4BGFA

The 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
270
Chain Sequence
LDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
publication title Structure of arylamine N-acetyltransferase from Mycobacterium tuberculosis determined by cross-seeding with the homologous protein from M. marinum: triumph over adversity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 73
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4bgfA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4bgfA01
1W5RA 2VFBA 3LTWA 2VFCA 4NV7A 3D9WA 4B55A 4NV8A 4BGFA 1W4TA 1GX3A 2BSZA 4C5PA 1E2TA 4GUZA 1W6FA
chains in the Genus database with same CATH superfamily
5L8NA 1ZNEA 2I5ZO 4AW8A 4KC8A 2FHNX 5HCEC 3VHHA 4GGTA 1BJ7A 1NP4A 3JSQA 1SY1A 1ML7A 4BX7A 1SWNA 2WWPA 3FA8A 1DF8A 2A5BA 3B2HA 2RTGB 4I9RA 4TKBA 2JN3A 1VWCB 4IAXA 4PJ2A 2IZBA 2A8GA 2XSTA 2X46A 4GETA 5DG4A 3WJBA 1HBQA 1AELA 1LIEA 4HPCA 3RDUA 1CBSA 1SLGB 1UZ2X 1GX8A 2JU7A 4KT5A 1SWEA 5HZ9A 1VPRA 2EU7X 4GZVA 5LJHA 4NNSA 1LIDA 5B5GA 3FA6A 2GJ5A 1N0SA 3SLJA 3FELA 3FR4A 1W4TA 5AJCA 4AZOA 5H9NA 2ACPX 1SY3A 4O3YA 2RQ0A 1SWJA 1JJUA 3RDXA 2IZLB 1MK5A 2QMIA 1OEKA 1FE3A 2RTFB 2OFBA 3VPJE 4DQ4A 3N91A 5EEEA 5HWZA 2RA6A 1EIIA 2IZAA 4XMHA 3S5XA 1KZXA 1MEPA 4XMCA 2C1QA 2OZQA 3S26A 3HWGA 1X8UA 3BSZE 3CWKA 1X8OA 4A60A 1SY0A 2PI3O 4GDZA 3VU1A 2C4IA 2AT5X 3CR6A 1N9MA 3MG5A 3OE3A 5BYPA 1HBPA 2X8TA 3EW1A 4TLJA 2CM4A 1SLFB 4L3RA 3NR3A 4HWMA 4XMDA 5LKFA 3UEUA 1VWRB 1NQMA 1I04A 1VWEB 2BSZA 4ORSA 3PK2A 3WZPA 4O3ZA 4Z2VA 4ZHGA 3LNBA 1IJ8A 4NP1A 2KW1A 1Y9TA 4TJZA 1GT5A 1LIFA 2QO4A 3SLTA 1WBIA 3MBTA 4FBRA 4FBVA 5HTEA 1EIOA 1KQXA 4IMNA 3RSWA 1GGLA 2DJFA 4FGIB 3VE1A 2FR2A 5FENA 1JYDA 1VWHB 4WHIA 1OSPO 4OEMA 4KCAA 5F6BA 3T2WA 4QYPA 2F73A 3STKA 1JBHA 1LIBA 1EXSA 1LICA 3P6EA 4ZHDA 3MX7A 1EW3A 2RCTA 1U18A 1X89A 3PQUA 4GE1A 2R74A 4WFUA 3TGBA 2LKKA 3P6HA 2Y3FA 1VWFB 1LCZA 5DPQA 4ORYA 3FENA 1IFCA 2BS6A 2O62A 2RTLA 2OVSA 3I17A 2M4LA 2KD2A 4AYHA 1D2UA 4CPIA 4JHQA 1NP1A 1QWDA 5FFHA 4ODDA 3SAOA 2R56A 3APVA 2MF6A 4A8ZA 4ZJ0A 2OY1O 3GE2A 3RDQA 1SXXA 1IKEA 2QO6A 4MEEA 1MVGA 1SWRA 1KT3A 1YP7A 2QCBA 1GT4A 3D96A 3BU1A 3ELXA 3S60A 4Z27A 4TQ2A 4PSQA 4O3XB 4OS3A 4JO6A 2JGSA 2YMSA 2JU8A 3JS1A 3WVMA 2RCQA 3FW5A 4NYQA 4YCEA 1VWLB 2GTLM 2RTDB 1SWBA 4FQBB 1IW2A 5BVQA 5LJGA 4ON1A 1D3SA 4LQZA 4O4OA 1TVQA 2L9CA 3RY2A 1JMZA 1HXLA 2MJIA 3P6DA 4CPEA 1CJ5A 1ALBA 1SRHA 2L67A 2OL7A 3EBWA 3FR2A 5HZ6A 1ZNLA 1SWCA 2OF9A 2OVEA 4IAWA 4LZUA 1KT4A 5HCDC 1ZRYA 3HTYA 3ZW2A 4AZNA 2OL8O 2QOMA 4I3DA 4IBAA 1KGLA 2P8GA 1EUOA 3LV4A 3SZIA 1CRBA 3C78X 4O9SA 5D8JA 2A5CA 1SREA 5B27A 2A13A 1QY2A 3BX7A 3RE6A 2G5LA 1X8NA 1AVDA 1JJXA 2IFBA 1GM6A 2A2GA 3FR5A 1DZKA 3ZWEA 1DFVA 5IRUA 4INNA 1NDJA 4YCHA 2WEWA 4I3BA 1HQPA 1MOYA 3U9PC 1KL4A 2KTDA 1I4UA 3B2LA 4YDBA 2FGSA 4YGGA 1AQBA 2NP1A 1STPA 3C77X 3P6CA 5FQ7E 1RXKA 1YP6A 5EDBA 2AH7X 4A1HA 1SY2A 4NW4A 4ID2A 2FLJA 2WQ9A 4ZH9A 3LTWA 1G7NA 4UU3A 5K67A 2IZDB 3EW2A 1JZUA 2ANSA 1VWBB 2HMBA 1DC9A 4KC7A 2Y32A 1MX7A 4I3CA 4EQAC 3NQ3A 3WYQA 1VWNB 3NX1A 3NQKA 3CKFA 4CK4A 3VHIA 1IFBA 3HWFA 5D48A 5L8OA 5L8IA 1NBXA 2Q39A 4Y5DA 3HOEA 1AB0A 4GJVA 2HNXA 3ZW1B 4D6AA 1FENA 4ML7B 3T6FA 1KZWA 2FS6A 1SWAA 1MUPA 2MWHA 3D4RA 3IFBA 4GDAA 