4BGFA

The 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
LDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of arylamine N-acetyltransferase from Mycobacterium tuberculosis determined by cross-seeding with the homologous protein from M. marinum: triumph over adversity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
total genus 73
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4bgfA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4bgfA01
1GX3A 4GUZA 4NV8A 2VFBA 2VFCA 1W6FA 3D9WA 1W5RA 3LTWA 4BGFA 4NV7A 4B55A 1W4TA 4C5PA 1E2TA 2BSZA
chains in the Genus database with same CATH superfamily
4UU3A 4YFPA 3AKMA 3T2XA 1G85A 1OSPO 1SWEA 2WSJA 2HZRA 2IZHB 4I3CA 4U46A 5BVTA 1G74A 3WYPA 1JJXA 1VWEB 4GH7A 1I04A 3ZW0A 1GT1A 4XMHA 2EU7X 2RTAA 4N7DA 3SZIA 1CBRA 2RTHB 2RTJA 2HNXA 5EZ2A 4C5PA 3VG7A 1LF7A 1EPAA 1A3YA 4O4SA 4COTA 3B2IA 4YKOA 1VWOB 2LBVA 1DZJA 4A60A 4BBOA 2BHVA 1SWKA 5L8NA 2X55A 3WJEA 2RCQA 3P24A 3RE5A 5KIDA 1SRFA 4IBAA 1NQMA 1KGLA 1VWAB 2Y3EA 4HPAA 3CKGA 2QMIA 4KCAA 4WFUA 2OY1O 2OF9A 2RQ0A 4CPEA 2LFOA 3VHIA 3RDMA 3T1DA 2C1QA 1SWBA 2Y3FA 1CJ5A 4INNA 1GT3A 4O4XA 1B8EA 2HKDA 2CZUA 1JV4A 4NNSA 1VWRB 1KT5A 2IZFB 3Q34A 1GKAA 2R56A 1VWQB 1KT3A 1AB0A 5IO5A 4U8UN 5F6BA 1BSOA 4ORRA 3DTQA 1YWBA 2WUTA 4GGTA 4IMOA 4FBRA 3P6FA 3ZZVA 1WBIA 3X00A 3I0AA 4O3WA 1W5RA 1SWDA 1BSQA 2F73A 1BWYA 1VWDB 1VYOA 1RSTB 3WJBA 4TLJA 4Z2OA 3D97A 1DF8A 1Y55X 2F09A 4IAXA 3ZQ3A 4GD9A 4ZHCA 4O49A 3EBKA 1ERXA 2X8FA 1ZRYA 4AZQA 3APXA 4Y0RA 2MO5A 1X71A 1TVQA 4EEJA 1SA8A 5FENA 4DQ3A 2Q2MA 1RAVA 1UYOX 2A5BA 1EIOA 4Z27A 3VU1A 1HMRA 4XMDA 1JMZA 1SWAA 5D4AA 1SWQA 3GAQA 3PPTA 4QYNA 1UZ2X 2IFBA 3D96A 4YFQA 4YGZA 3SLTA 5HZ8A 3WZOA 2OFBA 1X89A 4GU8A 5EEDA 2LBAA 4ID2A 3NPOA 3HTYA 1JBHA 1WUBA 1MM9A 2Z4HA 3P6HA 4U9CA 1SWCA 2FS7A 1ZNGA 3NQ9A 4NYQA 5JD2A 3WXQA 4K19A 3FR4A 1HQQA 4PJ2A 1VYFA 1HBQA 2A2GA 2RTLA 3ZW0B 4QAEA 1YWDA 2JN3A 2WWPA 1XKIA 3HWFA 5CHKA 3RDOA 4YVBA 4Z6JA 3AEHA 3VG6A 4QNIA 5EDCA 4ORXA 4O3ZA 1HMTA 2QCBA 3ZUIA 1OEJA 1K3BA 1KL3A 2HYSA 3CBCA 1PMPA 3JS1A 4ZHFA 2L68A 1AELA 3Q6LA 3B2LA 3HOLA 3HPEA 4CPIA 2FHLA 1KL5A 1SY1A 2A8GA 1VWLB 2VFBA 4MVKA 5KHPA 2G5LA 1VWHB 2X45A 1DF3A 4NYRA 3RY2A 1GGLA 1JMXA 1LIFA 2CBSA 1FJ1E 2W2AA 2FS6A 3CQNA 1N0SA 3P6CA 4ORYA 1DZPA 4Y59A 2IZCB 1SLGB 1ALBA 1PBOA 4TNNA 1QY2A 3PDFA 5AQ6A 1NC9A 2P8GA 3GE2A 2C4IA 4GUZA 4M6SA 1OEEA 2A2UA 3HWDA 3FENA 4ZHGA 1I78A 2OF8A 1IIUA 1T8VA 1TW4A 3KFHA 4XMEA 4BX7B 3RKGA 2AT8X 3D4RA 4LKTA 3P6EA 1JYJA 1LUQA 4O4OA 1LDQA 1FDQA 1VWJB 4NP1A 3HK1A 1Y9TA 2AH7X 3TGAA 4GJVA 4AZNA 1K24A 1Z24A 2I5ZO 4HFOA 5L8OA 2G8CO 4I3DA 1Y52X 1KT7A 1FENA 1STRB 1KT4A 3PK2A 5K06A 1Y9LA 4MISA 2RTKA 4DQ4A 1QQSA 3UEVA 3BDRA 4HPDA 4JNJA 2WEWA 1ZNKA 1GM6A 1U0XA 2AMMX 2RA6A 3HWGA 4PSQA 2IZKA 3RE6A 3SZHA 1GT4A 2BT9A 2N93A 2E4JA 4KIIA 5JR8A 1LNMA 5AJBA 1DV9A 2JMBA 2NNEA 3APUA 1NP1A 4GK9A 3WZQA 1ZNEA 2OY5O 1AQBA 2IZIA 1ML7A 1SXYA 2QOSC 2CZTA 1LCVA 1R0UA 2PY1A 2ZSCA 3FA7A 4GGRA 4ZHDA 1SWJA 2GH7A 2KD2A 1X8UA 4YDBA 4Y0PA 1PBYA 4AZOA 3FA6A 1NBXA 2I5VO 2OVAA 3FMZA 3FEKA 4IB9A 1L6MA 3LNBA 3FDCA 2F01A 4QQ1A 1YP6A 4ZH6A 2ZAIA 1T0VA 4DNEA 5IXGA 1SWHA 1LDOA 5DPQA 3RDQA 1N9YA 3P02A 4BX6A 4Z2VA 1DZKA 3WJCA 5IO7A 2X46A 