGSA 1HQPA 3P6DA 2PY1A 3GAQA 1QABE 4CDDA 2I5VO 3ELZA 1VWRB 2GTLM 5BVSA 1D2UA 4EXZA 2ALLX 3S60A 4ZHGA 4QRLA 3ZW0B 1UZ2X 4EFGA 1VWBB 1EXSA 3NX2A 5HBSA 2QCBA 3BRNA 2X8TA 4LZVA 1SY1A 1W4TA 1GX8A 1JJXA 1ERBA 2HZQA 4NW4A 2UZ2A 4YCHA 4CPHB 1NQMA 1WBIA 4KC7A 1DZKA 4IB9A 4I60A 4OS8A 3FIQA 3APUA 4ZGUA 4BVMA 5D45A 3RKGA 1I05A 2X56A 3ZUIA 1N9YA 4PSQA 3MG5A 2HYSA 3ZW1A 5L8OA 1RAVA 1X8PA 2F01A 3WYQA 3KFGA 1BLRA 4QGVA 1DZMA 3HK1A 1SLFB 2FWVA 1SWTA 5EZ2A 3KVNA 3RY1A 3CQRA 1UREA 4ZH6A 2LA7A 2L68A 2QO5A 2WWPA 5F7GA 4ZHHA 1B4MA 2NNQA 2QMIA 3EW2A 2BT9A 1UYNX 2JGSA 2MF6A 1VYFA 1X71A 3B2JA 3HOLA 3STMX 3MX7A 2FS6A 1P6PA 1STSB 3IA8A 1YUPA 2CZUA 4CPEA 3RBYA 2RTPB 4BX6A 3O19A 4ALBA 2RTGB 3HWDA 4IRWA 4I9SA 3RWXA 2IZFB 3KFHA 4YFRA 5L8IA 1OPBA 1A18A 1ADLA 1SWJA 3C76X 3RDQA 3FA9A 5IXGA 3IFBA 3WVMA 2Q9SA 2FS7A 1SXUA 2X8FA 4YKMA 5HTDA 1KZXA 4I9RA 1QFTA 3EW1A 1U17A 2O62A 4CPIA 3HOEA 4YDBA 3CBSA 2YMSA 3RY2A 1QY1A 2WEWA 2FKGA 3FR4A 4GE1A 1WUBA 4IB7A 1LICA 4XMCA 3PECA 5FFHA 2LB6A 4Z28A 4U8UN 2W2FA 3HWFA 1GGLA 4FQBB 4CV7A 1SY0A 4XMGA 2EU7X 5DG4A 3P24A 5EEEA 3T2XA 4UU2A 1W6FA 2OL6O 3ELXA 1OSPO 4WFVA 5B3MO 5BVQA 2AH7X 1LCVA 2RCTA 4BJ8A 4BX7A 4R0BA 4Y5DA 5KIDA 1O1UA 1DZJA 3FW4A 2AKQA 4I3CA 1G5WA 1N9MA 2IZCB 4XMHA 3UEVA 4I3DA 5FAZA 4WFUA 2AMMX 4NLJA 1OEKA 4QGXA 4TKHA 1LIEA 2WUTA 4YFPA 2R73A 3WJGA 5B5FA 2DJFA 1SWLA 1BJ7A 1GX9A 1TXLA 2WEXA 1HMSA 4CDEA 1A2DA 1FTPA 1H91A 3FEPA 4CSBA 4NYQA 4COTA 4O4XA 4GDAA 1SMPI 1SXXA 4GGZA 2ACPX 1NP1A 2LBVA 5AJBA 4A1HA 4AW8A 3EBKA 1QFVA 3P6FA 3VG2A 1ICNA 4ZJ0A 3NPOA 1VPRA 3F9DA 3LTWA 5B2AO 2A8GA 3N91A 5HZ9A 1I06A 1BSYA 1KL4A 4DCBA 1VWEB 5FENA 3RSWA 3FR2A 1HBPA 2X4MA 4U46A 2RTQB 3PK2A 2ANSA 5LJHA 2JU3A 3LNBA 2FHNX 4ORSA 2RTAA 2OFAA 4HFOA 5CSEA 3STKA 2RA6A 4JNJA 1SA8A 2Y3EA 4GGTA 3ZI8A 2QM9A 3PPTA 5EDBA 3JQOA 5FQ7E 3AUMO 2FR2A 4GK9A 1ZNHA 2RD7C 4OS0A 4O3ZA 3EBWA 1AVDA 1VWIB 4Z2PA 2OY8A 4ES7A 2FR3A 3VU1A 2WSJA 4TQ2A 5B29A 1YP7A 1X8OA 1EPAA 3AKMA 3WXQA 3C78X 3ZZVA 2BLGA 4O3WA 5HZ8A 2K23A 2HZRA 1X89A 2GH7A 5L8NA 4QYNA 1BRQA 1SWNA 2IZAA 3C77X 4Y0RA 4OEMA 1TVQA 2CM9A 3WZQA 3ZW1B 5IO7A 1ML7A 3BU1A 1SRJA 4GD9A 5D48A 4D6BA 1EW3A 1VYGA 1SREA 5KICA 1T0VA 1IW2A 1ERXA 2RTBB 3CR6A 3FA8A 2ZSCA 1E00A 3VG4A 1CBQA 1HN2A 1RXKA 3HPEA 1SY3A 3WBGA 4IAXA 2ZAIA 4HPBA 1NQNA 1EPBA 4AZMA 5EDCA 4AZNA 4MVIA 3B2IA 4IABA 1FENA 5H8TA 4D6AA 2X32A 1PEEA 4BX6B 3S5VA 1UYOX 3ZW2A 5IRUA 1NC9A 4EDEA 4WBKA 1LKEA 3RDXA 5IO6A 1SWHA 1A57A 4GJSA 5LJCA 1DF3A 4GDZA 4QQ1A 3WZPA 1GT5A 5IO5A 4TLJA 3F8AA 4YGGA 5H9AA 5CE4A 1BSOA 4ON1A 4YCEA 3WJDA 1MEPA 2NNEA 4FBVA 3MBTA 5HCEC 5LKEA 3ZQ3A 1QY0A 5B27A 1SRFA 3LHNA 1DFVA 2HNXA 3KFFA 4TKJA 4GNYA 1IKJA 1JMXA 2AT8X 3PP6A 3APXA 1K3BA 2QOSC 2RTFB 3RDSA 5IRWA 2QOMA 3FENA 1I04A 1GXAA 1OBUA 2IZHB 2KW1A 5B10O 2RQ0A 1EQDA 1IJ8A 2WQAE 3EC5A 4ORUA 4BX7B 5CYBA 3PDFA 2IZIA 4BCSA 1U18A 1GM6A 1TOUA 2MHDA 2OFRX 4O3YA 3UEXA 2QO4A 1SWDA 3MM0A 3PH5A 1KT7A 1VWPB 2OY1O 5F2BA 4ORRA 5LJKA 1KQXA 