4Z2PA 2GTLN 1LPJA 1O1UA 1RAVA 2RTAA 3F9DA 4IB7A 1KL3A 4QQ1A 3EC5A 5CYBA 2HZQA 3U03A 5IO5A 3PECA 1EQDA 3FEKA 3PP6A 1JV4A 2W2BA 1LCWA 4NV7A 1MDCA 2BC3A 2IZIA 2Z4IA 3ELZA 1LDOA 4N7DA 3CQRA 3GAQA 5LJCA 2WUTA 4O4XA 3PPTA 1OEJA 2Q4NA 5HAEA 2X8FA 3FIDA 3D95A 3PDFA 5B3MO 1GT3A 1ZNHA 1VYOA 2RTJA 2Y3EA 4GNWA 2FTBA 2CZTA 3AKNA 2X34A 1U17A 5H9LA 4EDEA 4R0BA 1SXUA 1A57A 4XMEA 2HYSA 2ZAGA 1GXAA 2G7BA 4MVKA 1VWIB 1OBPA 4ORUA 3CBCA 2ZAIA 1A3YA 4BVMA 3ZW0B 4KH8A 3WZQA 3FEPA 2Z4HA 3FMZA 3FLLA 4BCSA 4YGZA 2LB6A 4OMXA 4YBPA 1B56A 1G85A 2HKDA 2YG2A 4JNJA 3K3LA 3UEWA 1E2TA 3D9WA 1GX3A 4CDFA 2CZUA 2K23A 4EEJA 1VWQB 2Q2PA 3O2YA 1SXYA 5FQ6E 2Q2MA 1B0OA 4BX5B 1IIUA 1B8EA 1UYNX 5LJBA 4O49A 1EPBA 2BS5A 3RZYA 3WJCA 2MM3A 4NLJA 1BM5A 1HQQA 5KICA 1K3BA 4QNIA 2VDFA 1AVEA 1LDQA 4Y0SA 2RTPB 5B10O 4AZRA 2WQAE 1RXHA 2X56A 4LKTA 4QGVA 2FHLA 1PEEA 3HK1A 5HCCC 3TGAA 4QYNA 4HPBA 5F1EA 4N7CA 3LHNA 3OJYC 5F58A 5LJDA 3ZW1A 2OYBO 4ZGUA 2W2AA 1A2DA 4CV7A 2AT0X 1L6MA 3KFFA 2IZEB 1PTSA 2X45A 3V8UA 5F2BA 3O22A 4WFVA 1I06A 1SXWA 3H3IA 3HWEA 3B2KA 3Q6LA 1QFVA 2CM9A 1HMTA 1VWGB 3OD9A 4ZH6A 1AVGI 2GC9A 4CPHB 4GD9A 1LELA 1X8PA 1SWHA 2A3FX 4DNEA 5B5FA 1S44A 4M7MA 3WYPA 3OBLA 1XCAA 1SWDA 4OKAA 4QGXA 4ZHCA 5AQ6A 1HN2A 1BBPA 3EYCA 1NQNA 1GKAB 3APUA 3BLGA 1P6PA 1R0UA 4IMOA 4U8UO 4Z28A 1E00A 1OBQA 1HMSA 1SWSA 4L1NA 4U8UM 3VG3A 3S5VA 3WZNA 3B2JA 2RTBB 3NQ9A 5JD2A 1N4JA 3FW4A 1MX8A 5AEOA 1YUPA 1DZJA 2IZFB 1ICNA 3NADA 4GJSA 1T8VA 1ZNDA 2G8CO 3P02A 2JU3A 3AKMA 2RTIB 2WPUA 3ZW0A 1Y0GA 1QQSA 3VE2A 1LKEA 1SWUA 5D47A 2RTQB 1G5WA 2NNDA 3UEVA 2HLVA 3VHMA 1I78A 2RTMA 4TKHA 3WZOA 3L4RA 4ORXA 5K68A 2CBSA 1VWJB 2OFAA 1FDQA 4DMOA 4BX5A 4ES7A 3P6GA 1PMPA 4ALOA 1QABE 4IB8A 3U0DA 1SLDB 2FRSA 4M6SA 2LBVA 3WJEA 5IXGA 1OEEA 5L3YA 1JYJA 3TGCA 1BLRA 2XKLA 1BSYA 4ZGFA 2RN4A 3WOVA 2ACOA 1BSQA 2AT3X 2MO5A 1N7YA 5FQ8E 3RBYA 3RY1A 4GU8A 4Y0QA 2C1SA 4ALBA 2IJAA 2ALLX 4ARHA 1QFTA 3VG2A 1RSUB 3FIQA 4U3QA 2I5VO 5HZQA 2DJGA 4IABA 4MIRA 2RTNB 1RSTB 4I9SA 2HZRA 1G74A 4Y0PA 1VWOB 2X8SA 4CPHA 2RD7C 1Y53X 5F7GA 4LZVA 2Q9SA 1IKJA 1SWKA 3HWDA 4GKCA 2BLGA 3BRNA 2RTRB 4I6SA 1FJ1E 3BY0A 4XMFA 2AL0X 1U0XA 1KL5A 3APXA 1SWLA 1K24A 3EMMA 4OELA 5EEDA 1GKAA 4U8UN 1T0VA 1SA8A 1BEBA 3KZAA 4BOEA 1KFFA 1S7DA 3KFIA 3O19A 2FS7A 3UAQA 3ZUIA 1VWAB 4YDAA 4BBOA 4UU2A 2DM5A 1QY0A 4WBKA 3E3CA 2MHDA 1SWTA 3RWXA 3DTQA 4MVLA 2WSJA 1YIVA 4K19A 2VFBA 4Z2OA 5IO7A 5CHKA 2BHVA 2RTEB 4OMWA 3T1DA 4IRWA 5HZ5A 5C0NA 2PFRA 4GGRA 1SMPI 3KVNA 4TNNA 3RDOA 1ACDA 1XKIA 2CBRA 1UREA 3FA9A 1ICMA 3NPOA 2X4MA 1OPAA 2IZHB 3F6ZB 3KQ0A 1SWOA 4ZR2A 2FR3A 1KT6A 3WJGA 2X55A 3PEDA 5IO6A 5H9AA 3NX2A 1CBRA 1DZPA 3ZUOA 2PY1A 2OY5O 5F6ZA 5BVSA 5JR8A 5B11O 4CPFA 4Y59A 4CDDA 3APWA 4I60A 5LJKA 1GT1A 4HPAA 2AMMX 5H9KA 2POAA 1VYGA 4A1YA 4CDCA 3P24A 3D97A 1H91A 2AT6X 3TZSA 1S2PA 4C5PA 2R73A 1X71A 5LJEA 3PH5A 3VG4A 3WXQA 4NYRA 4COTA 4EXZA 4GNYA 1FTPA 4XMGA 1WUBA 3SZHA 4BJ8A 2AF5A 1JMXA 2QOSC 3KFHA 4GH7A 4MVEA 4DCBA 4YFRA 1ERBA 4YKMA 2WEXA 3CQNA 5CSEA 2AVIA 3SZJA 1TOWA 5HBSA 4JGLA 1EI5A 1LCVA 1STRB 4IB9A 3VG6A 2IZGB 1PM1X 4U46A 1JIWI 1EPAA 2RTKA 3CBSA 4QZUA 3B2IA 3P6FA 2IZKA 3CKGA 2OL6O 1E06A 1SLEB 4O4UA 2K62A 4ORRA 4YFQA 3G7XA 2L5PA 4QZTA 1E5PA 1O1VA 3PQSA 1E02A 1VWDB 2GH7A 