4GUZA

Structure of the arylamine n-acetyltransferase from mycobacterium abscessus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
284
Chain Sequence
b'VPRGSHMWNGDELQLDEYLAFIGFDGDRSPTLETLRRLQRGHVLNIKWENLDAVLHKHVALDIPAVQAKLLRSPRGGYCYEHVALFGAVLQRLGFDFYGIQGRVQMGATTIRPATHGMLVVRLAAEQWLCDVGFGTSPLAPIRLVDEAVVADESWTYRLRRGEVTPGADGWTLSEAAGDGSEPGWLSRHTFVLEPQYPIDYRAASYFVASSPHSPFSTRAFVQQISPDHAYILDHRELHEIQPGVGRKTRQLTPAEVLATLREIFGIELGADDSTLLLERLAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable arylamine n-acetyl transferase
molecule tags Transferase
source organism Mycobacterium abscessus
publication title Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
rcsb
total genus 86
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4guzA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4guzA01
4C5PA 1GX3A 4NV8A 4B55A 2VFCA 3LTWA 4GUZA 4BGFA 3D9WA 1W5RA 2BSZA 1E2TA 2VFBA 1W6FA 4NV7A 1W4TA
chains in the Genus database with same CATH superfamily
1Y9TA 4ZHCA 3D4RA 3CKGA 4GGZA 3HPEA 1KT3A 2HKDA 3QKGA 4Z27A 3TGCA 3VU1A 1BSOA 1OEEA 1YP6A 4GKCA 3WJEA 2MO5A 2BLGA 2RTMA 1SY0A 4I9RA 3RDSA 2R56A 3RZYA 4XMCA 4QYNA 3ZW1A 1X8PA 3C78X 2A2GA 3RDXA 1DZMA 3PH6A 1X8OA 2BS6A 3BX8A 3L4RA 4U46A 2FKJA 3G7XA 5HZ5A 1EIIA 3D97A 2KW1A 3APVA 4ORSA 1HXZA 4O3YA 2AF5A 4GGRA 4QGWA 5D4AA 4OKAA 4U3QA 2NNQA 2OF8A 3KZAA 3IFBA 4YFPA 1SWOA 4U8UN 3BRNA 2DJGA 1VYOA 3ZZVA 4YBUA 1SWJA 4ML7B 5HBSA 3U0DA 4NP1A 1I4UA 3VHHA 2IZLB 1AVDA 2IZAA 4IB9A 4A1HA 2CM4A 4C5PA 1SRIA 2WSJA 4CDDA 4CPHB 4NNSA 1MX8A 4EXZA 2JU8A 1VWQB 2MM3A 4UU2A 3VG7A 3ZUOA 1NDJA 1PEEA 1I04A 4YGHA 2RTCB 2X8SA 1BRPA 1E06A 1STSB 2CZUA 3VHIA 2RD7C 3B2KA 2PY1A 3MBTA 1T8VA 2BT9A 1N7YA 4NYRA 1D3SA 4O4UA 4YMYA 1KL3A 2JOZA 1SRGA 1GX8A 2LFOA 2QO4A 1FEMA 1I9HA 2RTGB 2RTIB 4LQZA 4RUUA 3CQNA 4Z2OA 1CBIA 1TW4A 1Y55X 4D6BA 4Y0PA 2CAMA 1RSTB 4D6AA 2PI3O 3NP1A 