4JO6A 1SMPI 3VE2A 3APWA 4ZR2A 2X32A 2ALLX 3MVFA 1AVDA 3ZW2A 1SWLA 1A2DA 2OFMX 1BJ7A 4GETA 4M7MA 2LB6A 5LKFA 1VWGB 4JHQA 1H91A 1LCZA 5BVQA 3T6LA 5B5GA 4TKHA 1QWDA 1S2PA 5B11O 4YMYA 1SLFB 4FBVA 2QO5A 3D9WA 5CYBA 2RTDB 2PFRA 4OS3A 1NDJA 2AF5A 5F58A 4EXZA 1E2TA 1QFTA 1A18A 1EQDA 3VGWA 1O1UA 3O2YA 5FQ7E 1D2UA 1LKEA 2X34A 5B10O 4I60A 1DFVA 2QO6A 1Y53X 3N91A 1ERBA 2BC3A 3FR2A 1RXKA 4XMFA 4AZPA 4GJSA 2MJIA 2XSTA 1VPRA 1N43A 2CM9A 2IZDB 4GE1A 4YBUA 3TGBA 3PQUA 4QZUA 4NV7A 4GDZA 3ELZA 4ZH9A 1EI5A 1ADLA 4CPFA 4BQUA 4YCEA 1LCWA 1SRIA 1TXLA 2W2FA 3C78X 5HZ9A 3OJYC 1RSUB 4BX5A 3UEXA 5F6ZA 5IRUA 1AVGI 1X8OA 5HCEC 4ZJ0A 1MK5A 1JYDA 2L9CA 2Z4IA 5KICA 3ZI8A 1SRGA 4HPBA 4IB7A 2HZQA 3P6DA 4YCHA 1KQXA 4ODDA 5IO6A 1SWPA 2GTFX 1GT5A 1EIIA 3PH5A 3WBGA 1N9MA 2OVDA 1E00A 4OMWA 4ZGUA 1D3SA 1MUPA 4DMOA 4AYHA 3IA8A 4I95A 4XMCA 1VWPB 4O3YA 1JJUA 1FTPA 3FIDA 1HXLA 1MEPA 2A3FX 2JU3A 1SXXA 2FR2A 4QYPA 2RTIB 1E06A 1Y0GA 2GTLO 2X8SA 3B2JA 2X8TA 3DSZA 4IB8A 2RTRB 4QRLA 5H9NA 2KW1A 2OVSA 2DJGA 3WJFA 2L67A 4CK4A 4BVMA 1LFOA 3RY1A 4DCBA 1QG5A 1STPA 2IZBA 4O3XB 2Q9SA 5HZ6A 1OPAA 2GTLN 2POAA 4YFRA 3F6ZB 1EUOA 2JGSA 5B3MO 3WVMA 1GKAB 3JSQA 4QGVA 2G79A 3MG5A 4GKCA 1JJJA 2FT9A 3OBLA 1SLDB 1SWGA 1G7NA 3VG2A 2WEXA 4OMXA 3U0DA 4KC8A 2RD7C 2PQTA 1KOIA 5LJGA 3EM0A 3VPJE 2X4MA 5K67A 2QO4A 3WZPA 4ORSA 2WQAE 3EBWA 3UEWA 1SLEB 3IFBA 1I05A 1SY2A 3G7XA 4QZTA 1ICNA 5IRAA 1MX7A 3K3LA 4GNWA 4OEMA 2OL6O 3FYFA 5EPQA 3MM0A 2OYBO 3NQKA 3SAOA 1HBPA 4CPHB 1YIVA 3O19A 1OBQA 2O62A 4AW8A 4YDAA 1HMSA 3B2HA 1E02A 2ACOA 2PI3O 4A1HA 3CWKA 2FLJA 3WJDA 4EQAC 1SY3A 4YGHA 4OS8A 5FAZA 5HA1A 3CQRA 3RBYA 4TQ2A 1QY0A 1KZXA 1SREA 4IABA 3EC5A 2M4LA 3S60A 1UYNX 1S44A 2JU7A 3FLLA 4ORWA 5F7GA 2BS6A 2W2BA 2HLVA 3JQOA 3S26A 1DZMA 2RTMA 4ML7B 1B56A 4ALBA 4ES7A 1JIWI 3KFIA 5LJEA 2RTCB 4GNYA 2FRSA 2RTPB 2ASNX 2CBRA 2QOMA 3BS2A 5B2AO 4CDCA 4OKAA 1HQPA 2IZEB 3V8UA 2RCTA 4HWMA 4R0BA 5LJCA 3C77X 5D47A 4KT5A 2ZAGA 5BVSA 2GTLM 2L5PA 3NR3A 2LKKA 1MVGA 3PECA 2Y32A 5F2BA 1ZNLA 3H3IA 3RDUA 3PQSA 1PM1X 1KFFA 4LZUA 1LIDA 2NNQA 3T6FA 1PEEA 3F8AA 3FA9A 1LIBA 1W4TA 1GXAA 3EYCA 2AVIA 1I06A 5C0NA 1EALA 3S5VA 4FGIB 2RTEB 5HTDA 2YG2A 4FBOA 2OVEA 3KQ0A 5LJKA 3TGCA 3BRNA 1ZNHA 2OFRX 4ORUA 3CMPA 3KFFA 3UEUA 4TKJA 2FKJA 3VHMA 5LKEA 3HWEA 4CSBA 1BRQA 1VWNB 1X8PA 2X56A 3PH6A 4U3QA 5CE4A 2DJFA 5AJCA 1PTSA 1A57A 4EFGA 3FELA 3PP6A 4D6AA 2KT4B 4LQZA 3STKA 4I9RA 3B2KA 1LICA 3WJGA 2G7BA 1KL4A 4IB6A 5D45A 3HOEA 1CBIA 1SWTA 3QKGA 4L3RA 1RLBE 1STSB 1SWRA 3PEDA 1FE3A 5IRWA 4BX6B 3ZW1A 4NLIA 1U18A 2WPUA 5B29A 1BBPA 3I17A 1SWSA 1VYGA 2LA7A 1BLRA 1VWBB 3NBXX 2G78A 4NNTA 3WOVA 1SXUA 5FQ8E 1IFCA 5EDBA 2AT5X 3RDSA 3RDXA 2IZJA 1GX3A 2NP1A 3AUMO 4O4UA 2A0AA 3TF6A 1MOYA 1TOUA 4BCSA 1FELA 1SRJA 1KXOA 2OL8O 3VG4A 1VWKB 1SXWA 1NQNA 4Z2PA 5FFHA 1E5PA 3CBSA 4TJZA 3TZSA 2CM4A 2MM3A 1VWCB 3BU9A 1CRBA 5K68A 4BX7A 5HZ5A 2WQ9A 5L3YA 2GC9A 1B0OA 1JQPA 4IMNA 5LJBA 4BJ8A 3KVNA 1AVEA 3LTWA 3VG5A 3STMX 3VE1A 1EPBA 1P6PA 2RTBB 1OEKA 2ANSA 2OY7A 1YUPA 1YWAA 4A1YA 5FQ6E 2RTNB 5HTEA 1SWFA 4D6BA 4ZHHA 4XMGA 4MVIA 1RBPA 3EW2A 2QM9A 2IJAA 1SWNA 3APVA 1TOWA 2GJ5A 4OS0A 1ZNDA 2IZLB 4NLJA 1SY0A 4GDAA 4KC7A 3C76X 4MVLA 3FA8A 4TKBA 3LHNA 5F1EA 1ICMA 5D48A 5B27A 4CV7A 