3DSZA 5FAZA 5H8TA 3SOTA 3FDCA 1DZMA 2AKQA 2QM9A 3IA8A 2G79A 3C76X 3QQ2A 3EM0A 5D4AA 4O3WA 4I95A 4U9CA 3RDMA 1SWGA 3JQOA 4OS8A 2JOZA 5KHPA 3X00A 1W5RA 2JMBA 3NP1A 3RKGA 2OF8A 1Y9LA 4CSBA 3STMX 2ASNX 2RTCB 3HOLA 1HXZA 3EBKA 4HFOA 2IZCB 1HMRA 2LFOA 3T6LA 1QG5A 2FWVA 4ZCBA 4RUUA 4EKVA 4ZHFA 1SRJA 5HTDA 1DV9A 3QKGA 3FA7A 1PBYA 1ADLA 4AZMA 1NGLA 3RDSA 1TW4A 1KQWA 1UYOX 3BDRA 2AT8X 1SWQA 3ZI8A 3Q34A 2OFRX 4AZQA 1EALA 1X8QA 3UEXA 1VWPB 2L68A 1DF3A 2GTFX 4FBOA 1Y55X 5B2AO 2NNQA 4BX6B 2OVAA 3TF6A 4YBUA 4ORWA 1O8VA 1KT7A 4YGHA 1W6FA 3MVFA 1B4MA 1KOIA 2ZSCA 5BVTA 1ZNGA 4B55A 2NNEA 3MM0A 5IRAA 4CDEA 2UYWA 1YWDA 2FT9A 3STNA 2KTSA 1BWYA 3ZZVA 4BX7B 4TKJA 2F09A 3PH6A 4NLIA 2UZ2A 1N43A 4KIIA 4OS0A 2X32A 3WBGA 3WJDA 2OY7A 1Y52X 2VFCA 1QY1A 3VG5A 4HPDA 2GTLO 1SRFA 5EDCA 1LFOA 2W2FA 2OY8A 4NV8A 1GX9A 5AJBA 1VWMB 5HA1A 5HZ8A 4Z6JA 1PBOA 1SRIA 3F8AA 5EPQA 2OVDA 3AUMO 1Z24A 4GUZA 4AZPA 4Y0RA 2CAMA 4ZHHA 2LA7A 4O4SA 3SLOA 4EFGA 1OPBA 1MM9A 4MVIA 5HA0A 1I9HA 1I05A 3NBXX 2E4JA 4GRJA 4YH0A 4YMYA 1LF7A 1JQPA 1YWBA 3HPEA 1KXOA 2KT4B 4BGFA 2QO5A 1NC9A 2WR6A 4MISA 5EZ2A 1SRGA 4ZFXA 1LNMA 1FEMA 4QRLA 2OFMX 4DQ3A 4YFPA 2A0AA 2PQTA 3ZQ3A 1OBUA 2JW1A 4YVBA 1FELA 2FKGA 1TOUA 2IZJA 4YKOA 1RXJA 5D45A 5CE4A 1VYFA 3CMPA 3I0AA 1ZNKA 2LBAA 1BSOA 1BRPA 1VWKB 1KT5A 4RUNA 3T2XA 3WJFA 4QAEA 4BQUA 3VG7A 1TXLA 2N93A 2RTOB 3RE5A 4D6BA 2G78A 1SWFA 1JJJA 4IB6A 4GGZA 5KIDA 1RLBE 1HY2A 2F01A 3VGWA 4GK9A 1CBIA 2BT9A 2RTHB 1STSB 1RBPA 3AEHA 3BS2A 3FYFA 3BU9A 3KFGA 4LKPA 4QGWA 2FKJA 4NNTA 1LUQA 1BRQA 1CBQA 2A2UA 1YWAA 3BX8A 5B29A 1A18A 4BX6A 5LKEA 1N9YA 5IRWA 1SWPA 1T68X 5K06A 1YWCA 1ERXA
chains in the Genus database with same CATH topology
1GECE 3OF9A 1PPPA 1NQCA 4BPVA 3DF0A 1CV8A 1S4VA 1CPJA 3BPFA 9PAPA 1KHPA 2PADA 1W4TA 3WXFA 2PREA 1EWMA 1MIRA 4N8WA 1CSBB 4QRXA 2XU5A 1NLJA 1A6RA 2AIMA 1GMYA 2FRQA 3CBKA 2E02A 5J94A 4QRVA 4AXMA 2DC6A 2DC8A 3CBJA 1EWLA 2BSZA 3M99A 3QT4A 3E1ZB 2R9OA 2XU3A 4MZSA 3MHSA 1MEGA 3RVWA 3K8UA 4OEMA 3H89A 1AU2A 2G8JA 3IV2A 4HWYA 1NB3A 1F2AA 2WBFX 2DCBA 3P5VA 1O0EA 1TL9A 3B79A 3BPMA 1ITOA 5F02A 3IUTA 3ZUAA 4CZWA 3KSEA 2FTDA 3PBHA 2IBIA 4PI3A 1PIPA 3NHEA 4X6IA 1ATKA 2YJ2A 1PXVA 3K24A 1BQIA 2ATOA 3MORA 3P5XA 1NB5A 4W4UA 4YVAA 3USVA 3QSDA 2DCDA 1BP4A 1QDQA 5EF4A 2G6DA 2R9CA 4CDFB 1KXRA 2YJBA 1GCBA 1DF0A 3LTWA 4BS6A 1CJLA 1PCIA 1K3BB 2G8EA 3IMAA 2CIOA 2DZZA 3IOQA 2F7DA 1VSNA 5CVOB 1TLOA 2VHFA 1U9XA 1AYUA 2NQAA 4PP1A 4NV7A 1TU6A 4RY2A 1CTEA 1EF7A 3IEJA 4MSXA 2HD5A 3PDFA 1AECA 1ZCMA 3PW3A 4BQVA 2FO5A 2R6NA 1ZIVA 4K7CA 3D6SA 4FJCA 1AU0A 2BDZA 4YYRA 1QMYA 1AU4A 1DEUA 2P0RA 3D9WA 1E2TA 1GX3A 5K16A 2OP3A 3RVXA 1AYVA 1NL6A 1NPZA 4PADA 2ARYA 2R9MA 4Q8GA 2GHUA 2DCCA 4FK5A 1CB5A 4N4ZA 3HHAA 3IHPA 3MTNA 1U9WA 2AYOA 1CS8A 1YVBA 2DJGB 7PCKA 3F75A 2YJ8A 1EWOA 3ERVA 4X6JA 2HH5A 2P86A 3CH3X 1PBHA 4BS5A 3KWBX 1AIMA 3OF8A 4G54A 4YV8A 1M6DA 2FYEA 8PCHA 1KHQA 2BDLA 5JH3A 4QH6A 1F2BA 2NQIA 2OZ2A 1SNKA 2VHSA 3BWKA 2B1MA 2R9NA 3BC3A 1X9YA 2O6XA 2R9FA 2CB5A 4Q8HA 3KX1A 3HD3A 1FH0A 1U9VA 2DC9A 4CDDB 2G7YA 1MEMA 3O1GA 1Y4HA 1Q6KA 4CDCB 4P6EA 4AXLA 1THEA 2E00A 2F1GA 3WXGA 3BOWA 3N3GA 1F29A 3K9MA 2XU4A 2PBHA 4DMXA 4N79A 1XKGA 1Y08A 2PNSA 1ICFA 3AI8A 1MHWA 2HHNA 1GLOA 3QJ3A 