2L68A 4GJSA 4BX7A 1BLRA 3HWDA 3FA8A 2OVDA 1GXAA 1SXYA 2CBRA 2IZJA 3NPOA 4QAEA 4YFQA 1MOYA 1OEKA 1ZNGA 3EW1A 1KT5A 2NNDA 1KZWA 2X46A 2IZIA 4O3WA 1GGLA 1G74A 2RTHB 1UZ2X 3RSWA 1RXKA 3TZSA 1OBQA 2CZTA 3EBKA 1YWCA 2FS6A 3HWGA 2A0AA 5DG4A 4OEMA 4ZHGA 1AB0A 1X8UA 1B8EA 2ASNX 4YCEA 1NBXA 5HZ6A 4YKMA 3PPTA 4HFOA 1O8VA 2FR2A 3UEUA 1QQSA 3WYPA 2LKKA 4Z28A 1JYJA 3PDFA 3ZQ3A 4AW8A 2JW1A 2ACOA 1VWNB 4ALBA 1VYFA 3WVMA 4TKJA 3CMPA 2C4IA 4Y0QA 5LKFA 2FGSA 2IZHB 1K24A 3WBGA 3CQRA 4AZMA 5F6BA 2R73A 4ES7A 1HXLA 1HQQA 2FRSA 2RTQB 3D96A 1A57A 5LJEA 2G5LA 5K68A 2GTLM 3HOEA 4BCSA 3P24A 4EEJA 1HBQA 1SRFA 3BY0A 4ON1A 4QGVA 5B5GA 2OY8A 4A1YA 1LELA 2WR6A 5BYPA 1CJ5A 3EW2A 4FBOA 2LBVA 2CBSA 2POAA 5HA0A 1SXUA 1LIEA 4O4XA 5HAEA 4O3ZA 2FHNX 3FEPA 4JHQA 4BGFA 3SLJA 4YFRA 4KT5A 1SLDB 1RBPA 1AVEA 3RE5A 3KVNA 3OE3A 1MUPA 1VWRB 4INNA 4O4SA 2K62A 5KHPA 3RDOA 1DFVA 4Y5DA 2XKLA 4BX6B 2X56A 4DCBA 3QQ2A 3ZW0A 1ICNA 4ZFXA 3PP6A 2YMSA 3RKGA 3FENA 3JS1A 2VDFA 4GDZA 1AQBA 4O9SA 5EDBA 3VE2A 1TVQA 3CBSA 4FGIB 1ADLA 1P6PA 2ZAGA 1GT1A 1H91A 1T68X 1VYGA 2XSTA 4KC7A 1GKAA 2IJAA 3NQKA 1IKEA 4TQ2A 3WXQA 2ZSCA 2IZDB 5KICA 5F58A 3P6HA 2OL7A 2QOMA 2JN3A 2W2FA 5AJBA 2RTLA 1EIOA 1PBOA 3AEHA 1L6MA 3EC5A 4DQ3A 4DQ4A 3VPJE 5IO5A 4PJ2A 2WQAE 1KL4A 3RDQA 2BHVA 4JO6A 1VWOB 2WEXA 1LNMA 2X55A 3ELXA 2GTFX 3P6DA 4GETA 3O2YA 3B2IA 1BJ7A 1X8NA 3BU9A 2IZGB 1KFFA 4TLJA 2ACPX 4ORWA 4EDEA 4AZRA 4ID2A 1DZKA 1CBSA 1N9MA 1GT5A 1MEPA 1PM1X 3FEKA 3Q6LA 5EEDA 3STKA 4AYHA 1SXXA 1KT6A 1LIDA 4IRWA 4I6SA 4UU3A 1RLBE 2LA7A 2GJ5A 4JNJA 4YGGA 4MIRA 1OPAA 3I0AA 1A3YA 1CBQA 4XMEA 5EZ2A 1HMTA 1NP1A 2RTOB 5BVQA 5DPQA 1SWUA 2A8GA 5CSEA 1VWBB 4I60A 1KQXA 1ML7A 1RAVA 1XKIA 4IB6A 3P6GA 4CPIA 1N9YA 4NV8A 2R74A 3KFFA 1MX7A 4XMHA 5EDCA 3HTYA 5H9NA 2RTDB 1SY3A 2DM5A 3MX7A 4NLJA 4ZHDA 4I9SA 1BEBA 1HN2A 1Y9LA 3CBCA 3X00A 1JMXA 4MISA 2IZBA 1LFOA 1MM9A 4QGXA 1EUOA 