2VDFA 3ZUOA 4EDEA 4YKMA 1LIEA 4ZFXA 1B4MA 1LELA 1EW3A 3BU1A 4IAWA 1KT6A 2YMSA 4JGLA 2HMBA 3QQ2A 5L8IA 4ON1A 1T68X 3CKFA 1FEMA 3LV4A 1OBUA 1W6FA 1N7YA 2KTDA 4RUNA 1QFVA 5HWZA 3L4RA 3RWXA 4YH0A 3SOTA 5EEEA 2MF6A 1BEBA 1SRHA 2OL7A 2UZ2A 3CR6A 2K62A 4NV8A 1IKEA 4IRWA 5DG4A 3BSZE 5H9AA 4BGFA 1BSYA 4LZVA 4YBPA 2R74A 1SWOA 3FW5A 3NP1A 1YWCA 5B5FA 4Y5DA 3EW1A 4BX5B 1U17A 3KFGA 1RXJA 4AZMA 1HXZA 4MIRA 3FW4A 4WFVA 3BX7A 3FIQA 2RTGB 5LJDA 4N7CA 3BY0A 3ZWEA 2RTQB 3NX2A 3OE3A 4I9SA 1I4UA 2JU8A 1IKJA 4MEEA 5H9LA 4A8ZA 5HZQA 3NADA 2KTSA 1MDCA 1OBPA 5HCCC 1RXHA 1SWUA 3O22A 3E3CA 1GX8A 3AKNA 1N4JA 1S7DA 4LKPA 1X8NA 3MBTA 4YGGA 3S5XA 1HY2A 5HBSA 4U8UM 3VHHA 3WYQA 1OPBA 1VWMB 1QY1A 5BYPA 2BLGA 2RTFB 3ELXA 4WBKA 4Y0QA 3U03A 1XCAA 4B55A 4KH8A 4ZGFA 3SLJA 4QGXA 3ZW1B 1NP4A 3NQ3A 2AT6X 5LJHA 1JZUA 4WHIA 2UYWA 1CBSA 2RTOB 1DC9A 2Q39A 3U9PC 2AL0X 3D95A 3T2WA 1IJ8A 5HA0A 4O9SA 2K23A 1KQWA 1X8QA 1I9HA 2WR6A 1IW2A 2VFCA 2FHNX 3MX7A 4EKVA 3UAQA 2MHDA 2Q2PA 4MVEA 4CDFA 2FTBA 4ZCBA 1GX9A 3SZJA 4UU2A 2JOZA 2MWHA 3FR5A 2AT3X 2JW1A 3OD9A 2AKQA 2FGSA 1BRPA 4NW4A 4RUUA 1G5WA 1VWFB 2DM5A 4CPHA 2OFAA 4Z28A 1ACDA 1QABE 2FWVA 3BLGA 3STNA 2OY8A 5H8TA 1KZWA 1YP7A 1HN2A 1O8VA 2OZQA 4L1NA 3WZNA 4ALOA 5HCDC 2AT0X 2IZGB 2BS5A 3RSWA 2NNDA 4GRJA 5HAEA 3BX8A 5CSEA 4I3BA 4CDDA 2IZAA 2RN4A 2BSZA 4CDEA 2ACPX 1NGLA 1VWIB 4FQBB 4GZVA 4QGWA 4Y0SA 3NX1A 1IFBA 1UREA 3FEPA 2XKLA 2A13A 3P6GA 4OELA 1LPJA 1O1VA 5AEOA 2Q4NA 1MX8A 1CBQA 2FR3A 3EMMA 3VG3A 2R73A 2FKGA 3F9DA 5H9KA 4AZRA 4HPCA 1EXSA 5D8JA 4BOEA 3KZAA 4I6SA 4U8UO 4GGZA 2C1SA 3SLOA 4ARHA 1BM5A 3RZYA 2CAMA 2A5CA
chains in the Genus database with same CATH topology
1KFUL 2DJGB 4Q8GA 4N79A 4MSXA 3RVWA 2AYNA 3B79A 1AU3A 5CVMA 1EWPA 2IBIA 2AYOA 1ZIVA 1BGOA 2P0RA 2YJCA 4C5PA 1ICFA 2FO5A 3U8EA 3IUTA 3H7DA 3CBJA 2XU5A 2AU1A 1BQIA 1TLOA 3BCNA 5K16A 3H8BA 3O1GA 1S4VA 2CIOA 1PPOA 2FUDA 3WXGA 3BPMA 4WA6A 4QH6A 1W5RA 1GECE 2JQGR 2Y5BA 1NB3A 2G8EA 2GHUA 2DC6A 1F29A 2DCBA 2OZ2A 1Q6KA 3GCBA 5PADA 1POPA 3BPFA 1STFE 4P6GA 1F2AA 4CZWA 1PPNA 2BDLA 2HD5A 2JQFR 4X6HA 3KWZA 4PI3A 1YVBA 2AIMA 1NLJA 1NB5A 3QT4A 4MZSA 3OVZA 1PIPA 3H6SA 5JH3A 1NQCA 4FK5A 1HUCB 1BP4A 2G8JA 2XU3A 4Q8HA 5CVNB 4BPVA 3WXFA 1AYUA 4I04A 4G54A 2VFBA 5F02A 2YJBA 4BS5A 3HD3A 2HXZA 4CDCB 1EWOA 4K7CA 3PDFA 1PADA 1EF7A 4GUZA 1QDQA 3BWKA 3P5WA 3V6EA 3OVXA 2NQGA 5J94A 3F75A 3MHSA 2P86A 3BOWA 2IPPB 2DC8A 2PREA 3RVXA 2C0YA 3PBHA 1K3BB 1MEMA 3USVA 2XU1A 1NPZA 2AUXA 2ACTA 1YK8A 3MORA 3M99A 3K24A 2FYEA 1A6RA 2O6XA 2YJ8A 4FIPA 9PAPA 4AXLA 3MHHA 3N3GA 1YK7A 2OULA 3IHPA 2CB5A 1KHQA 3D6SA 2YJ9A 1U5IA 1TL9A 4YV8A 8PCHA 1U9QX 2PBHA 2DJFB 3V6CA 1AU2A 1SNKA 5CVOB 5A24A 3D9WA 3NHEA 4W5CA 2GFOA 1E2TA 3IMAA 1GMYA 2FQ9A 3N4CA 4I05A 1MEGA 1Y08A 1ZCMA 2B1MA 2G7YA 1KFXL 2P7UA 2VHSA 4NV7A 2R9NA 4YYRA 2Y6EA 1GLOA 4QRVA 3PNRA 1YALA 3MTNA 4W5BA 3CBKA 4BQVA 3PW3A 1CQDA 1AYWA 5CHTA 4YYWA 3CH2X 1CS8A 2R9CA 3KX1A 2DCCA 3K9MA 1PCIA 4QBBA 1O0EA 2HH5A 2XU4A 1KXRA 2ATOA 1AU0A 1FH0A 4W4UA 2DZYA 4MZOA 4QRXA 1PPPA 2E00A 4BS6A 2F1GA 4ZUXU 2B1NA 3I06A 3KSEA 4YVAA 1YT7A 7PCKA 3H89A 1SP4B 2HHNA 2NQAA 1PBHA 2AUZA 4OEMA 3K8UA 2NQIA 2FT2A 4YYVA 1PPDA 3QJ3A 1VJVA 2PNSA 1QMYA 4I07A 1M6DA 3KKUA 1MDWA 2R6NA 1MHWA 