2NQGA 3MHHA 4OELA 3GCBA 5A24A 5CVNB 2E01A 3KW9A 4FIPA 1EWPA 1U5IA 2HXZA 2VFBA 2FRAA 4X6HA 1PPDA 4I05A 2FQ9A 2OULA 1PADA 3N4CA 3OVZA 4P6GA 1PPOA 1MS6A 1ME4A 1KFXL 3C9EA 4W5BA 2DCAA 4W5CA 4CDEB 3OISA 3OVXA 4C5PA 1QOLA 1CVZA 5CHTA 1POPA 5PADA 2H7JA 4XR7A 4MZOA 3CH2X 3LXSA 2ACTA 1YALA 1KFUL 4XUIA 3KWZA 2YJ9A 3TNXA 4WA6A 3S3RA 3F5VA 4ZUXU 1VJVA 2XU1A 2B1NA 3V6CA 3WXEA 4KLBA 2JQGR 2AS8A 3I06A 4I07A 2YJCA 3HWNA 1BGOA 1W5RA 1F2CA 3KKUA 1CQDA 2Y6EA 1STFE 5CVMA 1YK7A 1SP4B 6PADA 3HHIA 2IPPB 3RVVA 1PPNA 1AYWA 2P7UA 1YK8A 3LFYA 4YYUA 1W6FA 2AU1A 4B55A 2FT2A 2AVWA 2JQFR 4YYSA 4YYWA 2NQDB 1PE6A 4PP2E 2VFCA 3KFQA 4BSQA 4NV8A 1AU3A 3PNRA 2C0YA 4DMYA 2Y5BA 4GUZA 3O0UA 3V6EA 1JQPA 1YT7A 3P5UA 4BGFA 3S3QA 3P5WA 4YYVA 4QRGA 3N3KA 5FPWA 2DC7A 5JA7A 4QBBA 3H8BA 2AYNA 2GFOA 1U9QX 1ME3A 1QXPA 3H6SA 2AUXA 3BCNA 1IWDA 2AUZA 3H7DA 3H8CA 2DZYA 5EGWA 1HUCB 4YYQA 1MDWA 5CHVA 2E03A 2DJFB 4I04A 2FUDA 1BY8A 3U8EA 3I3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5R A;  2VFB A;  3LTW A;  2VFC A;  4NV7 A;  3D9W A;  4B55 A;  4NV8 A;  4BGF A;  1W4T A;  1GX3 A;  2BSZ A;  4C5P A;  1E2T A;  4GUZ A;  1W6F A; 
#chains in the Genus database with same CATH topology
 5L8N A;  1ZNE A;  2I5Z O;  4AW8 A;  4KC8 A;  2FHN X;  5HCE C;  3VHH A;  4GGT A;  1BJ7 A;  1NP4 A;  3JSQ A;  1SY1 A;  1ML7 A;  4BX7 A;  1SWN A;  2WWP A;  3FA8 A;  1DF8 A;  2A5B A;  3B2H A;  2RTG B;  4I9R A;  4TKB A;  2JN3 A;  1VWC B;  4IAX A;  4PJ2 A;  2IZB A;  2A8G A;  2XST A;  2X46 A;  4GET A;  5DG4 A;  3WJB A;  1HBQ A;  1AEL A;  1LIE A;  4HPC A;  3RDU A;  1CBS A;  1SLG B;  1UZ2 X;  1GX8 A;  2JU7 A;  4KT5 A;  1SWE A;  5HZ9 A;  1VPR A;  2EU7 X;  4GZV A;  5LJH A;  4NNS A;  1LID A;  5B5G A;  3FA6 A;  2GJ5 A;  1N0S A;  3SLJ A;  3FEL A;  3FR4 A;  1W4T A;  5AJC A;  4AZO A;  5H9N A;  2ACP X;  1SY3 A;  4O3Y A;  2RQ0 A;  1SWJ A;  1JJU A;  3RDX A;  2IZL B;  1MK5 A;  2QMI A;  1OEK A;  1FE3 A;  2RTF B;  2OFB A;  3VPJ E;  4DQ4 A;  3N91 A;  5EEE A;  5HWZ A;  2RA6 A;  1EII A;  2IZA A;  4XMH A;  3S5X A;  1KZX A;  1MEP A;  4XMC A;  2C1Q A;  2OZQ A;  3S26 A;  3HWG A;  1X8U A;  3BSZ E;  3CWK A;  1X8O A;  4A60 A;  1SY0 A;  2PI3 O;  4GDZ A;  3VU1 A;  2C4I A;  2AT5 X;  3CR6 A;  1N9M A;  3MG5 A;  3OE3 A;  5BYP A;  1HBP A;  2X8T A;  3EW1 A;  4TLJ A;  2CM4 A;  1SLF B;  4L3R A;  3NR3 A;  4HWM A;  4XMD A;  5LKF A;  3UEU A;  1VWR B;  1NQM A;  1I04 A;  1VWE B;  2BSZ A;  4ORS A;  3PK2 A;  3WZP A;  4O3Z A;  4Z2V A;  4ZHG A;  3LNB A;  1IJ8 A;  4NP1 A;  2KW1 A;  1Y9T A;  4TJZ A;  1GT5 A;  1LIF A;  2QO4 A;  3SLT A;  1WBI A;  3MBT A;  4FBR A;  4FBV A;  5HTE A;  1EIO A;  1KQX A;  4IMN A;  3RSW A;  1GGL A;  2DJF A;  4FGI B;  3VE1 A;  2FR2 A;  5FEN A;  1JYD A;  1VWH B;  4WHI A;  1OSP O;  4OEM A;  4KCA A;  5F6B A;  3T2W A;  4QYP A;  2F73 A;  3STK A;  1JBH A;  1LIB A;  1EXS A;  1LIC A;  3P6E A;  4ZHD A;  3MX7 A;  1EW3 A;  2RCT A;  1U18 A;  1X89 A;  3PQU A;  4GE1 A;  2R74 A;  4WFU A;  3TGB A;  2LKK A;  3P6H A;  2Y3F A;  1VWF B;  1LCZ A;  5DPQ A;  4ORY A;  3FEN A;  1IFC A;  2BS6 A;  2O62 A;  2RTL A;  2OVS A;  3I17 A;  2M4L A;  2KD2 A;  4AYH A;  1D2U A;  4CPI A;  4JHQ A;  1NP1 A;  1QWD A;  5FFH A;  4ODD A;  3SAO A;  2R56 A;  3APV