2OVSA 2G8CO 4GJVA 4NNTA 1B0OA 3FR5A 4CK4A 4ZGFA 3I17A 3WJBA 4ZHHA 4I3CA 3HOLA 3VG5A 5AEOA 1ZNLA 4IMNA 4KIIA 3VGWA 2VFBA 4HPAA 5HTEA 5HZ9A 1AELA 2ANSA 1DZJA 3BX7A 1JJUA 3ZW1B 1ZNDA 5CE4A 3KFHA 1FJ1E 3OBLA 4CSBA 1B4MA 2GH7A 5KIDA 4OS3A 1MK5A 3DSZA 1VWFB 1BM5A 1DV9A 1ZNKA 3VE1A 3RY2A 4BX6A 3TGBA 2JU7A 1IKJA 4NLIA 1LIBA 3O19A 3PK2A 5IRUA 1GX3A 1VWDB 5FENA 1G5WA 1RSUB 2A3FX 2MHDA 1SWLA 1KOIA 4ORRA 1ALBA 2AT0X 2RTEB 4LKPA 5B10O 1OBPA 4IBAA 2AH7X 3ZW0B 4ZHFA 4QQ1A 2Z4HA 1SWEA 2RTFB 3FW5A 1U0XA 3RDMA 4PSQA 2BC3A 1WUBA 2WPUA 5H9LA 5D48A 5LJDA 1OBUA 1QABE 2FWVA 2RCQA 2UYWA 5FFHA 5B3MO 3ZW2A 1A2DA 1NQNA 3ZI8A 4MVLA 5FQ8E 1W6FA 4HPCA 3C76X 4YKOA 1FE3A 2PFRA 4HPDA 4ALOA 2FKGA 5AJCA 1JJXA 3GE2A 1FDQA 1EXSA 3P6EA 5FAZA 4Z2VA 5LJBA 1JZUA 2IZEB 4WFVA 2AMMX 3NR3A 5B27A 1KQWA 1HQPA 1VWGB 4OS0A 3LV4A 1NC9A 3D9WA 1X71A 5CHKA 3PECA 2Y32A 3KFGA 4QYPA 5K67A 4QZUA 2EU7X 4NV7A 2IZKA 3APXA 3Q34A 3RY1A 3SLOA 3SAOA 4ARHA 4DMOA 2C1SA 4U8UM 4Z2PA 1VWKB 4GRJA 2X8TA 2RA6A 2MJIA 3FELA 2FR3A 1W4TA 1VWCB 2KTSA 5HWZA 1IW2A 2RTNB 3WZNA 3RE6A 1NGLA 1VWJB 3IA8A 1QY2A 1SY1A 1XCAA 2OF9A 3BS2A 4GZVA 3TGAA 2RTRB 4BQUA 4ODDA 1LDQA 1QFTA 3GAQA 4BBOA 3T6FA 1DC9A 4IB8A 4BVMA 1BWYA 3B2LA 1PTSA 5B2AO 4YDAA 3T2WA 5LKEA 4WHIA 2RN4A 1EW3A 4KH8A 1Y53X 2I5VO 4WFUA 4BX7B 4CPFA 5F2BA 1NP4A 1E5PA 1S44A 4COTA 2VFCA 4Y59A 4EQAC 1KT4A 1VPRA 4KC8A 1N4JA 3OJYC 2GTLO 4K19A 1GT4A 4YCHA 1Y52X 1A18A 2OVEA 3WZQA 5F6ZA 5F1EA 3AKMA 4IAXA 1SWDA 5D47A 2NNEA 1R0UA 2OVAA 3WOVA 1B56A 2Q9SA 2OL6O 4GK9A 2C1QA 1G85A 3VG2A 5HA1A 3BLGA 4OS8A 5HCDC 4CDCA 3WYQA 3VG3A 2IFBA 1X89A 1ZNEA 3FMZA 1AVGI 2BS5A 4O4OA 4CPHA 1SWKA 4FBRA 3U03A 1SWSA 2RQ0A 2K23A 2F09A 3OD9A 2KT4B 3FIQA 2X45A 3JQOA 4MVEA 4OMWA 5IXGA 1K3BA 1SLFB 5BVSA 3SZHA 5EPQA 1JYDA 4CPEA 5F7GA 5FQ6E 4A60A 1SWCA 1VWHB 1JBHA 1VWPB 2AT6X 2QMIA 4TKHA 1SWAA 3B2JA 3LHNA 3PQUA 1CRBA 1JV4A 2QM9A 