1GCBA 4CDEB 2YJ2A 1W4TA 3OISA 2DC7A 2E02A 3HWNA 4PADA 4QRGA 4RY2A 4CDFB 4X6JA 1VSNA 5JA7A 3CH3X 3HHAA 1CV8A 1ME4A 2VHFA 3O0UA 2H7JA 5EF4A 3HHIA 1CVZA 4FJCA 1KHPA 1Y4HA 4BSQA 1BY8A 1ME3A 1ITOA 1AYVA 2FRQA 2R9FA 3LXSA 1GX3A 1ATKA 6PADA 3KW9A 3OF9A 3P5VA 1EWLA 3IOQA 1F2BA 3AI8A 1JQPA 3LTWA 1CSBB 3S3RA 3IV2A 1CB5A 3F5VA 4P6EA 3WXEA 4CDDB 1MIRA 3E1ZB 2NQDB 4HWYA 2E03A 1CJLA 4YYSA 2OP3A 2AVWA 3ZUAA 2DCAA 1W6FA 4DMXA 3TNXA 4XUIA 4YYQA 2E01A 4NV8A 4KLBA 4BGFA 3C9EA 1CPJA 2R9OA 2G6DA 1DEUA 4N4ZA 2PADA 3P5UA 1CTEA 3ERVA 1F2CA 4X6IA 1DF0A 1PXVA 1AIMA 5FPWA 3I3TA 3DF0A 1THEA 1PE6A 3S3QA 3BC3A 2F7DA 4B55A 5EGWA 1NL6A 3QSDA 4PP2E 1U9WA 3N3KA 2BDZA 1XKGA 3LFYA 4PP1A 1X9YA 4AXMA 2VFCA 5CHVA 3OF8A 2ARYA 1QOLA 2WBFX 2DC9A 3H8CA 1TU6A 3P5XA 2DZZA 1QXPA 1U9XA 1IWDA 4XR7A 1AU4A 3KWBX 1U9VA 2BSZA 2DCDA 1MS6A 1AECA 2FRAA 3RVVA 1EWMA 2FTDA 4N8WA 3KFQA 4OELA 2AS8A 4DMYA 4YYUA 3IEJA 2R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX3 A;  4GUZ A;  4NV8 A;  2VFB A;  2VFC A;  1W6F A;  3D9W A;  1W5R A;  3LTW A;  4BGF A;  4NV7 A;  4B55 A;  1W4T A;  4C5P A;  1E2T A;  2BSZ A; 
#chains in the Genus database with same CATH topology
 4UU3 A;  4YFP A;  3AKM A;  3T2X A;  1G85 A;  1OSP O;  1SWE A;  2WSJ A;  2HZR A;  2IZH B;  4I3C A;  4U46 A;  5BVT A;  1G74 A;  3WYP A;  1JJX A;  1VWE B;  4GH7 A;  1I04 A;  3ZW0 A;  1GT1 A;  4XMH A;  2EU7 X;  2RTA A;  4N7D A;  3SZI A;  1CBR A;  2RTH B;  2RTJ A;  2HNX A;  5EZ2 A;  4C5P A;  3VG7 A;  1LF7 A;  1EPA A;  1A3Y A;  4O4S A;  4COT A;  3B2I A;  4YKO A;  1VWO B;  2LBV A;  1DZJ A;  4A60 A;  4BBO A;  2BHV A;  1SWK A;  5L8N A;  2X55 A;  3WJE A;  2RCQ A;  3P24 A;  3RE5 A;  5KID A;  1SRF A;  4IBA A;  1NQM A;  1KGL A;  1VWA B;  2Y3E A;  4HPA A;  3CKG A;  2QMI A;  4KCA A;  4WFU A;  2OY1 O;  2OF9 A;  2RQ0 A;  4CPE A;  2LFO A;  3VHI A;  3RDM A;  3T1D A;  2C1Q A;  1SWB A;  2Y3F A;  1CJ5 A;  4INN A;  1GT3 A;  4O4X A;  1B8E A;  2HKD A;  2CZU A;  1JV4 A;  4NNS A;  1VWR B;  1KT5 A;  2IZF B;  3Q34 A;  1GKA A;  2R56 A;  1VWQ B;  1KT3 A;  1AB0 A;  5IO5 A;  4U8U N;  5F6B A;  1BSO A;  4ORR A;  3DTQ A;  1YWB A;  2WUT A;  4GGT A;  4IMO A;  4FBR A;  3P6F A;  3ZZV A;  1WBI A;  3X00 A;  3I0A A;  4O3W A;  1W5R A;  1SWD A;  1BSQ A;  2F73 A;  1BWY A;  1VWD B;  1VYO A;  1RST B;  3WJB A;  4TLJ A;  4Z2O A;  3D97 A;  1DF8 A;  1Y55 X;  2F09 A;  4IAX A;  3ZQ3 A;  4GD9 A;  4ZHC A;  4O49 A;  3EBK A;  1ERX A;  2X8F A;  1ZRY A;  4AZQ A;  3APX A;  4Y0R A;  2MO5 A;  1X71 A;  1TVQ A;  4EEJ A;  1SA8 A;  5FEN A;  4DQ3 A;  2Q2M A;  1RAV A;  1UYO X;  2A5B A;  1EIO A;  4Z27 A;  3VU1 A;  1HMR A;  4XMD A;  1JMZ A;  1SWA A;  5D4A A;  1SWQ A;  3GAQ A;  3PPT A;  4QYN A;  1UZ2 X;  2IFB A;  3D96 A;  4YFQ A;  4YGZ A;  3SLT A;  5HZ8 A;  3WZO A;  2OFB A;  1X89 A;  4GU8 A;  5EED A;  2LBA A;  4ID2 A;  3NPO A;  3HTY A;  1JBH A;  1WUB A;  1MM9 A;  2Z4H A;  3P6H A;  4U9C A;  1SWC A;  2FS7 A;  1ZNG A;  3NQ9 A;  4NYQ A;  5JD2 A;  3WXQ A;  4K19 A;  3FR4 A;  1HQQ A;  4PJ2 A;  1VYF A;  1HBQ A;  2A2G A;  2RTL A;  3ZW0 B;  4QAE A;  1YWD A;  2JN3 A;  2WWP A;  1XKI A;  3HWF A;  5CHK A;  3RDO A;  4YVB A;  4Z6J A;  3AEH A;  3VG6 A;  4QNI A;  5EDC A;  4ORX A;  4O3Z A;  1HMT