A;  2MF6 A;  4A8Z A;  4ZJ0 A;  2OY1 O;  3GE2 A;  3RDQ A;  1SXX A;  1IKE A;  2QO6 A;  4MEE A;  1MVG A;  1SWR A;  1KT3 A;  1YP7 A;  2QCB A;  1GT4 A;  3D96 A;  3BU1 A;  3ELX A;  3S60 A;  4Z27 A;  4TQ2 A;  4PSQ A;  4O3X B;  4OS3 A;  4JO6 A;  2JGS A;  2YMS A;  2JU8 A;  3JS1 A;  3WVM A;  2RCQ A;  3FW5 A;  4NYQ A;  4YCE A;  1VWL B;  2GTL M;  2RTD B;  1SWB A;  4FQB B;  1IW2 A;  5BVQ A;  5LJG A;  4ON1 A;  1D3S A;  4LQZ A;  4O4O A;  1TVQ A;  2L9C A;  3RY2 A;  1JMZ A;  1HXL A;  2MJI A;  3P6D A;  4CPE A;  1CJ5 A;  1ALB A;  1SRH A;  2L67 A;  2OL7 A;  3EBW A;  3FR2 A;  5HZ6 A;  1ZNL A;  1SWC A;  2OF9 A;  2OVE A;  4IAW A;  4LZU A;  1KT4 A;  5HCD C;  1ZRY A;  3HTY A;  3ZW2 A;  4AZN A;  2OL8 O;  2QOM A;  4I3D A;  4IBA A;  1KGL A;  2P8G A;  1EUO A;  3LV4 A;  3SZI A;  1CRB A;  3C78 X;  4O9S A;  5D8J A;  2A5C A;  1SRE A;  5B27 A;  2A13 A;  1QY2 A;  3BX7 A;  3RE6 A;  2G5L A;  1X8N A;  1AVD A;  1JJX A;  2IFB A;  1GM6 A;  2A2G A;  3FR5 A;  1DZK A;  3ZWE A;  1DFV A;  5IRU A;  4INN A;  1NDJ A;  4YCH A;  2WEW A;  4I3B A;  1HQP A;  1MOY A;  3U9P C;  1KL4 A;  2KTD A;  1I4U A;  3B2L A;  4YDB A;  2FGS A;  4YGG A;  1AQB A;  2NP1 A;  1STP A;  3C77 X;  3P6C A;  5FQ7 E;  1RXK A;  1YP6 A;  5EDB A;  2AH7 X;  4A1H A;  1SY2 A;  4NW4 A;  4ID2 A;  2FLJ A;  2WQ9 A;  4ZH9 A;  3LTW A;  1G7N A;  4UU3 A;  5K67 A;  2IZD B;  3EW2 A;  1JZU A;  2ANS A;  1VWB B;  2HMB A;  1DC9 A;  4KC7 A;  2Y32 A;  1MX7 A;  4I3C A;  4EQA C;  3NQ3 A;  3WYQ A;  1VWN B;  3NX1 A;  3NQK A;  3CKF A;  4CK4 A;  3VHI A;  1IFB A;  3HWF A;  5D48 A;  5L8O A;  5L8I A;  1NBX A;  2Q39 A;  4Y5D A;  3HOE A;  1AB0 A;  4GJV A;  2HNX A;  3ZW1 B;  4D6A A;  1FEN A;  4ML7 B;  3T6F A;  1KZW A;  2FS6 A;  1SWA A;  1MUP A;  2MWH A;  3D4R A;  3IFB A;  4GDA A;  4Z2P A;  2GTL N;  1LPJ A;  1O1U A;  1RAV A;  2RTA A;  3F9D A;  4IB7 A;  1KL3 A;  4QQ1 A;  3EC5 A;  5CYB A;  2HZQ A;  3U03 A;  5IO5 A;  3PEC A;  1EQD A;  3FEK A;  3PP6 A;  1JV4 A;  2W2B A;  1LCW A;  4NV7 A;  1MDC A;  2BC3 A;  2IZI A;  2Z4I A;  3ELZ A;  1LDO A;  4N7D A;  3CQR A;  3GAQ A;  5LJC A;  2WUT A;  4O4X A;  3PPT A;  1OEJ A;  2Q4N A;  5HAE A;  2X8F A;  3FID A;  3D95 A;  3PDF A;  5B3M O;  1GT3 A;  1ZNH A;  1VYO A;  2RTJ A;  2Y3E A;  4GNW A;  2FTB A;  2CZT A;  3AKN A;  2X34 A;  1U17 A;  5H9L A;  4EDE A;  4R0B A;  1SXU A;  1A57 A;  4XME A;  2HYS A;  2ZAG A;  1GXA A;  2G7B A;  4MVK A;  1VWI B;  1OBP A;  4ORU A;  3CBC A;  2ZAI A;  1A3Y A;  4BVM A;  3ZW0 B;  4KH8 A;  3WZQ A;  3FEP A;  2Z4H A;  3FMZ A;  3FLL A;  4BCS A;  4YGZ A;  2LB6 A;  4OMX A;  4YBP A;  1B56 A;  1G85 A;  2HKD A;  2YG2 A;  4JNJ A;  3K3L A;  3UEW A;  1E2T A;  3D9W A;  1GX3 A;  4CDF A;  2CZU A;  2K23 A;  4EEJ A;  1VWQ B;  2Q2P A;  3O2Y A;  1SXY A;  5FQ6 E;  2Q2M A;  1B0O A;  4BX5 B;  1IIU A;  1B8E A;  1UYN X;  5LJB A;  4O49 A;  1EPB A;  2BS5 A;  3RZY A;  3WJC A;  2MM3 A;  4NLJ A;  1BM5 A;  1HQQ A;  5KIC A;  1K3B A;  4QNI A;  2VDF A;  1AVE A;  1LDQ A;  4Y0S A;  2RTP B;  5B10 O;  4AZR A;  2WQA E;  1RXH A;  2X56 A;  4LKT A;  4QGV A;  2FHL A;  1PEE A;  3HK1 A;  5HCC C;  3TGA A;  4QYN A;  4HPB A;  5F1E A;  4N7C A;  3LHN A;  3OJY C;  5F58 A;  5LJD A;  3ZW1 A;  2OYB O;  4ZGU A;  2W2A A;  1A2D