4MISA 4FBRA 1FELA 1ZNEA 2GTLO 2CM4A 3HTYA 1CBSA 1SRGA 3FA7A 1EALA 1Z24A 1VWCB 2N93A 3FMZA 4MEEA 4I3BA 3FDCA 1RSTB 4LKTA 4U8UM 3B2LA 1GT4A 2AT3X 2CBRA 2FT9A 1AELA 1SLDB 2G7BA 1VWMB 4Y0QA 4Y0PA 2LKKA 4YGHA 4BX5B 3APVA 5EEDA 1KT6A 3VG5A 3O2YA 1ZNGA 3D97A 4XMEA 2VFBA 1YP6A 4OKAA 1X8QA 3RDUA 1PTSA 1VWNB 2HKDA 2X46A 4KIIA 4CDCA 1BSQA 1HXLA 1ZNKA 2OL8O 2QO6A 5HAEA 4L1NA 2IJAA 1RXHA 1L6MA 1O1VA 2RTCB 1G85A 1HBQA 3T2WA 4OMXA 3S5XA 1SWPA 4ID2A 1BBPA 2OVAA 2W2AA 4EKVA 4RUNA 1X8NA 4O9SA 3PH6A 5HZQA 2X55A 1SXWA 2FKJA 1VWDB 2RTDB 3UEWA 1S7DA 3QKGA 1JJUA 4AZOA 2G79A 4KCAA 3B2HA 4GNWA 5H9NA 3WZNA 5AEOA 1I4UA 1TW4A 4ZH9A 2A2UA 3SAOA 2RTJA 2NP1A 3I0AA 1LIDA 2AT0X 4NNTA 3D4RA 1T8VA 4MVKA 2JU7A 3VHIA 2Q2PA 3L4RA 4DNEA 3JS1A 3P6HA 1JJJA 3U9PC 4C5PA 4O4OA 1I9HA 1N43A 1DZPA 1YIVA 2XSTA 2K62A 3NQ9A 2OF8A 4N7DA 4BX5A 1VWOB 1VWJB 2ACOA 1MVGA 2WQ9A 3BLGA 1RLBE 1X8UA 2GC9A 5B5GA 4GZVA 3OD9A 3Q6LA 3X00A 1O8VA 2IZGB 4MVEA 5D8JA 3CKGA 1D3SA 1OEJA 3BS2A 4AZQA 1AQBA 4ZFXA 2OVDA 1SWBA 3CMPA 2C4IA 4DMOA 3VPJE 2MWHA 3KZAA 4KT5A 3P6GA 3OE3A 1LIBA 4HPDA 2DM5A 3VE2A 1STPA 1GT1A 1DC9A 2KTSA 2OL7A 2X45A 2Y3FA 3FR5A 2IZJA 2Z4IA 1KOIA 1G7NA 1KT5A 4UU3A 1B0OA 2WR6A 1TOWA 4BGFA 2POAA 1IIUA 5AJCA 2M4LA 3FIDA 2Q4NA 3SLOA 5FQ6E 2A5BA 3QQ2A 1OBQA 3FLLA 4JO6A 4EEJA 3FA6A 4I6SA 4M7MA 1U0XA 3D9WA 5HZ5A 3JSQA 1E5PA 5HWZA 1MUPA 4MVLA 3D96A 1JYDA 4NNSA 3T6LA 4DQ3A 1FJ1E 1YWBA 5K06A 4HPCA 1RXJA 4NV8A 1GX3A 4GRJA 3ZUOA 4Z2VA 1R0UA 3SZJA 3TZSA 4LKPA 3P02A 3Q34A 4N7CA 4XMDA 2W2BA 1B8EA 1BEBA 1KT3A 2L67A 4MIRA 4ORYA 2Q2MA 4XMFA 4CPFA 1E06A 1Y55X 2FLJA 3NQKA 3MVFA 4ZCBA 1BM5A 2HMBA 1KL3A 1PBYA 5BVTA 5HCDC 1SRHA 2BC3A 5IRAA 4IB6A 2A3FX 5LJBA 1EI5A 3I17A 3NQ3A 3WJBA 4YDAA 2OZQA 4YH0A 5K67A 4L3RA 4ORXA 4ZHFA 1KGLA 2OY5O 2IZKA 2F09A 1SXYA 2RTIB 1JBHA 3LV4A 4ZR2A 1CBIA 4KH8A 2OY7A 3NBXX 1GT3A 2AT6X 2NNDA 2X8SA 3BU9A 1DF8A 1KL5A 1LDQA 1SLEB 1CBRA 1MM9A 2IFBA 4INNA 1CJ5A 4GKCA 1N0SA 4Z2OA 2RTLA 1LUQA 4QAEA 2G8CO 5HCCC 2KTDA 2OFBA 4BOEA 3G7XA 3OJYC 1SWQA 1JQPA 4ZHCA 2PQTA 4AYHA 1RSUB 1SWKA 3VHHA 1VWHB 5L3YA 1LDOA 1OBPA 1CRBA 4K19A 4O3XB 1SWOA 2MJIA 4YVBA 3SLJA 4IAWA 1FDQA 2JOZA 3NX1A 2IZBA 1JIWI 5EPQA 5F1EA 3H3IA 1IFCA 2JU8A 1ALBA 4IMNA 5CHKA 3SOTA 2OYBO 2E4JA 3STNA 1SWRA 1K24A 3FELA 1STRB 4OMWA 4LZUA 2A13A 4OELA 1SY2A 2C1SA 3CKFA 1SWSA 3WOVA 1JZUA 1AVEA 2I5ZO 1N7YA 3ZWEA 5HZ6A 4OS3A 4YGZA 3VGWA 2AL0X 1ZNDA 3P6CA 3WYPA 1HY2A 1QWDA 4ZGFA 5JR8A 1AVGI 4QZTA 3PQSA 2GTLN 3D95A 1KXOA 3UEUA 4AZRA 1KQWA 4ODDA 2GJ5A 2A0AA 1W5RA 2FTBA 3RE5A 2LFOA 1DV9A 5JD2A 3BY0A 4CDFA 3P6EA 2L9CA 4Z6JA 2JMBA 1I78A 4A1YA 2G78A 3RZYA 1QQSA 1VWKB 3BX7A 3WJFA 1LIFA 4GUZA 2UYWA 3RDMA 2FHLA 4ALOA 3SZIA 5C0NA 3UAQA 3NR3A 1SWUA 3VG3A 4Y0SA 1GKAB 5H9LA 1MX8A 1JV4A 1NP4A 2G5LA 1YWCA 3KFIA 3O22A 1IFBA 4IMOA 4QGWA 3BSZE 4QZUA 4ZHDA 1VWFB 3ZW0A 2P8GA 1E02A 2R74A 3VHMA 5LJGA 2A5CA 1Y9LA 3GE2A 2YG2A 4FBOA 1RBPA 4ML7B 4U8UO 3WJCA 5B11O 3T6FA 4U3QA 1Y0GA 2GTFX 4O49A