4FQBB 3F6ZB 5JR8A 3FA9A 1DF8A 1RXJA 3BDRA 3PEDA 2JMBA 2LB6A 3FYFA 1GKAB 2X32A 1D2UA 1PBYA 4GH7A 2Q4NA 5L8IA 5B29A 4MVIA 4LKTA 1CBRA 2IZFB 1HBPA 3VG6A 2HZQA 5HCEC 2AL0X 3WJGA 4WBKA 4O49A 2RTJA 2L5PA 4YDBA 1SWQA 2LBAA 4ZGUA 3S60A 1EI5A 5IRWA 1SREA 4XMDA 4TKBA 1SY2A 2A2UA 1SA8A 3O22A 1KZXA 2RTKA 1TXLA 1YWDA 2W2BA 3E3CA 4BX5A 5BVTA 1LCWA 1NQMA 2GC9A 3APWA 4YVBA 2HLVA 2W2AA 3WJDA 1IFBA 1KXOA 3KFIA 1QY0A 5AQ6A 2OL8O 1YIVA 2YG2A 2FLJA 2QCBA 4L1NA 3T1DA 4RUNA 5EEEA 1KGLA 3ZWEA 1SMPI 4GE1A 4A8ZA 4GNYA 4ZH6A 4BOEA 3KQ0A 4GNWA 3FLLA 3NQ3A 4ZCBA 5B11O 5LJCA 2F73A 5HZQA 1GM6A 1IFCA 4TNNA 1TOUA 1LICA 4FBVA 2ALLX 3T6LA 2OY1O 2NP1A 3EM0A 2X8FA 4GDAA 3P6CA 4QZTA 2GTLN 3RWXA 4ORXA 3CR6A 4LZVA 1SWHA 2UZ2A 1S2PA 3WZPA 4AZPA 3H3IA 3LTWA 3NQ9A 5HZ8A 5D8JA 1I05A 1I06A 2OFRX 1JQPA 5H9AA 1Y0GA 4MVKA 3P02A 1S7DA 4NW4A 4Y0RA 4CDEA 5LJHA 2FHLA 4IAWA 4B55A 5CYBA 2KTDA 3EMMA 1SWBA 2OY7A 3AUMO 1EPAA 2QO6A 1OPBA 4KCAA 3VG4A 3F9DA 2OFMX 4LZUA 1SWRA 2M4LA 4BX5B 1IJ8A 3ZUIA 4R0BA 1U18A 1U17A 1ZNHA 4NYQA 1LPJA 4ZH9A 3NX2A 1E2TA 1OSPO 3EBWA 1RXHA 1HY2A 2E4JA 2OFAA 3AKNA 5IO6A 1JJJA 2G7BA 3PQSA 2O62A 2CM9A 1VWLB 1EPBA 1EQDA 2DJFA 1YP7A 2FT9A 1BSYA 1O1UA 1Z24A 2QO5A 3STMX 3V8UA 4YBPA 2PQTA 5L8OA 1KT7A 1GT3A 2HMBA 4I95A 3TF6A 2OZQA 5L8NA 1G7NA 1WBIA 2OFBA 3BSZE 1LDOA 2AKQA 2G79A 1JMZA 1SXWA 1QWDA 4EFGA 2QOSC 2HNXA 2JGSA 2A5BA 3EYCA 4L3RA 4OMXA 2X4MA 3PH5A 2A13A 5IO7A 2WEWA 2AT8X 3F8AA 3FIDA 1SWTA 2FS7A 1E00A 1JIWI 4U8UO 3RDUA 2BSZA 2AVIA 1SWFA 2IZCB 3N91A 1STPA 4M7MA 3UEWA 1FENA 3UAQA 4XMFA 1LKEA 1LUQA 1ERXA 1UYOX 3FA6A 3C77X 3HWEA 2P8GA 4GU8A 2I5ZO 1EALA 3CKFA 1SWNA 2HYSA 1MDCA 1E02A 2AT3X 2KD2A 3WJFA 4IB7A 2AT5X 1QG5A 1YWBA 4JGLA 5HTDA 3HWFA 3HK1A 1UREA 2L9CA 3MVFA 2MF6A 1LCZA 3S5VA 3FR4A 2G78A 1HMRA 1T0VA 3NX1A 4I3DA 3SOTA 1BRQA 1ZRYA 1ERBA 1LCVA 1PMPA 4ORUA 5FQ7E 3FW4A 2WWPA 2X34A 4YGZA 4XMGA 4QRLA 