A;  2QCB A;  3ZUI A;  1OEJ A;  1K3B A;  1KL3 A;  2HYS A;  3CBC A;  1PMP A;  3JS1 A;  4ZHF A;  2L68 A;  1AEL A;  3Q6L A;  3B2L A;  3HOL A;  3HPE A;  4CPI A;  2FHL A;  1KL5 A;  1SY1 A;  2A8G A;  1VWL B;  2VFB A;  4MVK A;  5KHP A;  2G5L A;  1VWH B;  2X45 A;  1DF3 A;  4NYR A;  3RY2 A;  1GGL A;  1JMX A;  1LIF A;  2CBS A;  1FJ1 E;  2W2A A;  2FS6 A;  3CQN A;  1N0S A;  3P6C A;  4ORY A;  1DZP A;  4Y59 A;  2IZC B;  1SLG B;  1ALB A;  1PBO A;  4TNN A;  1QY2 A;  3PDF A;  5AQ6 A;  1NC9 A;  2P8G A;  3GE2 A;  2C4I A;  4GUZ A;  4M6S A;  1OEE A;  2A2U A;  3HWD A;  3FEN A;  4ZHG A;  1I78 A;  2OF8 A;  1IIU A;  1T8V A;  1TW4 A;  3KFH A;  4XME A;  4BX7 B;  3RKG A;  2AT8 X;  3D4R A;  4LKT A;  3P6E A;  1JYJ A;  1LUQ A;  4O4O A;  1LDQ A;  1FDQ A;  1VWJ B;  4NP1 A;  3HK1 A;  1Y9T A;  2AH7 X;  3TGA A;  4GJV A;  4AZN A;  1K24 A;  1Z24 A;  2I5Z O;  4HFO A;  5L8O A;  2G8C O;  4I3D A;  1Y52 X;  1KT7 A;  1FEN A;  1STR B;  1KT4 A;  3PK2 A;  5K06 A;  1Y9L A;  4MIS A;  2RTK A;  4DQ4 A;  1QQS A;  3UEV A;  3BDR A;  4HPD A;  4JNJ A;  2WEW A;  1ZNK A;  1GM6 A;  1U0X A;  2AMM X;  2RA6 A;  3HWG A;  4PSQ A;  2IZK A;  3RE6 A;  3SZH A;  1GT4 A;  2BT9 A;  2N93 A;  2E4J A;  4KII A;  5JR8 A;  1LNM A;  5AJB A;  1DV9 A;  2JMB A;  2NNE A;  3APU A;  1NP1 A;  4GK9 A;  3WZQ A;  1ZNE A;  2OY5 O;  1AQB A;  2IZI A;  1ML7 A;  1SXY A;  2QOS C;  2CZT A;  1LCV A;  1R0U A;  2PY1 A;  2ZSC A;  3FA7 A;  4GGR A;  4ZHD A;  1SWJ A;  2GH7 A;  2KD2 A;  1X8U A;  4YDB A;  4Y0P A;  1PBY A;  4AZO A;  3FA6 A;  1NBX A;  2I5V O;  2OVA A;  3FMZ A;  3FEK A;  4IB9 A;  1L6M A;  3LNB A;  3FDC A;  2F01 A;  4QQ1 A;  1YP6 A;  4ZH6 A;  2ZAI A;  1T0V A;  4DNE A;  5IXG A;  1SWH A;  1LDO A;  5DPQ A;  3RDQ A;  1N9Y A;  3P02 A;  4BX6 A;  4Z2V A;  1DZK A;  3WJC A;  5IO7 A;  2X46 A;  4JO6 A;  1SMP I;  3VE2 A;  3APW A;  4ZR2 A;  2X32 A;  2ALL X;  3MVF A;  1AVD A;  3ZW2 A;  1SWL A;  1A2D A;  2OFM X;  1BJ7 A;  4GET A;  4M7M A;  2LB6 A;  5LKF A;  1VWG B;  4JHQ A;  1H91 A;  1LCZ A;  5BVQ A;  3T6L A;  5B5G A;  4TKH A;  1QWD A;  1S2P A;  5B11 O;  4YMY A;  1SLF B;  4FBV A;  2QO5 A;  3D9W A;  5CYB A;  2RTD B;  2PFR A;  4OS3 A;  1NDJ A;  2AF5 A;  5F58 A;  4EXZ A;  1E2T A;  1QFT A;  1A18 A;  1EQD A;  3VGW A;  1O1U A;  3O2Y A;  5FQ7 E;  1D2U A;  1LKE A;  2X34 A;  5B10 O;  4I60 A;  1DFV A;  2QO6 A;  1Y53 X;  3N91 A;  1ERB A;  2BC3 A;  3FR2 A;  1RXK A;  4XMF A;  4AZP A;  4GJS A;  2MJI A;  2XST A;  1VPR A;  1N43 A;  2CM9 A;  2IZD B;  4GE1 A;  4YBU A;  3TGB A;  3PQU A;  4QZU A;  4NV7 A;  4GDZ A;  3ELZ A;  4ZH9 A;  1EI5 A;  1ADL A;  4CPF A;  4BQU A;  4YCE A;  1LCW A;  1SRI A;  1TXL A;  2W2F A;  3C78 X;  5HZ9 A;  3OJY C;  1RSU B;  4BX5 A;  3UEX A;  5F6Z A;  5IRU A;  1AVG I;  1X8O A;  5HCE C;  4ZJ0 A;  1MK5 A;  1JYD A;  2L9C A;  2Z4I A;  5KIC A;  3ZI8 A;  1SRG A;  4HPB A;  4IB7 A;  2HZQ A;  3P6D A;  4YCH A;  1KQX A;  4ODD A;  5IO6 A;  1SWP A;  2GTF X;  1GT5 A;  1EII A;  3PH5 A;  3WBG A;  1N9M A;  2OVD A;  1E00 A;  4OMW A;  4ZGU A;  1D3S A;  1MUP A;  4DMO A;  4AYH A;  3IA8 A;  4I95 A;  4XMC A;  1VWP B;  4O3Y A;  1JJU A;  1FTP A;  3FID A;  1HXL A;  1MEP A;  2A3F X;  2JU3 A;  1SXX A;  2FR2 A;  4QYP A;  2RTI B;  1E06 A;  