chains in the Genus database with same CATH topology
4BSQA 1CQDA 1CVZA 1NLJA 4QRXA 1POPA 2P86A 2F1GA 3U8EA 3D6SA 3H8CA 3QJ3A 2CIOA 1NB5A 5JA7A 1A6RA 2GFOA 5CHVA 1PPDA 4MSXA 1TU6A 4G54A 4Q8HA 4W5BA 4N79A 3H6SA 2IPPB 1U9XA 1YT7A 3IUTA 1Q6KA 4QH6A 2NQAA 4DMYA 4YYQA 1GECE 2BDZA 9PAPA 2FYEA 2VFCA 3WXGA 5EGWA 1O0EA 1YK8A 2R6NA 4NV7A 3KX1A 1E2TA 2BSZA 1Y08A 2PADA 1AU3A 4CDDB 2R9OA 1NL6A 1ICFA 5FPWA 4BPVA 1AYVA 1YVBA 2HHNA 4AXMA 1ZCMA 3QSDA 4B55A 3IV2A 2G7YA 4BS5A 1PPNA 3WXEA 1DF0A 1PADA 1KFXL 2E00A 3B79A 3KKUA 3ERVA 1MS6A 1AU4A 2DC7A 2P7UA 3OF8A 3HWNA 4KLBA 2AUZA 3MORA 2AIMA 1CPJA 1W4TA 1AYUA 3LFYA 1ME4A 1GMYA 3O0UA 4WA6A 1BP4A 3CBKA 3OF9A 2DJGB 3ZUAA 1PIPA 3IMAA 5EF4A 1NB3A 1PXVA 2FQ9A 1NPZA 1VJVA 4YV8A 3MTNA 3F5VA 1AU0A 1ITOA 4YYUA 1U9QX 1F2BA 4PADA 1KHPA 1QXPA 3K8UA 3BCNA 2G8EA 3H89A 2HXZA 3N4CA 1EWPA 3C9EA 1GLOA 3KW9A 1W6FA 1U9WA 3OVXA 4ZUXU 1EWMA 1KXRA 3N3KA 2FRQA 4I07A 7PCKA 3MHSA 1TL9A 1ATKA 3S3RA 2FT2A 4I04A 1MEGA 2Y5BA 2GHUA 5K16A 2NQDB 2P0RA 3PNRA 3IEJA 1TLOA 2AYNA 2PBHA 3KWZA 3LTWA 3OISA 2G6DA 3RVWA 2DZZA 2BDLA 4BQVA 1AIMA 1EWOA 2OZ2A 2AUXA 1QDQA 2YJ9A 1EWLA 4Q8GA 3P5VA 3KFQA 4RY2A 2XU3A 2AYOA 1FH0A 1U9VA 1YALA 4CZWA 3M99A 1BY8A 1YK7A 2XU5A 3KSEA 2B1MA 2G8JA 4OEMA 3BOWA 2DCBA 1F29A 5CHTA 2YJBA 2R9NA 3BPMA 2JQFR 3QT4A 1AYWA 2HD5A 3RVVA 1AECA 4P6EA 1CTEA 2FO5A 2ARYA 1MHWA 1QMYA 1CS8A 3TNXA 4P6GA 4XUIA 4K7CA 4MZSA 5F02A 4YYVA 2XU1A 3PDFA 4HWYA 1CB5A 2HH5A 2PNSA 4YYRA 3HHAA 1MIRA 1CSBB 2DJFB 3IOQA 3V6CA 4CDEB 4PP1A 2R9FA 1F2CA 2O6XA 2DCCA 4X6JA 1CV8A 4PI3A 2R9MA 2C0YA 1PPOA 1PCIA 2VFBA 1STFE 2FUDA 2OP3A 3K24A 3LXSA 3S3QA 3H7DA 3BC3A 2XU4A 2AVWA 1U5IA 2AU1A 5CVMA 5A24A 4QBBA 3CH2X 3PW3A 2DC9A 1S4VA 2FTDA 3F75A 4FK5A 1VSNA 3GCBA 3USVA 1F2AA 4C5PA 1PE6A 2YJCA 3P5UA 2F7DA 3BWKA 1MDWA 2VHFA 2R9CA 3I3TA 1THEA 2H7JA 1PBHA 1HUCB 1AU2A 4MZOA 1BGOA 4QRVA 3NHEA 3E1ZB 1KHQA 1PPPA 1ME3A 2DC6A 4BGFA 3K9MA 3IHPA 2WBFX 4YVAA 1ZIVA 2FRAA 4X6HA 3O1GA 2VHSA 2E02A 3D9WA 2ACTA 3P5XA 4FIPA 4DMXA 2DCAA 4I05A 1K3BB 3PBHA 4NV8A 2CB5A 1GX3A 2NQGA 1SNKA 1SP4B 3RVXA 2YJ2A 4YYSA 2OULA 3V6EA 1MEMA 8PCHA 4N4ZA 4AXLA 5JH3A 4N8WA 3CBJA 5CVNB 4BS6A 2JQGR 1XKGA 4YYWA 2NQIA 4CDFB 4CDCB 3KWBX 1JQPA 1CJLA 1X9YA 2PREA 2E01A 1BQIA 2YJ8A 2DCDA 1DEUA 4W5CA 5J94A 4FJCA 3P5WA 1M6DA 4OELA 4W4UA 3H8BA 3CH3X 2DC8A 2IBIA 5PADA 3HHIA 1W5RA 3MHHA 6PADA 3OVZA 1KFUL 4PP2E 4GUZA 2B1NA 3HD3A 1EF7A 4X6IA 3WXFA 2AS8A 1IWDA 3DF0A 3N3GA 4XR7A 1GCBA 2ATOA 3I06A 1QOLA 3BPFA 2E03A 1Y4HA 2DZYA 2Y6EA 4QRGA 3AI8A 1NQCA 5CVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B55 A;  1W5R A;  1E2T A;  2BSZ A;  4NV7 A;  4GUZ A;  2VFB A;  4NV8 A;  2VFC A;  4BGF A;  1GX3 A;  3D9W A;  1W6F A;  3LTW A;  4C5P A;  1W4T A; 
#chains in the Genus database with same CATH topology