4N7CA 3STNA 1SWPA 1O1VA 1LF7A 4I3BA 4CV7A 1IIUA 2Q2PA 2JU3A 1ACDA 3K3LA 3P6FA 5D45A 3UEXA 4AZNA 1STRB 4TJZA 3APUA 5IRAA 3FA7A 4HPBA 4N7DA 2L67A 2Z4IA 4QNIA 1ICMA 3NBXX 2Y3FA 4IMOA 5H8TA 3D95A 1VWAB 4GUZA 4AZOA 2RTAA 4YH0A 1MVGA 4ZJ0A 3MM0A 3T2XA 4M6SA 1UYNX 1FELA 1BSQA 1YWAA 2N93A 3S5XA 2ZAIA 5LJKA 2A5CA 3S26A 2FTBA 1DZPA 1N43A 3NADA 4O3XB 1DF3A 1SLGB 3UEVA 3CWKA 5L3YA 4EKVA 4IABA 2RCTA 1GX9A 4CDFA 1I78A 3FDCA 5K06A 1SWGA 1X8QA 2Y3EA 3U9PC 1SRHA 4ZR2A 1YUPA 4BJ8A 2HZRA 3SLTA 1HMSA 1VWMB 3ELZA 4GD9A 4Z6JA 2RTPB 1LIFA 2RTBB 3DTQA 3MG5A 2WQ9A 4MEEA 5H9KA 1VWIB 2WUTA 2Q39A 4Y0SA 4AZQA 5JD2A 3SZIA 3LNBA 1SLEB 3BU1A 1FTPA 3JSQA 1N0SA 1W5RA 3B2HA 1OEJA 4ORYA 3VHMA 1BBPA 2OY5O 3FR2A 3WZOA 1VWEB 2F01A 2MWHA 1QY1A 5LJGA 4DNEA 1KL5A 4OELA 3WJCA 3RBYA 5C0NA 2OYBO 4U9CA 3SZJA 1TOWA 1QFVA 2Q2MA 4GGTA 4HWMA 5B5FA 1SRJA 5HCCC
chains in the Genus database with same CATH topology
9PAPA 1GMYA 3RVVA 4QRXA 4KLBA 4W4UA 4YYUA 4BS5A 3CBJA 1PPNA 3GCBA 1QXPA 4N8WA 1EWMA 2ACTA 3CBKA 1A6RA 3IMAA 4FIPA 1CSBB 1K3BB 2ARYA 1EF7A 1PPDA 3HHIA 4C5PA 2DC6A 1F29A 1SP4B 3K8UA 4BS6A 2R9MA 2AIMA 2YJ8A 4MSXA 1CQDA 1CJLA 4P6GA 3ZUAA 1YVBA 2PADA 2E02A 4MZOA 4YYWA 3B79A 2NQIA 3I06A 1GCBA 1PBHA 3O1GA 2E00A 2HXZA 5EGWA 1Y4HA 1NB3A 3P5UA 3D6SA 1AYVA 1Q6KA 4BQVA 2JQFR 1CVZA 1GLOA 4OEMA 1BY8A 3V6EA 1VSNA 1CB5A 3PDFA 3BWKA 1YK7A 3PNRA 2HHNA 1EWLA 1U9QX 2NQGA 3P5VA 3E1ZB 1X9YA 1ME4A 1YALA 3OISA 4X6HA 3WXEA 4YYSA 2FT2A 4G54A 1QDQA 4BGFA 4CDFB 2CB5A 2DZYA 1YT7A 3H8BA 1MS6A 4W5BA 3V6CA 2E01A 2BDZA 4PI3A 4DMYA 2YJ9A 4K7CA 1QMYA 6PADA 2G7YA 1YK8A 4I05A 2OZ2A 1NB5A 1CV8A 1BP4A 2DC9A 2AYOA 2B1NA 1SNKA 1ICFA 3RVXA 4PP1A 1ATKA 2AS8A 2XU5A 3BC3A 3PW3A 4FK5A 2R9OA 2DC8A 5CHTA 5FPWA 2FTDA 1KFUL 2FYEA 4QBBA 1NPZA 1AU2A 4QH6A 2O6XA 4NV8A 4YV8A 5JA7A 3S3RA 1KXRA 1PXVA 3IOQA 4RY2A 3MHHA 1PE6A 3IUTA 1VJVA 1MHWA 4W5CA 4BSQA 4BPVA 