1Y0G A;  2GTL O;  2X8S A;  3B2J A;  2X8T A;  3DSZ A;  4IB8 A;  2RTR B;  4QRL A;  5H9N A;  2KW1 A;  2OVS A;  2DJG A;  3WJF A;  2L67 A;  4CK4 A;  4BVM A;  1LFO A;  3RY1 A;  4DCB A;  1QG5 A;  1STP A;  2IZB A;  4O3X B;  2Q9S A;  5HZ6 A;  1OPA A;  2GTL N;  2POA A;  4YFR A;  3F6Z B;  1EUO A;  2JGS A;  5B3M O;  3WVM A;  1GKA B;  3JSQ A;  4QGV A;  2G79 A;  3MG5 A;  4GKC A;  1JJJ A;  2FT9 A;  3OBL A;  1SLD B;  1SWG A;  1G7N A;  3VG2 A;  2WEX A;  4OMX A;  3U0D A;  4KC8 A;  2RD7 C;  2PQT A;  1KOI A;  5LJG A;  3EM0 A;  3VPJ E;  2X4M A;  5K67 A;  2QO4 A;  3WZP A;  4ORS A;  2WQA E;  3EBW A;  3UEW A;  1SLE B;  3IFB A;  1I05 A;  1SY2 A;  3G7X A;  4QZT A;  1ICN A;  5IRA A;  1MX7 A;  3K3L A;  4GNW A;  4OEM A;  2OL6 O;  3FYF A;  5EPQ A;  3MM0 A;  2OYB O;  3NQK A;  3SAO A;  1HBP A;  4CPH B;  1YIV A;  3O19 A;  1OBQ A;  2O62 A;  4AW8 A;  4YDA A;  1HMS A;  3B2H A;  1E02 A;  2ACO A;  2PI3 O;  4A1H A;  3CWK A;  2FLJ A;  3WJD A;  4EQA C;  1SY3 A;  4YGH A;  4OS8 A;  5FAZ A;  5HA1 A;  3CQR A;  3RBY A;  4TQ2 A;  1QY0 A;  1KZX A;  1SRE A;  4IAB A;  3EC5 A;  2M4L A;  3S60 A;  1UYN X;  1S44 A;  2JU7 A;  3FLL A;  4ORW A;  5F7G A;  2BS6 A;  2W2B A;  2HLV A;  3JQO A;  3S26 A;  1DZM A;  2RTM A;  4ML7 B;  1B56 A;  4ALB A;  4ES7 A;  1JIW I;  3KFI A;  5LJE A;  2RTC B;  4GNY A;  2FRS A;  2RTP B;  2ASN X;  2CBR A;  2QOM A;  3BS2 A;  5B2A O;  4CDC A;  4OKA A;  1HQP A;  2IZE B;  3V8U A;  2RCT A;  4HWM A;  4R0B A;  5LJC A;  3C77 X;  5D47 A;  4KT5 A;  2ZAG A;  5BVS A;  2GTL M;  2L5P A;  3NR3 A;  2LKK A;  1MVG A;  3PEC A;  2Y32 A;  5F2B A;  1ZNL A;  3H3I A;  3RDU A;  3PQS A;  1PM1 X;  1KFF A;  4LZU A;  1LID A;  2NNQ A;  3T6F A;  1PEE A;  3F8A A;  3FA9 A;  1LIB A;  1W4T A;  1GXA A;  3EYC A;  2AVI A;  1I06 A;  5C0N A;  1EAL A;  3S5V A;  4FGI B;  2RTE B;  5HTD A;  2YG2 A;  4FBO A;  2OVE A;  3KQ0 A;  5LJK A;  3TGC A;  3BRN A;  1ZNH A;  2OFR X;  4ORU A;  3CMP A;  3KFF A;  3UEU A;  4TKJ A;  2FKJ A;  3VHM A;  5LKE A;  3HWE A;  4CSB A;  1BRQ A;  1VWN B;  1X8P A;  2X56 A;  3PH6 A;  4U3Q A;  5CE4 A;  2DJF A;  5AJC A;  1PTS A;  1A57 A;  4EFG A;  3FEL A;  3PP6 A;  4D6A A;  2KT4 B;  4LQZ A;  3STK A;  4I9R A;  3B2K A;  1LIC A;  3WJG A;  2G7B A;  1KL4 A;  4IB6 A;  5D45 A;  3HOE A;  1CBI A;  1SWT A;  3QKG A;  4L3R A;  1RLB E;  1STS B;  1SWR A;  3PED A;  1FE3 A;  5IRW A;  4BX6 B;  3ZW1 A;  4NLI A;  1U18 A;  2WPU A;  5B29 A;  1BBP A;  3I17 A;  1SWS A;  1VYG A;  2LA7 A;  1BLR A;  1VWB B;  3NBX X;  2G78 A;  4NNT A;  3WOV A;  1SXU A;  5FQ8 E;  1IFC A;  5EDB A;  2AT5 X;  3RDS A;  3RDX A;  2IZJ A;  1GX3 A;  2NP1 A;  3AUM O;  4O4U A;  2A0A A;  3TF6 A;  1MOY A;  1TOU A;  4BCS A;  1FEL A;  1SRJ A;  1KXO A;  2OL8 O;  3VG4 A;  1VWK B;  1SXW A;  1NQN A;  4Z2P A;  5FFH A;  1E5P A;  3CBS A;  4TJZ A;  3TZS A;  2CM4 A;  2MM3 A;  1VWC B;  3BU9 A;  1CRB A;  5K68 A;  4BX7 A;  5HZ5 A;  2WQ9 A;  5L3Y A;  2GC9 A;  1B0O A;  1JQP A;  4IMN A;  5LJB A;  4BJ8 A;  3KVN A;  1AVE A;  3LTW A;  3VG5 A;  3STM X;  3VE1 A;  1EPB A;  1P6P A;  2RTB B;  1OEK A;  2ANS A;  2OY7 A;  1YUP A;  1YWA A;  4A1Y A;  5FQ6 E;  2RTN B;  5HTE A;  1SWF A;  4D6B A;  4ZHH A;  4XMG A;  4MVI A;  1RBP A;  3EW2 A;  2QM9 A;  2IJA