 4CPH A;  4QNI A;  1NDJ A;  2XKL A;  2ZAG A;  2JW1 A;  3PED A;  4KC8 A;  3RDO A;  1A3Y A;  1SLG B;  3VG7 A;  2AVI A;  1YWA A;  2RTO B;  1MK5 A;  1LPJ A;  1SWA A;  1XKI A;  2Z4H A;  4GGR A;  4PJ2 A;  2VDF A;  4NYR A;  1FE3 A;  4FGI B;  1LCW A;  4RUU A;  5LJD A;  3TGA A;  1KZW A;  1ICM A;  1VYO A;  4EQA C;  1JMZ A;  4GH7 A;  5F6Z A;  2IZD B;  2MM3 A;  1QY2 A;  2DJG A;  3K3L A;  4M6S A;  4A60 A;  2OFM X;  2AF5 A;  5HA0 A;  2OF9 A;  3RE6 A;  3TF6 A;  4YFQ A;  3V8U A;  1G74 A;  3SZH A;  4ARH A;  3CWK A;  2IZL B;  5KHP A;  1BRP A;  1PBO A;  3F6Z B;  4LQZ A;  4Z27 A;  3BX8 A;  1EIO A;  3U0D A;  1XCA A;  2PFR A;  1ACD A;  1FEM A;  1GKA A;  4TJZ A;  5FQ8 E;  2ASN X;  4QYP A;  3WJE A;  1VWA B;  1NGL A;  4A8Z A;  4AZP A;  4IBA A;  5BYP A;  1QG5 A;  2RTE B;  3DSZ A;  1EUO A;  4TNN A;  2CBS A;  2KD2 A;  3S26 A;  4YMY A;  4DQ4 A;  1LNM A;  1Y52 X;  2JN3 A;  4O4U A;  4YKO A;  3FW5 A;  2LBA A;  5HTE A;  1KFF A;  1PMP A;  1LF7 A;  1ZRY A;  1S44 A;  1SWF A;  2VFC A;  3B2K A;  5F6B A;  4WHI A;  2RN4 A;  3APW A;  2OVE A;  4IB8 A;  5H9K A;  3SLT A;  4NV7 A;  5LJE A;  4YBP A;  3AKN A;  1E2T A;  2BSZ A;  2F73 A;  1VWQ B;  2BHV A;  1Y53 X;  2BS5 A;  2CZT A;  2OVS A;  2RTM A;  3BDR A;  3OBL A;  1AB0 A;  1HXZ A;  1S2P A;  2BS6 A;  4GET A;  4JHQ A;  3EMM A;  3VG6 A;  1HMT A;  1OPA A;  1HMR A;  1Y9T A;  3EYC A;  1IKE A;  1VWG B;  1JYJ A;  2CAM A;  3HWE A;  1KT4 A;  2R56 A;  1BWY A;  1LCZ A;  2AT5 X;  4I95 A;  2RTH B;  4GJV A;  1MDC A;  2C1Q A;  3KQ0 A;  2Q39 A;  3U03 A;  5D47 A;  1LEL A;  1B56 A;  3VE1 A;  1MX7 A;  4O4S A;  5HA1 A;  5AQ6 A;  1T68 X;  3TGB A;  2KT4 B;  5F58 A;  2RTK A;  1OEE A;  4ORW A;  2HLV A;  4B55 A;  1SRI A;  4BBO A;  4HWM A;  3HWG A;  1ZNL A;  4CK4 A;  4Y59 A;  2L5P A;  2PI3 O;  1NBX A;  2IZE B;  1LFO A;  3CQN A;  3T1D A;  2MO5 A;  2Y32 A;  3E3C A;  4NLI A;  5D4A A;  4JGL A;  2A2G A;  2X34 A;  3DTQ A;  3PQU A;  1MOY A;  5K68 A;  5LKF A;  1HQQ A;  1SWG A;  1VWL B;  1SWC A;  5DPQ A;  1SWE A;  2RTR B;  2RCQ A;  1EII A;  3WZO A;  3EM0 A;  1N4J A;  4U9C A;  1PM1 X;  3NP1 A;  2RTN B;  2WPU A;  2FRS A;  4HPA A;  4NP1 A;  3AEH A;  4TKB A;  4GU8 A;  4YBU A;  4BQU A;  3FEK A;  3NAD A;  3TGC A;  1YWD A;  3FYF A;  3CBC A;  2FGS A;  1HQP A;  3P6D A;  2PY1 A;  3GAQ A;  1QAB E;  4CDD A;  2I5V O;  3ELZ A;  1VWR B;  2GTL M;  5BVS A;  1D2U A;  4EXZ A;  2ALL X;  3S60 A;  4ZHG A;  4QRL A;  3ZW0 B;  1UZ2 X;  4EFG A;  1VWB B;  1EXS A;  3NX2 A;  5HBS A;  2QCB A;  3BRN A;  2X8T A;  4LZV A;  1SY1 A;  1W4T A;  1GX8 A;  1JJX A;  1ERB A;  2HZQ A;  4NW4 A;  2UZ2 A;  4YCH A;  4CPH B;  1NQM A;  1WBI A;  4KC7 A;  1DZK A;  4IB9 A;  4I60 A;  4OS8 A;  3FIQ A;  3APU A;  4ZGU A;  4BVM A;  5D45 A;  3RKG A;  1I05 A;  2X56 A;  3ZUI A;  1N9Y A;  4PSQ A;  3MG5 A;  2HYS A;  3ZW1 A;  5L8O A;  1RAV A;  1X8P A;  2F01 A;  3WYQ A;  3KFG A;  1BLR A;  4QGV A;  1DZM A;  3HK1 A;  1SLF B;  2FWV A;  1SWT A;  5EZ2 A;  3KVN A;  3RY1 A;  3CQR A;  1URE A;  4ZH6 A;  2LA7 A;  2L68 A;  2QO5 A;  2WWP A;  5F7G A;  4ZHH A;  1B4M A;  2NNQ A;  2QMI A;  3EW2 A;  2BT9 A;  1UYN X;  2JGS