2CIOA 1Y08A 3WXFA 3LFYA 1F2AA 2VFBA 3AI8A 4CDEB 4Q8HA 3MTNA 2F7DA 4XUIA 5K16A 2G8JA 2P86A 3KSEA 1GX3A 1PCIA 2H7JA 3K9MA 2DC7A 2R9CA 2FUDA 2HD5A 1BQIA 1EWPA 3M99A 2YJCA 1MDWA 3OF9A 3QJ3A 2B1MA 2BDLA 2C0YA 1THEA 1W6FA 2XU3A 1STFE 1ME3A 1QOLA 2AUZA 3QSDA 4AXLA 4X6IA 2OP3A 3D9WA 2FQ9A 1F2CA 4YYVA 5JH3A 3HHAA 4NV7A 3N4CA 3N3GA 1W4TA 4YVAA 1KHQA 1U9XA 4N4ZA 1EWOA 2R9NA 3H89A 3KFQA 1CPJA 3U8EA 2DCAA 2YJ2A 1AU4A 3PBHA 1AU0A 7PCKA 2G6DA 3F5VA 1XKGA 2VFCA 3OF8A 2G8EA 3KWZA 3OVZA 3H8CA 2P7UA 1AYUA 2WBFX 3H7DA 2VHFA 3MHSA 4YYQA 3DF0A 4MZSA 4PADA 1M6DA 1PPOA 5EF4A 4ZUXU 4CDCB 2PBHA 3BPFA 3IEJA 4Q8GA 3TNXA 1DEUA 2E03A 1BGOA 2F1GA 1MIRA 1ITOA 1AIMA 3C9EA 1PADA 4I07A 1MEGA 1PPPA 1NQCA 2Y5BA 4WA6A 4CZWA 1GECE 2DZZA 1NL6A 2Y6EA 1HUCB 3MORA 3P5WA 1U5IA 1F2BA 4FJCA 1S4VA 2DCDA 1AU3A 3KWBX 5CVOB 3KW9A 1U9WA 3KKUA 2JQGR 2IPPB 1TLOA 2DCCA 3LTWA 3S3QA 3IHPA 1JQPA 2ATOA 4AXMA 2GHUA 4B55A 4XR7A 2FRAA 3I3TA 5CVMA 4X6JA 2PNSA 3H6SA 1E2TA 2PREA 1MEMA 5A24A 2AU1A 4PP2E 3BPMA 4P6EA 8PCHA 2XU4A 4DMXA 4HWYA 2AVWA 5CVNB 1CS8A 5CHVA 1IWDA 2DCBA 2OULA 3CH2X 2NQDB 2R6NA 1O0EA 4I04A 1ZCMA 2XU1A 3P5XA 3O0UA 2BSZA 1DF0A 3N3KA 1ZIVA 1KFXL 1PIPA 1CTEA 3OVXA 4CDDB 1KHPA 2DJFB 2IBIA 3K24A 4YYRA 2NQAA 2HH5A 1AYWA 3RVWA 2DJGB 2GFOA 5J94A 2FRQA 3CH3X 1AECA 3QT4A 3BOWA 1NLJA 3KX1A 2R9FA 4GUZA 4QRGA 4N79A 2AUXA 3F75A 1TU6A 3BCNA 3HD3A 3LXSA 2AYNA 3WXGA 2FO5A 5PADA 1TL9A 3USVA 3ERVA 1FH0A 1POPA 1W5RA 4QRVA 3IV2A 2P0RA 4OELA 2VHSA 3NHEA 1U9VA 3HWNA 2YJBA 5F02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5P A;  1GX3 A;  4NV8 A;  4B55 A;  2VFC A;  3LTW A;  4GUZ A;  4BGF A;  3D9W A;  1W5R A;  2BSZ A;  1E2T A;  2VFB A;  1W6F A;  4NV7 A;  1W4T A; 
#chains in the Genus database with same CATH topology