A;  1SWN A;  3APV A;  1TOW A;  2GJ5 A;  4OS0 A;  1ZND A;  2IZL B;  4NLJ A;  1SY0 A;  4GDA A;  4KC7 A;  3C76 X;  4MVL A;  3FA8 A;  4TKB A;  3LHN A;  5F1E A;  1ICM A;  5D48 A;  5B27 A;  4CV7 A;  2VDF A;  3ZUO A;  4EDE A;  4YKM A;  1LIE A;  4ZFX A;  1B4M A;  1LEL A;  1EW3 A;  3BU1 A;  4IAW A;  1KT6 A;  2YMS A;  4JGL A;  2HMB A;  3QQ2 A;  5L8I A;  4ON1 A;  1T68 X;  3CKF A;  1FEM A;  3LV4 A;  1OBU A;  1W6F A;  1N7Y A;  2KTD A;  4RUN A;  1QFV A;  5HWZ A;  3L4R A;  3RWX A;  4YH0 A;  3SOT A;  5EEE A;  2MF6 A;  1BEB A;  1SRH A;  2OL7 A;  2UZ2 A;  3CR6 A;  2K62 A;  4NV8 A;  1IKE A;  4IRW A;  5DG4 A;  3BSZ E;  5H9A A;  4BGF A;  1BSY A;  4LZV A;  4YBP A;  2R74 A;  1SWO A;  3FW5 A;  3NP1 A;  1YWC A;  5B5F A;  4Y5D A;  3EW1 A;  4BX5 B;  1U17 A;  3KFG A;  1RXJ A;  4AZM A;  1HXZ A;  4MIR A;  3FW4 A;  4WFV A;  3BX7 A;  3FIQ A;  2RTG B;  5LJD A;  4N7C A;  3BY0 A;  3ZWE A;  2RTQ B;  3NX2 A;  3OE3 A;  4I9S A;  1I4U A;  2JU8 A;  1IKJ A;  4MEE A;  5H9L A;  4A8Z A;  5HZQ A;  3NAD A;  2KTS A;  1MDC A;  1OBP A;  5HCC C;  1RXH A;  1SWU A;  3O22 A;  3E3C A;  1GX8 A;  3AKN A;  1N4J A;  1S7D A;  4LKP A;  1X8N A;  3MBT A;  4YGG A;  3S5X A;  1HY2 A;  5HBS A;  4U8U M;  3VHH A;  3WYQ A;  1OPB A;  1VWM B;  1QY1 A;  5BYP A;  2BLG A;  2RTF B;  3ELX A;  4WBK A;  4Y0Q A;  3U03 A;  1XCA A;  4B55 A;  4KH8 A;  4ZGF A;  3SLJ A;  4QGX A;  3ZW1 B;  1NP4 A;  3NQ3 A;  2AT6 X;  5LJH A;  1JZU A;  4WHI A;  2UYW A;  1CBS A;  2RTO B;  1DC9 A;  2Q39 A;  3U9P C;  2AL0 X;  3D95 A;  3T2W A;  1IJ8 A;  5HA0 A;  4O9S A;  2K23 A;  1KQW A;  1X8Q A;  1I9H A;  2WR6 A;  1IW2 A;  2VFC A;  2FHN X;  3MX7 A;  4EKV A;  3UAQ A;  2MHD A;  2Q2P A;  4MVE A;  4CDF A;  2FTB A;  4ZCB A;  1GX9 A;  3SZJ A;  4UU2 A;  2JOZ A;  2MWH A;  3FR5 A;  2AT3 X;  2JW1 A;  3OD9 A;  2AKQ A;  2FGS A;  1BRP A;  4NW4 A;  4RUU A;  1G5W A;  1VWF B;  2DM5 A;  4CPH A;  2OFA A;  4Z28 A;  1ACD A;  1QAB E;  2FWV A;  3BLG A;  3STN A;  2OY8 A;  5H8T A;  1KZW A;  1YP7 A;  1HN2 A;  1O8V A;  2OZQ A;  4L1N A;  3WZN A;  4ALO A;  5HCD C;  2AT0 X;  2IZG B;  2BS5 A;  3RSW A;  2NND A;  4GRJ A;  5HAE A;  3BX8 A;  5CSE A;  4I3B A;  4CDD A;  2IZA A;  2RN4 A;  2BSZ A;  4CDE A;  2ACP X;  1NGL A;  1VWI B;  4FQB B;  4GZV A;  4QGW A;  4Y0S A;  3NX1 A;  1IFB A;  1URE A;  3FEP A;  2XKL A;  2A13 A;  3P6G A;  4OEL A;  1LPJ A;  1O1V A;  5AEO A;  2Q4N A;  1MX8 A;  1CBQ A;  2FR3 A;  3EMM A;  3VG3 A;  2R73 A;  2FKG A;  3F9D A;  5H9K A;  4AZR A;  4HPC A;  1EXS A;  5D8J A;  4BOE A;  3KZA A;  4I6S A;  4U8U O;  4GGZ A;  2C1S A;  3SLO A;  4ARH A;  1BM5 A;  3RZY A;  2CAM A;  2A5C A; 
#chains in the Genus database with same CATH homology
 1KFU L;  2DJG B;  4Q8G A;  4N79 A;  4MSX A;  3RVW A;  2AYN A;  3B79 A;  1AU3 A;  5CVM A;  1EWP A;  2IBI A;  2AYO A;  1ZIV A;  1BGO A;  2P0R A;  2YJC A;  4C5P A;  1ICF A;  2FO5 A;  3U8E A;  3IUT A;  3H7D A;  3CBJ A;  2XU5 A;  2AU1 A;  1BQI A;  1TLO A;  3BCN A;  5K16 A;  3H8B A;  3O1G A;  1S4V A;  2CIO A;  1PPO A;  2FUD A;  3WXG A;  3BPM A;  4WA6 A;  4QH6 A;  1W5R A;  1GEC E;  2JQG R;  2Y5B A;  1NB3 A;  2G8E A;  2GHU A;  2DC6 A;  1F29 A;  2DCB A;  2OZ2 A;  1Q6K A;  3GCB A;  5PAD A;  1POP A;  3BPF A;  1STF E;  