A;  2MF6 A;  1VYF A;  1X71 A;  3B2J A;  3HOL A;  3STM X;  3MX7 A;  2FS6 A;  1P6P A;  1STS B;  3IA8 A;  1YUP A;  2CZU A;  4CPE A;  3RBY A;  2RTP B;  4BX6 A;  3O19 A;  4ALB A;  2RTG B;  3HWD A;  4IRW A;  4I9S A;  3RWX A;  2IZF B;  3KFH A;  4YFR A;  5L8I A;  1OPB A;  1A18 A;  1ADL A;  1SWJ A;  3C76 X;  3RDQ A;  3FA9 A;  5IXG A;  3IFB A;  3WVM A;  2Q9S A;  2FS7 A;  1SXU A;  2X8F A;  4YKM A;  5HTD A;  1KZX A;  4I9R A;  1QFT A;  3EW1 A;  1U17 A;  2O62 A;  4CPI A;  3HOE A;  4YDB A;  3CBS A;  2YMS A;  3RY2 A;  1QY1 A;  2WEW A;  2FKG A;  3FR4 A;  4GE1 A;  1WUB A;  4IB7 A;  1LIC A;  4XMC A;  3PEC A;  5FFH A;  2LB6 A;  4Z28 A;  4U8U N;  2W2F A;  3HWF A;  1GGL A;  4FQB B;  4CV7 A;  1SY0 A;  4XMG A;  2EU7 X;  5DG4 A;  3P24 A;  5EEE A;  3T2X A;  4UU2 A;  1W6F A;  2OL6 O;  3ELX A;  1OSP O;  4WFV A;  5B3M O;  5BVQ A;  2AH7 X;  1LCV A;  2RCT A;  4BJ8 A;  4BX7 A;  4R0B A;  4Y5D A;  5KID A;  1O1U A;  1DZJ A;  3FW4 A;  2AKQ A;  4I3C A;  1G5W A;  1N9M A;  2IZC B;  4XMH A;  3UEV A;  4I3D A;  5FAZ A;  4WFU A;  2AMM X;  4NLJ A;  1OEK A;  4QGX A;  4TKH A;  1LIE A;  2WUT A;  4YFP A;  2R73 A;  3WJG A;  5B5F A;  2DJF A;  1SWL A;  1BJ7 A;  1GX9 A;  1TXL A;  2WEX A;  1HMS A;  4CDE A;  1A2D A;  1FTP A;  1H91 A;  3FEP A;  4CSB A;  4NYQ A;  4COT A;  4O4X A;  4GDA A;  1SMP I;  1SXX A;  4GGZ A;  2ACP X;  1NP1 A;  2LBV A;  5AJB A;  4A1H A;  4AW8 A;  3EBK A;  1QFV A;  3P6F A;  3VG2 A;  1ICN A;  4ZJ0 A;  3NPO A;  1VPR A;  3F9D A;  3LTW A;  5B2A O;  2A8G A;  3N91 A;  5HZ9 A;  1I06 A;  1BSY A;  1KL4 A;  4DCB A;  1VWE B;  5FEN A;  3RSW A;  3FR2 A;  1HBP A;  2X4M A;  4U46 A;  2RTQ B;  3PK2 A;  2ANS A;  5LJH A;  2JU3 A;  3LNB A;  2FHN X;  4ORS A;  2RTA A;  2OFA A;  4HFO A;  5CSE A;  3STK A;  2RA6 A;  4JNJ A;  1SA8 A;  2Y3E A;  4GGT A;  3ZI8 A;  2QM9 A;  3PPT A;  5EDB A;  3JQO A;  5FQ7 E;  3AUM O;  2FR2 A;  4GK9 A;  1ZNH A;  2RD7 C;  4OS0 A;  4O3Z A;  3EBW A;  1AVD A;  1VWI B;  4Z2P A;  2OY8 A;  4ES7 A;  2FR3 A;  3VU1 A;  2WSJ A;  4TQ2 A;  5B29 A;  1YP7 A;  1X8O A;  1EPA A;  3AKM A;  3WXQ A;  3C78 X;  3ZZV A;  2BLG A;  4O3W A;  5HZ8 A;  2K23 A;  2HZR A;  1X89 A;  2GH7 A;  5L8N A;  4QYN A;  1BRQ A;  1SWN A;  2IZA A;  3C77 X;  4Y0R A;  4OEM A;  1TVQ A;  2CM9 A;  3WZQ A;  3ZW1 B;  5IO7 A;  1ML7 A;  3BU1 A;  1SRJ A;  4GD9 A;  5D48 A;  4D6B A;  1EW3 A;  1VYG A;  1SRE A;  5KIC A;  1T0V A;  1IW2 A;  1ERX A;  2RTB B;  3CR6 A;  3FA8 A;  2ZSC A;  1E00 A;  3VG4 A;  1CBQ A;  1HN2 A;  1RXK A;  3HPE A;  1SY3 A;  3WBG A;  4IAX A;  2ZAI A;  4HPB A;  1NQN A;  1EPB A;  4AZM A;  5EDC A;  4AZN A;  4MVI A;  3B2I A;  4IAB A;  1FEN A;  5H8T A;  4D6A A;  2X32 A;  1PEE A;  4BX6 B;  3S5V A;  1UYO X;  3ZW2 A;  5IRU A;  1NC9 A;  4EDE A;  4WBK A;  1LKE A;  3RDX A;  5IO6 A;  1SWH A;  1A57 A;  4GJS A;  5LJC A;  1DF3 A;  4GDZ A;  4QQ1 A;  3WZP A;  1GT5 A;  5IO5 A;  4TLJ A;  3F8A A;  4YGG A;  5H9A A;  5CE4 A;  1BSO A;  4ON1 A;  4YCE