A;  4CV7 A;  2AT0 X;  1L6M A;  3KFF A;  2IZE B;  1PTS A;  2X45 A;  3V8U A;  5F2B A;  3O22 A;  4WFV A;  1I06 A;  1SXW A;  3H3I A;  3HWE A;  3B2K A;  3Q6L A;  1QFV A;  2CM9 A;  1HMT A;  1VWG B;  3OD9 A;  4ZH6 A;  1AVG I;  2GC9 A;  4CPH B;  4GD9 A;  1LEL A;  1X8P A;  1SWH A;  2A3F X;  4DNE A;  5B5F A;  1S44 A;  4M7M A;  3WYP A;  3OBL A;  1XCA A;  1SWD A;  4OKA A;  4QGX A;  4ZHC A;  5AQ6 A;  1HN2 A;  1BBP A;  3EYC A;  1NQN A;  1GKA B;  3APU A;  3BLG A;  1P6P A;  1R0U A;  4IMO A;  4U8U O;  4Z28 A;  1E00 A;  1OBQ A;  1HMS A;  1SWS A;  4L1N A;  4U8U M;  3VG3 A;  3S5V A;  3WZN A;  3B2J A;  2RTB B;  3NQ9 A;  5JD2 A;  1N4J A;  3FW4 A;  1MX8 A;  5AEO A;  1YUP A;  1DZJ A;  2IZF B;  1ICN A;  3NAD A;  4GJS A;  1T8V A;  1ZND A;  2G8C O;  3P02 A;  2JU3 A;  3AKM A;  2RTI B;  2WPU A;  3ZW0 A;  1Y0G A;  1QQS A;  3VE2 A;  1LKE A;  1SWU A;  5D47 A;  2RTQ B;  1G5W A;  2NND A;  3UEV A;  2HLV A;  3VHM A;  1I78 A;  2RTM A;  4TKH A;  3WZO A;  3L4R A;  4ORX A;  5K68 A;  2CBS A;  1VWJ B;  2OFA A;  1FDQ A;  4DMO A;  4BX5 A;  4ES7 A;  3P6G A;  1PMP A;  4ALO A;  1QAB E;  4IB8 A;  3U0D A;  1SLD B;  2FRS A;  4M6S A;  2LBV A;  3WJE A;  5IXG A;  1OEE A;  5L3Y A;  1JYJ A;  3TGC A;  1BLR A;  2XKL A;  1BSY A;  4ZGF A;  2RN4 A;  3WOV A;  2ACO A;  1BSQ A;  2AT3 X;  2MO5 A;  1N7Y A;  5FQ8 E;  3RBY A;  3RY1 A;  4GU8 A;  4Y0Q A;  2C1S A;  4ALB A;  2IJA A;  2ALL X;  4ARH A;  1QFT A;  3VG2 A;  1RSU B;  3FIQ A;  4U3Q A;  2I5V O;  5HZQ A;  2DJG A;  4IAB A;  4MIR A;  2RTN B;  1RST B;  4I9S A;  2HZR A;  1G74 A;  4Y0P A;  1VWO B;  2X8S A;  4CPH A;  2RD7 C;  1Y53 X;  5F7G A;  4LZV A;  2Q9S A;  1IKJ A;  1SWK A;  3HWD A;  4GKC A;  2BLG A;  3BRN A;  2RTR B;  4I6S A;  1FJ1 E;  3BY0 A;  4XMF A;  2AL0 X;  1U0X A;  1KL5 A;  3APX A;  1SWL A;  1K24 A;  3EMM A;  4OEL A;  5EED A;  1GKA A;  4U8U N;  1T0V A;  1SA8 A;  1BEB A;  3KZA A;  4BOE A;  1KFF A;  1S7D A;  3KFI A;  3O19 A;  2FS7 A;  3UAQ A;  3ZUI A;  1VWA B;  4YDA A;  4BBO A;  4UU2 A;  2DM5 A;  1QY0 A;  4WBK A;  3E3C A;  2MHD A;  1SWT A;  3RWX A;  3DTQ A;  4MVL A;  2WSJ A;  1YIV A;  4K19 A;  2VFB A;  4Z2O A;  5IO7 A;  5CHK A;  2BHV A;  2RTE B;  4OMW A;  3T1D A;  4IRW A;  5HZ5 A;  5C0N A;  2PFR A;  4GGR A;  1SMP I;  3KVN A;  4TNN A;  3RDO A;  1ACD A;  1XKI A;  2CBR A;  1URE A;  3FA9 A;  1ICM A;  3NPO A;  2X4M A;  1OPA A;  2IZH B;  3F6Z B;  3KQ0 A;  1SWO A;  4ZR2 A;  2FR3 A;  1KT6 A;  3WJG A;  2X55 A;  3PED A;  5IO6 A;  5H9A A;  3NX2 A;  1CBR A;  1DZP A;  3ZUO A;  2PY1 A;  2OY5 O;  5F6Z A;  5BVS A;  5JR8 A;  5B11 O;  4CPF A;  4Y59 A;  4CDD A;  3APW A;  4I60 A;  5LJK A;  1GT1 A;  4HPA A;  2AMM X;  5H9K A;  2POA A;  1VYG A;  4A1Y A;  4CDC A;  3P24 A;  3D97 A;  1H91 A;  2AT6 X;  3TZS A;  1S2P A;  4C5P A;  2R73 A;  1X71 A;  5LJE A;  3PH5 A;  3VG4 A;  3WXQ A;  4NYR A;  4COT A;  4EXZ A;  4GNY A;  1FTP A;  4XMG A;  1WUB A;  3SZH A;  4BJ8 A;  2AF5 A;  1JMX A;  2QOS C;  3KFH A;  4GH7 A;  4MVE A;  4DCB A;  4YFR A;  1ERB A;  4YKM A;  2WEX A;  3CQN A;  5CSE A;  2AVI A;  3SZJ A;  1TOW A;  5HBS A;  4JGL A;  1EI5 A;  1LCV A;  1STR B;  4IB9 A;  3VG6 A;  2IZG B;  1PM1 X;  4U46 A;  1JIW I;  1EPA A;  2RTK A;  3CBS A;  4QZU A;  3B2I A;  3P6F