4P6G A;  1F2A A;  4CZW A;  1PPN A;  2BDL A;  2HD5 A;  2JQF R;  4X6H A;  3KWZ A;  4PI3 A;  1YVB A;  2AIM A;  1NLJ A;  1NB5 A;  3QT4 A;  4MZS A;  3OVZ A;  1PIP A;  3H6S A;  5JH3 A;  1NQC A;  4FK5 A;  1HUC B;  1BP4 A;  2G8J A;  2XU3 A;  4Q8H A;  5CVN B;  4BPV A;  3WXF A;  1AYU A;  4I04 A;  4G54 A;  2VFB A;  5F02 A;  2YJB A;  4BS5 A;  3HD3 A;  2HXZ A;  4CDC B;  1EWO A;  4K7C A;  3PDF A;  1PAD A;  1EF7 A;  4GUZ A;  1QDQ A;  3BWK A;  3P5W A;  3V6E A;  3OVX A;  2NQG A;  5J94 A;  3F75 A;  3MHS A;  2P86 A;  3BOW A;  2IPP B;  2DC8 A;  2PRE A;  3RVX A;  2C0Y A;  3PBH A;  1K3B B;  1MEM A;  3USV A;  2XU1 A;  1NPZ A;  2AUX A;  2ACT A;  1YK8 A;  3MOR A;  3M99 A;  3K24 A;  2FYE A;  1A6R A;  2O6X A;  2YJ8 A;  4FIP A;  9PAP A;  4AXL A;  3MHH A;  3N3G A;  1YK7 A;  2OUL A;  3IHP A;  2CB5 A;  1KHQ A;  3D6S A;  2YJ9 A;  1U5I A;  1TL9 A;  4YV8 A;  8PCH A;  1U9Q X;  2PBH A;  2DJF B;  3V6C A;  1AU2 A;  1SNK A;  5CVO B;  5A24 A;  3D9W A;  3NHE A;  4W5C A;  2GFO A;  1E2T A;  3IMA A;  1GMY A;  2FQ9 A;  3N4C A;  4I05 A;  1MEG A;  1Y08 A;  1ZCM A;  2B1M A;  2G7Y A;  1KFX L;  2P7U A;  2VHS A;  4NV7 A;  2R9N A;  4YYR A;  2Y6E A;  1GLO A;  4QRV A;  3PNR A;  1YAL A;  3MTN A;  4W5B A;  3CBK A;  4BQV A;  3PW3 A;  1CQD A;  1AYW A;  5CHT A;  4YYW A;  3CH2 X;  1CS8 A;  2R9C A;  3KX1 A;  2DCC A;  3K9M A;  1PCI A;  4QBB A;  1O0E A;  2HH5 A;  2XU4 A;  1KXR A;  2ATO A;  1AU0 A;  1FH0 A;  4W4U A;  2DZY A;  4MZO A;  4QRX A;  1PPP A;  2E00 A;  4BS6 A;  2F1G A;  4ZUX U;  2B1N A;  3I06 A;  3KSE A;  4YVA A;  1YT7 A;  7PCK A;  3H89 A;  1SP4 B;  2HHN A;  2NQA A;  1PBH A;  2AUZ A;  4OEM A;  3K8U A;  2NQI A;  2FT2 A;  4YYV A;  1PPD A;  3QJ3 A;  1VJV A;  2PNS A;  1QMY A;  4I07 A;  1M6D A;  3KKU A;  1MDW A;  2R6N A;  1MHW A;  1GCB A;  4CDE B;  2YJ2 A;  1W4T A;  3OIS A;  2DC7 A;  2E02 A;  3HWN A;  4PAD A;  4QRG A;  4RY2 A;  4CDF B;  4X6J A;  1VSN A;  5JA7 A;  3CH3 X;  3HHA A;  1CV8 A;  1ME4 A;  2VHF A;  3O0U A;  2H7J A;  5EF4 A;  3HHI A;  1CVZ A;  4FJC A;  1KHP A;  1Y4H A;  4BSQ A;  1BY8 A;  1ME3 A;  1ITO A;  1AYV A;  2FRQ A;  2R9F A;  3LXS A;  1GX3 A;  1ATK A;  6PAD A;  3KW9 A;  3OF9 A;  3P5V A;  1EWL A;  3IOQ A;  1F2B A;  3AI8 A;  1JQP A;  3LTW A;  1CSB B;  3S3R A;  3IV2 A;  1CB5 A;  3F5V A;  4P6E A;  3WXE A;  4CDD B;  1MIR A;  3E1Z B;  2NQD B;  4HWY A;  2E03 A;  1CJL A;  4YYS A;  2OP3 A;  2AVW A;  3ZUA A;  2DCA A;  1W6F A;  4DMX A;  3TNX A;  4XUI A;  4YYQ A;  2E01 A;  4NV8 A;  4KLB A;  4BGF A;  3C9E A;  1CPJ A;  2R9O A;  2G6D A;  1DEU A;  4N4Z A;  2PAD A;  3P5U A;  1CTE A;  3ERV A;  1F2C A;  4X6I A;  1DF0 A;  1PXV A;  1AIM A;  5FPW A;  3I3T A;  3DF0 A;  1THE A;  1PE6 A;  3S3Q A;  3BC3 A;  2F7D A;  4B55 A;  5EGW A;  1NL6 A;  3QSD A;  4PP2 E;  1U9W A;  3N3K A;  2BDZ A;  1XKG A;  3LFY A;  4PP1 A;  1X9Y A;  4AXM A;  2VFC A;  5CHV A;  3OF8 A;  2ARY A;  1QOL A;  2WBF X;  2DC9 A;  3H8C A;  1TU6 A;  3P5X A;  2DZZ A;  1QXP A;  1U9X A;  1IWD A;  4XR7 A;  1AU4 A;  3KWB X;  1U9V A;  2BSZ A;  2DCD A;  1MS6 A;  1AEC A;  2FRA A;  3RVV A;  1EWM A;  2FTD A;  4N8W A;  3KFQ A;  4OEL A;  2AS8 A;  4DMY A;  4YYU A;  3IEJ A;  2R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...