A;  3WJD A;  1MEP A;  2NNE A;  4FBV A;  3MBT A;  5HCE C;  5LKE A;  3ZQ3 A;  1QY0 A;  5B27 A;  1SRF A;  3LHN A;  1DFV A;  2HNX A;  3KFF A;  4TKJ A;  4GNY A;  1IKJ A;  1JMX A;  2AT8 X;  3PP6 A;  3APX A;  1K3B A;  2QOS C;  2RTF B;  3RDS A;  5IRW A;  2QOM A;  3FEN A;  1I04 A;  1GXA A;  1OBU A;  2IZH B;  2KW1 A;  5B10 O;  2RQ0 A;  1EQD A;  1IJ8 A;  2WQA E;  3EC5 A;  4ORU A;  4BX7 B;  5CYB A;  3PDF A;  2IZI A;  4BCS A;  1U18 A;  1GM6 A;  1TOU A;  2MHD A;  2OFR X;  4O3Y A;  3UEX A;  2QO4 A;  1SWD A;  3MM0 A;  3PH5 A;  1KT7 A;  1VWP B;  2OY1 O;  5F2B A;  4ORR A;  5LJK A;  1KQX A;  4MIS A;  4FBR A;  1FEL A;  1ZNE A;  2GTL O;  2CM4 A;  3HTY A;  1CBS A;  1SRG A;  3FA7 A;  1EAL A;  1Z24 A;  1VWC B;  2N93 A;  3FMZ A;  4MEE A;  4I3B A;  3FDC A;  1RST B;  4LKT A;  4U8U M;  3B2L A;  1GT4 A;  2AT3 X;  2CBR A;  2FT9 A;  1AEL A;  1SLD B;  2G7B A;  1VWM B;  4Y0Q A;  4Y0P A;  2LKK A;  4YGH A;  4BX5 B;  3APV A;  5EED A;  1KT6 A;  3VG5 A;  3O2Y A;  1ZNG A;  3D97 A;  4XME A;  2VFB A;  1YP6 A;  4OKA A;  1X8Q A;  3RDU A;  1PTS A;  1VWN B;  2HKD A;  2X46 A;  4KII A;  4CDC A;  1BSQ A;  1HXL A;  1ZNK A;  2OL8 O;  2QO6 A;  5HAE A;  4L1N A;  2IJA A;  1RXH A;  1L6M A;  1O1V A;  2RTC B;  1G85 A;  1HBQ A;  3T2W A;  4OMX A;  3S5X A;  1SWP A;  4ID2 A;  1BBP A;  2OVA A;  2W2A A;  4EKV A;  4RUN A;  1X8N A;  4O9S A;  3PH6 A;  5HZQ A;  2X55 A;  1SXW A;  2FKJ A;  1VWD B;  2RTD B;  3UEW A;  1S7D A;  3QKG A;  1JJU A;  4AZO A;  2G79 A;  4KCA A;  3B2H A;  4GNW A;  5H9N A;  3WZN A;  5AEO A;  1I4U A;  1TW4 A;  4ZH9 A;  2A2U A;  3SAO A;  2RTJ A;  2NP1 A;  3I0A A;  1LID A;  2AT0 X;  4NNT A;  3D4R A;  1T8V A;  4MVK A;  2JU7 A;  3VHI A;  2Q2P A;  3L4R A;  4DNE A;  3JS1 A;  3P6H A;  1JJJ A;  3U9P C;  4C5P A;  4O4O A;  1I9H A;  1N43 A;  1DZP A;  1YIV A;  2XST A;  2K62 A;  3NQ9 A;  2OF8 A;  4N7D A;  4BX5 A;  1VWO B;  1VWJ B;  2ACO A;  1MVG A;  2WQ9 A;  3BLG A;  1RLB E;  1X8U A;  2GC9 A;  5B5G A;  4GZV A;  3OD9 A;  3Q6L A;  3X00 A;  1O8V A;  2IZG B;  4MVE A;  5D8J A;  3CKG A;  1D3S A;  1OEJ A;  3BS2 A;  4AZQ A;  1AQB A;  4ZFX A;  2OVD A;  1SWB A;  3CMP A;  2C4I A;  4DMO A;  3VPJ E;  2MWH A;  3KZA A;  4KT5 A;  3P6G A;  3OE3 A;  1LIB A;  4HPD A;  2DM5 A;  3VE2 A;  1STP A;  1GT1 A;  1DC9 A;  2KTS A;  2OL7 A;  2X45 A;  2Y3F A;  3FR5 A;  2IZJ A;  2Z4I A;  1KOI A;  1G7N A;  1KT5 A;  4UU3 A;  1B0O A;  2WR6 A;  1TOW A;  4BGF A;  2POA A;  1IIU A;  5AJC A;  2M4L A;  3FID A;  2Q4N A;  3SLO A;  5FQ6 E;  2A5B A;  3QQ2 A;  1OBQ A;  3FLL A;  4JO6 A;  4EEJ A;  3FA6 A;  4I6S A;  4M7M A;  1U0X A;  3D9W A;  5HZ5 A;  3JSQ A;  1E5P A;  5HWZ A;  1MUP A;  4MVL A;  3D96 A;  1JYD A;  4NNS A;  3T6L A;  4DQ3 A;  1FJ1 E;  1YWB A;  5K06 A;  4HPC A;  1RXJ A;  4NV8 A;  1GX3 A;  4GRJ A;  3ZUO A;  4Z2V A;  1R0U A;  3SZJ A;  3TZS A;  4LKP A;  3P02 A;  3Q34 A;  4N7C A;  4XMD A;  2W2B A;  1B8E A;  1BEB A;  1KT3 A;  2L67 A;  4MIR A;  4ORY A;  2Q2M