A;  2IZK A;  3CKG A;  2OL6 O;  1E06 A;  1SLE B;  4O4U A;  2K62 A;  4ORR A;  4YFQ A;  3G7X A;  2L5P A;  4QZT A;  1E5P A;  1O1V A;  3PQS A;  1E02 A;  1VWD B;  2GH7 A;  3DSZ A;  5FAZ A;  5H8T A;  3SOT A;  3FDC A;  1DZM A;  2AKQ A;  2QM9 A;  3IA8 A;  2G79 A;  3C76 X;  3QQ2 A;  3EM0 A;  5D4A A;  4O3W A;  4I95 A;  4U9C A;  3RDM A;  1SWG A;  3JQO A;  4OS8 A;  2JOZ A;  5KHP A;  3X00 A;  1W5R A;  2JMB A;  3NP1 A;  3RKG A;  2OF8 A;  1Y9L A;  4CSB A;  3STM X;  2ASN X;  2RTC B;  3HOL A;  1HXZ A;  3EBK A;  4HFO A;  2IZC B;  1HMR A;  2LFO A;  3T6L A;  1QG5 A;  2FWV A;  4ZCB A;  4RUU A;  4EKV A;  4ZHF A;  1SRJ A;  5HTD A;  1DV9 A;  3QKG A;  3FA7 A;  1PBY A;  1ADL A;  4AZM A;  1NGL A;  3RDS A;  1TW4 A;  1KQW A;  1UYO X;  3BDR A;  2AT8 X;  1SWQ A;  3ZI8 A;  3Q34 A;  2OFR X;  4AZQ A;  1EAL A;  1X8Q A;  3UEX A;  1VWP B;  2L68 A;  1DF3 A;  2GTF X;  4FBO A;  1Y55 X;  5B2A O;  2NNQ A;  4BX6 B;  2OVA A;  3TF6 A;  4YBU A;  4ORW A;  1O8V A;  1KT7 A;  4YGH A;  1W6F A;  3MVF A;  1B4M A;  1KOI A;  2ZSC A;  5BVT A;  1ZNG A;  4B55 A;  2NNE A;  3MM0 A;  5IRA A;  4CDE A;  2UYW A;  1YWD A;  2FT9 A;  3STN A;  2KTS A;  1BWY A;  3ZZV A;  4BX7 B;  4TKJ A;  2F09 A;  3PH6 A;  4NLI A;  2UZ2 A;  1N43 A;  4KII A;  4OS0 A;  2X32 A;  3WBG A;  3WJD A;  2OY7 A;  1Y52 X;  2VFC A;  1QY1 A;  3VG5 A;  4HPD A;  2GTL O;  1SRF A;  5EDC A;  1LFO A;  2W2F A;  2OY8 A;  4NV8 A;  1GX9 A;  5AJB A;  1VWM B;  5HA1 A;  5HZ8 A;  4Z6J A;  1PBO A;  1SRI A;  3F8A A;  5EPQ A;  2OVD A;  3AUM O;  1Z24 A;  4GUZ A;  4AZP A;  4Y0R A;  2CAM A;  4ZHH A;  2LA7 A;  4O4S A;  3SLO A;  4EFG A;  1OPB A;  1MM9 A;  4MVI A;  5HA0 A;  1I9H A;  1I05 A;  3NBX X;  2E4J A;  4GRJ A;  4YH0 A;  4YMY A;  1LF7 A;  1JQP A;  1YWB A;  3HPE A;  1KXO A;  2KT4 B;  4BGF A;  2QO5 A;  1NC9 A;  2WR6 A;  4MIS A;  5EZ2 A;  1SRG A;  4ZFX A;  1LNM A;  1FEM A;  4QRL A;  2OFM X;  4DQ3 A;  4YFP A;  2A0A A;  2PQT A;  3ZQ3 A;  1OBU A;  2JW1 A;  4YVB A;  1FEL A;  2FKG A;  1TOU A;  2IZJ A;  4YKO A;  1RXJ A;  5D45 A;  5CE4 A;  1VYF A;  3CMP A;  3I0A A;  1ZNK A;  2LBA A;  1BSO A;  1BRP A;  1VWK B;  1KT5 A;  4RUN A;  3T2X A;  3WJF A;  4QAE A;  4BQU A;  3VG7 A;  1TXL A;  2N93 A;  2RTO B;  3RE5 A;  4D6B A;  2G78 A;  1SWF A;  1JJJ A;  4IB6 A;  4GGZ A;  5KID A;  1RLB E;  1HY2 A;  2F01 A;  3VGW A;  4GK9 A;  1CBI A;  2BT9 A;  2RTH B;  1STS B;  1RBP A;  3AEH A;  3BS2 A;  3FYF A;  3BU9 A;  3KFG A;  4LKP A;  4QGW A;  2FKJ A;  4NNT A;  1LUQ A;  1BRQ A;  1CBQ A;  2A2U A;  1YWA A;  3BX8 A;  5B29 A;  1A18 A;  4BX6 A;  5LKE A;  1N9Y A;  5IRW A;  1SWP A;  1T68 X;  5K06 A;  1YWC A;  1ERX A; 
#chains in the Genus database with same CATH homology
 1GEC E;  3OF9 A;  1PPP A;  1NQC A;  4BPV A;  3DF0 A;  1CV8 A;  1S4V A;  1CPJ A;  3BPF A;  9PAP A;  1KHP A;  2PAD A;  1W4T A;  3WXF A;  2PRE A;  1EWM A;  1MIR A;  4N8W A;  1CSB B;  4QRX A;  2XU5 A;  1NLJ A;  1A6R A;  2AIM A;  1GMY A;  2FRQ A;  3CBK A;  2E02 A;  5J94 A;  4QRV A;  4AXM A;  2DC6 A;  2DC8 A;  3CBJ A;  1EWL A;  2BSZ A;  3M99 A;  3QT4 A;  3E1Z B;  2R9O A;  2XU3 A;  4MZS A;  3MHS A;  1MEG A;  3RVW A;  3K8U A;  4OEM A;  3H89 A;  1AU2 A;  2G8J A;  3IV2 A;  4HWY A;  1NB3 A;  1F2A A;  2WBF X;  2DCB