 1Y9T A;  4ZHC A;  3D4R A;  3CKG A;  4GGZ A;  3HPE A;  1KT3 A;  2HKD A;  3QKG A;  4Z27 A;  3TGC A;  3VU1 A;  1BSO A;  1OEE A;  1YP6 A;  4GKC A;  3WJE A;  2MO5 A;  2BLG A;  2RTM A;  1SY0 A;  4I9R A;  3RDS A;  2R56 A;  3RZY A;  4XMC A;  4QYN A;  3ZW1 A;  1X8P A;  3C78 X;  2A2G A;  3RDX A;  1DZM A;  3PH6 A;  1X8O A;  2BS6 A;  3BX8 A;  3L4R A;  4U46 A;  2FKJ A;  3G7X A;  5HZ5 A;  1EII A;  3D97 A;  2KW1 A;  3APV A;  4ORS A;  1HXZ A;  4O3Y A;  2AF5 A;  4GGR A;  4QGW A;  5D4A A;  4OKA A;  4U3Q A;  2NNQ A;  2OF8 A;  3KZA A;  3IFB A;  4YFP A;  1SWO A;  4U8U N;  3BRN A;  2DJG A;  1VYO A;  3ZZV A;  4YBU A;  1SWJ A;  4ML7 B;  5HBS A;  3U0D A;  4NP1 A;  1I4U A;  3VHH A;  2IZL B;  1AVD A;  2IZA A;  4IB9 A;  4A1H A;  2CM4 A;  4C5P A;  1SRI A;  2WSJ A;  4CDD A;  4CPH B;  4NNS A;  1MX8 A;  4EXZ A;  2JU8 A;  1VWQ B;  2MM3 A;  4UU2 A;  3VG7 A;  3ZUO A;  1NDJ A;  1PEE A;  1I04 A;  4YGH A;  2RTC B;  2X8S A;  1BRP A;  1E06 A;  1STS B;  2CZU A;  3VHI A;  2RD7 C;  3B2K A;  2PY1 A;  3MBT A;  1T8V A;  2BT9 A;  1N7Y A;  4NYR A;  1D3S A;  4O4U A;  4YMY A;  1KL3 A;  2JOZ A;  1SRG A;  1GX8 A;  2LFO A;  2QO4 A;  1FEM A;  1I9H A;  2RTG B;  2RTI B;  4LQZ A;  4RUU A;  3CQN A;  4Z2O A;  1CBI A;  1TW4 A;  1Y55 X;  4D6B A;  4Y0P A;  2CAM A;  1RST B;  4D6A A;  2PI3 O;  3NP1 A;  2L68 A;  4GJS A;  4BX7 A;  1BLR A;  3HWD A;  3FA8 A;  2OVD A;  1GXA A;  1SXY A;  2CBR A;  2IZJ A;  3NPO A;  4QAE A;  4YFQ A;  1MOY A;  1OEK A;  1ZNG A;  3EW1 A;  1KT5 A;  2NND A;  1KZW A;  2X46 A;  2IZI A;  4O3W A;  1GGL A;  1G74 A;  2RTH B;  1UZ2 X;  3RSW A;  1RXK A;  3TZS A;  1OBQ A;  2CZT A;  3EBK A;  1YWC A;  2FS6 A;  3HWG A;  2A0A A;  5DG4 A;  4OEM A;  4ZHG A;  1AB0 A;  1X8U A;  1B8E A;  2ASN X;  4YCE A;  1NBX A;  5HZ6 A;  4YKM A;  3PPT A;  4HFO A;  1O8V A;  2FR2 A;  3UEU A;  1QQS A;  3WYP A;  2LKK A;  4Z28 A;  1JYJ A;  3PDF A;  3ZQ3 A;  4AW8 A;  2JW1 A;  2ACO A;  1VWN B;  4ALB A;  1VYF A;  3WVM A;  4TKJ A;  3CMP A;  2C4I A;  4Y0Q A;  