A;  4XMF A;  4CPF A;  1E06 A;  1Y55 X;  2FLJ A;  3NQK A;  3MVF A;  4ZCB A;  1BM5 A;  2HMB A;  1KL3 A;  1PBY A;  5BVT A;  5HCD C;  1SRH A;  2BC3 A;  5IRA A;  4IB6 A;  2A3F X;  5LJB A;  1EI5 A;  3I17 A;  3NQ3 A;  3WJB A;  4YDA A;  2OZQ A;  4YH0 A;  5K67 A;  4L3R A;  4ORX A;  4ZHF A;  1KGL A;  2OY5 O;  2IZK A;  2F09 A;  1SXY A;  2RTI B;  1JBH A;  3LV4 A;  4ZR2 A;  1CBI A;  4KH8 A;  2OY7 A;  3NBX X;  1GT3 A;  2AT6 X;  2NND A;  2X8S A;  3BU9 A;  1DF8 A;  1KL5 A;  1LDQ A;  1SLE B;  1CBR A;  1MM9 A;  2IFB A;  4INN A;  1CJ5 A;  4GKC A;  1N0S A;  4Z2O A;  2RTL A;  1LUQ A;  4QAE A;  2G8C O;  5HCC C;  2KTD A;  2OFB A;  4BOE A;  3G7X A;  3OJY C;  1SWQ A;  1JQP A;  4ZHC A;  2PQT A;  4AYH A;  1RSU B;  1SWK A;  3VHH A;  1VWH B;  5L3Y A;  1LDO A;  1OBP A;  1CRB A;  4K19 A;  4O3X B;  1SWO A;  2MJI A;  4YVB A;  3SLJ A;  4IAW A;  1FDQ A;  2JOZ A;  3NX1 A;  2IZB A;  1JIW I;  5EPQ A;  5F1E A;  3H3I A;  1IFC A;  2JU8 A;  1ALB A;  4IMN A;  5CHK A;  3SOT A;  2OYB O;  2E4J A;  3STN A;  1SWR A;  1K24 A;  3FEL A;  1STR B;  4OMW A;  4LZU A;  2A13 A;  4OEL A;  1SY2 A;  2C1S A;  3CKF A;  1SWS A;  3WOV A;  1JZU A;  1AVE A;  2I5Z O;  1N7Y A;  3ZWE A;  5HZ6 A;  4OS3 A;  4YGZ A;  3VGW A;  2AL0 X;  1ZND A;  3P6C A;  3WYP A;  1HY2 A;  1QWD A;  4ZGF A;  5JR8 A;  1AVG I;  4QZT A;  3PQS A;  2GTL N;  3D95 A;  1KXO A;  3UEU A;  4AZR A;  1KQW A;  4ODD A;  2GJ5 A;  2A0A A;  1W5R A;  2FTB A;  3RE5 A;  2LFO A;  1DV9 A;  5JD2 A;  3BY0 A;  4CDF A;  3P6E A;  2L9C A;  4Z6J A;  2JMB A;  1I78 A;  4A1Y A;  2G78 A;  3RZY A;  1QQS A;  1VWK B;  3BX7 A;  3WJF A;  1LIF A;  4GUZ A;  2UYW A;  3RDM A;  2FHL A;  4ALO A;  3SZI A;  5C0N A;  3UAQ A;  3NR3 A;  1SWU A;  3VG3 A;  4Y0S A;  1GKA B;  5H9L A;  1MX8 A;  1JV4 A;  1NP4 A;  2G5L A;  1YWC A;  3KFI A;  3O22 A;  1IFB A;  4IMO A;  4QGW A;  3BSZ E;  4QZU A;  4ZHD A;  1VWF B;  3ZW0 A;  2P8G A;  1E02 A;  2R74 A;  3VHM A;  5LJG A;  2A5C A;  1Y9L A;  3GE2 A;  2YG2 A;  4FBO A;  1RBP A;  4ML7 B;  4U8U O;  3WJC A;  5B11 O;  3T6F A;  4U3Q A;  1Y0G A;  2GTF X;  4O49 A; 
#chains in the Genus database with same CATH homology
 4BSQ A;  1CQD A;  1CVZ A;  1NLJ A;  4QRX A;  1POP A;  2P86 A;  2F1G A;  3U8E A;  3D6S A;  3H8C A;  3QJ3 A;  2CIO A;  1NB5 A;  5JA7 A;  1A6R A;  2GFO A;  5CHV A;  1PPD A;  4MSX A;  1TU6 A;  4G54 A;  4Q8H A;  4W5B A;  4N79 A;  3H6S A;  2IPP B;  1U9X A;  1YT7 A;  3IUT A;  1Q6K A;  4QH6 A;  2NQA A;  4DMY A;  4YYQ A;  1GEC E;  2BDZ A;  9PAP A;  2FYE A;  2VFC A;  3WXG A;  5EGW A;  1O0E A;  1YK8 A;  2R6N A;  4NV7 A;  3KX1 A;  1E2T A;  2BSZ A;  1Y08 A;  2PAD A;  1AU3 A;  4CDD B;  2R9O A;  1NL6 A;  1ICF A;  5FPW A;  4BPV A;  1AYV A;  1YVB A;  2HHN A;  4AXM A;  1ZCM A;  3QSD A;  4B55 A;  3IV2 A;  2G7Y A;  4BS5 A;  1PPN A;  3WXE A;  1DF0 A;  1PAD A;  1KFX L;  2E00 A;  3B79 A;  3KKU A;  3ERV A;  1MS6 A;  1AU4 A;  2DC7 A;  2P7U A;  3OF8 A;  3HWN A;  4KLB A;  2AUZ A;  3MOR