A;  3P5V A;  1O0E A;  1TL9 A;  3B79 A;  3BPM A;  1ITO A;  5F02 A;  3IUT A;  3ZUA A;  4CZW A;  3KSE A;  2FTD A;  3PBH A;  2IBI A;  4PI3 A;  1PIP A;  3NHE A;  4X6I A;  1ATK A;  2YJ2 A;  1PXV A;  3K24 A;  1BQI A;  2ATO A;  3MOR A;  3P5X A;  1NB5 A;  4W4U A;  4YVA A;  3USV A;  3QSD A;  2DCD A;  1BP4 A;  1QDQ A;  5EF4 A;  2G6D A;  2R9C A;  4CDF B;  1KXR A;  2YJB A;  1GCB A;  1DF0 A;  3LTW A;  4BS6 A;  1CJL A;  1PCI A;  1K3B B;  2G8E A;  3IMA A;  2CIO A;  2DZZ A;  3IOQ A;  2F7D A;  1VSN A;  5CVO B;  1TLO A;  2VHF A;  1U9X A;  1AYU A;  2NQA A;  4PP1 A;  4NV7 A;  1TU6 A;  4RY2 A;  1CTE A;  1EF7 A;  3IEJ A;  4MSX A;  2HD5 A;  3PDF A;  1AEC A;  1ZCM A;  3PW3 A;  4BQV A;  2FO5 A;  2R6N A;  1ZIV A;  4K7C A;  3D6S A;  4FJC A;  1AU0 A;  2BDZ A;  4YYR A;  1QMY A;  1AU4 A;  1DEU A;  2P0R A;  3D9W A;  1E2T A;  1GX3 A;  5K16 A;  2OP3 A;  3RVX A;  1AYV A;  1NL6 A;  1NPZ A;  4PAD A;  2ARY A;  2R9M A;  4Q8G A;  2GHU A;  2DCC A;  4FK5 A;  1CB5 A;  4N4Z A;  3HHA A;  3IHP A;  3MTN A;  1U9W A;  2AYO A;  1CS8 A;  1YVB A;  2DJG B;  7PCK A;  3F75 A;  2YJ8 A;  1EWO A;  3ERV A;  4X6J A;  2HH5 A;  2P86 A;  3CH3 X;  1PBH A;  4BS5 A;  3KWB X;  1AIM A;  3OF8 A;  4G54 A;  4YV8 A;  1M6D A;  2FYE A;  8PCH A;  1KHQ A;  2BDL A;  5JH3 A;  4QH6 A;  1F2B A;  2NQI A;  2OZ2 A;  1SNK A;  2VHS A;  3BWK A;  2B1M A;  2R9N A;  3BC3 A;  1X9Y A;  2O6X A;  2R9F A;  2CB5 A;  4Q8H A;  3KX1 A;  3HD3 A;  1FH0 A;  1U9V A;  2DC9 A;  4CDD B;  2G7Y A;  1MEM A;  3O1G A;  1Y4H A;  1Q6K A;  4CDC B;  4P6E A;  4AXL A;  1THE A;  2E00 A;  2F1G A;  3WXG A;  3BOW A;  3N3G A;  1F29 A;  3K9M A;  2XU4 A;  2PBH A;  4DMX A;  4N79 A;  1XKG A;  1Y08 A;  2PNS A;  1ICF A;  3AI8 A;  1MHW A;  2HHN A;  1GLO A;  3QJ3 A;  2NQG A;  3MHH A;  4OEL A;  3GCB A;  5A24 A;  5CVN B;  2E01 A;  3KW9 A;  4FIP A;  1EWP A;  1U5I A;  2HXZ A;  2VFB A;  2FRA A;  4X6H A;  1PPD A;  4I05 A;  2FQ9 A;  2OUL A;  1PAD A;  3N4C A;  3OVZ A;  4P6G A;  1PPO A;  1MS6 A;  1ME4 A;  1KFX L;  3C9E A;  4W5B A;  2DCA A;  4W5C A;  4CDE B;  3OIS A;  3OVX A;  4C5P A;  1QOL A;  1CVZ A;  5CHT A;  1POP A;  5PAD A;  2H7J A;  4XR7 A;  4MZO A;  3CH2 X;  3LXS A;  2ACT A;  1YAL A;  1KFU L;  4XUI A;  3KWZ A;  2YJ9 A;  3TNX A;  4WA6 A;  3S3R A;  3F5V A;  4ZUX U;  1VJV A;  2XU1 A;  2B1N A;  3V6C A;  3WXE A;  4KLB A;  2JQG R;  2AS8 A;  3I06 A;  4I07 A;  2YJC A;  3HWN A;  1BGO A;  1W5R A;  1F2C A;  3KKU A;  1CQD A;  2Y6E A;  1STF E;  5CVM A;  1YK7 A;  1SP4 B;  6PAD A;  3HHI A;  2IPP B;  3RVV A;  1PPN A;  1AYW A;  2P7U A;  1YK8 A;  3LFY A;  4YYU A;  1W6F A;  2AU1 A;  4B55 A;  2FT2 A;  2AVW A;  2JQF R;  4YYS A;  4YYW A;  2NQD B;  1PE6 A;  4PP2 E;  2VFC A;  3KFQ A;  4BSQ A;  4NV8 A;  1AU3 A;  3PNR A;  2C0Y A;  4DMY A;  2Y5B A;  4GUZ A;  3O0U A;  3V6E A;  1JQP A;  1YT7 A;  3P5U A;  4BGF A;  3S3Q A;  3P5W A;  4YYV A;  4QRG A;  3N3K A;  5FPW A;  2DC7 A;  5JA7 A;  4QBB A;  3H8B A;  2AYN A;  2GFO A;  1U9Q X;  1ME3 A;  1QXP A;  3H6S A;  2AUX A;  3BCN A;  1IWD A;  2AUZ A;  3H7D A;  3H8C A;  2DZY A;  5EGW A;  1HUC B;  4YYQ A;  1MDW A;  5CHV A;  2E03 A;  2DJF B;  4I04 A;  2FUD A;  1BY8 A;  3U8E A;  3I3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...