A;  2AIM A;  1CPJ A;  1W4T A;  1AYU A;  3LFY A;  1ME4 A;  1GMY A;  3O0U A;  4WA6 A;  1BP4 A;  3CBK A;  3OF9 A;  2DJG B;  3ZUA A;  1PIP A;  3IMA A;  5EF4 A;  1NB3 A;  1PXV A;  2FQ9 A;  1NPZ A;  1VJV A;  4YV8 A;  3MTN A;  3F5V A;  1AU0 A;  1ITO A;  4YYU A;  1U9Q X;  1F2B A;  4PAD A;  1KHP A;  1QXP A;  3K8U A;  3BCN A;  2G8E A;  3H89 A;  2HXZ A;  3N4C A;  1EWP A;  3C9E A;  1GLO A;  3KW9 A;  1W6F A;  1U9W A;  3OVX A;  4ZUX U;  1EWM A;  1KXR A;  3N3K A;  2FRQ A;  4I07 A;  7PCK A;  3MHS A;  1TL9 A;  1ATK A;  3S3R A;  2FT2 A;  4I04 A;  1MEG A;  2Y5B A;  2GHU A;  5K16 A;  2NQD B;  2P0R A;  3PNR A;  3IEJ A;  1TLO A;  2AYN A;  2PBH A;  3KWZ A;  3LTW A;  3OIS A;  2G6D A;  3RVW A;  2DZZ A;  2BDL A;  4BQV A;  1AIM A;  1EWO A;  2OZ2 A;  2AUX A;  1QDQ A;  2YJ9 A;  1EWL A;  4Q8G A;  3P5V A;  3KFQ A;  4RY2 A;  2XU3 A;  2AYO A;  1FH0 A;  1U9V A;  1YAL A;  4CZW A;  3M99 A;  1BY8 A;  1YK7 A;  2XU5 A;  3KSE A;  2B1M A;  2G8J A;  4OEM A;  3BOW A;  2DCB A;  1F29 A;  5CHT A;  2YJB A;  2R9N A;  3BPM A;  2JQF R;  3QT4 A;  1AYW A;  2HD5 A;  3RVV A;  1AEC A;  4P6E A;  1CTE A;  2FO5 A;  2ARY A;  1MHW A;  1QMY A;  1CS8 A;  3TNX A;  4P6G A;  4XUI A;  4K7C A;  4MZS A;  5F02 A;  4YYV A;  2XU1 A;  3PDF A;  4HWY A;  1CB5 A;  2HH5 A;  2PNS A;  4YYR A;  3HHA A;  1MIR A;  1CSB B;  2DJF B;  3IOQ A;  3V6C A;  4CDE B;  4PP1 A;  2R9F A;  1F2C A;  2O6X A;  2DCC A;  4X6J A;  1CV8 A;  4PI3 A;  2R9M A;  2C0Y A;  1PPO A;  1PCI A;  2VFB A;  1STF E;  2FUD A;  2OP3 A;  3K24 A;  3LXS A;  3S3Q A;  3H7D A;  3BC3 A;  2XU4 A;  2AVW A;  1U5I A;  2AU1 A;  5CVM A;  5A24 A;  4QBB A;  3CH2 X;  3PW3 A;  2DC9 A;  1S4V A;  2FTD A;  3F75 A;  4FK5 A;  1VSN A;  3GCB A;  3USV A;  1F2A A;  4C5P A;  1PE6 A;  2YJC A;  3P5U A;  2F7D A;  3BWK A;  1MDW A;  2VHF A;  2R9C A;  3I3T A;  1THE A;  2H7J A;  1PBH A;  1HUC B;  1AU2 A;  4MZO A;  1BGO A;  4QRV A;  3NHE A;  3E1Z B;  1KHQ A;  1PPP A;  1ME3 A;  2DC6 A;  4BGF A;  3K9M A;  3IHP A;  2WBF X;  4YVA A;  1ZIV A;  2FRA A;  4X6H A;  3O1G A;  2VHS A;  2E02 A;  3D9W A;  2ACT A;  3P5X A;  4FIP A;  4DMX A;  2DCA A;  4I05 A;  1K3B B;  3PBH A;  4NV8 A;  2CB5 A;  1GX3 A;  2NQG A;  1SNK A;  1SP4 B;  3RVX A;  2YJ2 A;  4YYS A;  2OUL A;  3V6E A;  1MEM A;  8PCH A;  4N4Z A;  4AXL A;  5JH3 A;  4N8W A;  3CBJ A;  5CVN B;  4BS6 A;  2JQG R;  1XKG A;  4YYW A;  2NQI A;  4CDF B;  4CDC B;  3KWB X;  1JQP A;  1CJL A;  1X9Y A;  2PRE A;  2E01 A;  1BQI A;  2YJ8 A;  2DCD A;  1DEU A;  4W5C A;  5J94 A;  4FJC A;  3P5W A;  1M6D A;  4OEL A;  4W4U A;  3H8B A;  3CH3 X;  2DC8 A;  2IBI A;  5PAD A;  3HHI A;  1W5R A;  3MHH A;  6PAD A;  3OVZ A;  1KFU L;  4PP2 E;  4GUZ A;  2B1N A;  3HD3 A;  1EF7 A;  4X6I A;  3WXF A;  2AS8 A;  1IWD A;  3DF0 A;  3N3G A;  4XR7 A;  1GCB A;  2ATO A;  3I06 A;  1QOL A;  3BPF A;  2E03 A;  1Y4H A;  2DZY A;  2Y6E A;  4QRG A;  3AI8 A;  1NQC A;  5CVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...