5LKF A;  2FGS A;  2IZH B;  1K24 A;  3WBG A;  3CQR A;  4AZM A;  5F6B A;  2R73 A;  4ES7 A;  1HXL A;  1HQQ A;  2FRS A;  2RTQ B;  3D96 A;  1A57 A;  5LJE A;  2G5L A;  5K68 A;  2GTL M;  3HOE A;  4BCS A;  3P24 A;  4EEJ A;  1HBQ A;  1SRF A;  3BY0 A;  4ON1 A;  4QGV A;  5B5G A;  2OY8 A;  4A1Y A;  1LEL A;  2WR6 A;  5BYP A;  1CJ5 A;  3EW2 A;  4FBO A;  2LBV A;  2CBS A;  2POA A;  5HA0 A;  1SXU A;  1LIE A;  4O4X A;  5HAE A;  4O3Z A;  2FHN X;  3FEP A;  4JHQ A;  4BGF A;  3SLJ A;  4YFR A;  4KT5 A;  1SLD B;  1RBP A;  1AVE A;  3RE5 A;  3KVN A;  3OE3 A;  1MUP A;  1VWR B;  4INN A;  4O4S A;  2K62 A;  5KHP A;  3RDO A;  1DFV A;  4Y5D A;  2XKL A;  4BX6 B;  2X56 A;  4DCB A;  3QQ2 A;  3ZW0 A;  1ICN A;  4ZFX A;  3PP6 A;  2YMS A;  3RKG A;  3FEN A;  3JS1 A;  2VDF A;  4GDZ A;  1AQB A;  4O9S A;  5EDB A;  3VE2 A;  1TVQ A;  3CBS A;  4FGI B;  1ADL A;  1P6P A;  2ZAG A;  1GT1 A;  1H91 A;  1T68 X;  1VYG A;  2XST A;  4KC7 A;  1GKA A;  2IJA A;  3NQK A;  1IKE A;  4TQ2 A;  3WXQ A;  2ZSC A;  2IZD B;  5KIC A;  5F58 A;  3P6H A;  2OL7 A;  2QOM A;  2JN3 A;  2W2F A;  5AJB A;  2RTL A;  1EIO A;  1PBO A;  3AEH A;  1L6M A;  3EC5 A;  4DQ3 A;  4DQ4 A;  3VPJ E;  5IO5 A;  4PJ2 A;  2WQA E;  1KL4 A;  3RDQ A;  2BHV A;  4JO6 A;  1VWO B;  2WEX A;  1LNM A;  2X55 A;  3ELX A;  2GTF X;  3P6D A;  4GET A;  3O2Y A;  3B2I A;  1BJ7 A;  1X8N A;  3BU9 A;  2IZG B;  1KFF A;  4TLJ A;  2ACP X;  4ORW A;  4EDE A;  4AZR A;  4ID2 A;  1DZK A;  1CBS A;  1N9M A;  1GT5 A;  1MEP A;  1PM1 X;  3FEK A;  3Q6L A;  5EED A;  3STK A;  4AYH A;  1SXX A;  1KT6 A;  1LID A;  4IRW A;  4I6S A;  4UU3 A;  1RLB E;  2LA7 A;  2GJ5 A;  4JNJ A;  4YGG A;  4MIR A;  1OPA A;  3I0A A;  1A3Y A;  1CBQ A;  4XME A;  5EZ2 A;  1HMT A;  1NP1 A;  2RTO B;  5BVQ A;  5DPQ A;  1SWU A;  2A8G A;  5CSE A;  1VWB B;  4I60 A;  1KQX A;  1ML7 A;  1RAV A;  1XKI A;  4IB6 A;  3P6G A;  4CPI A;  1N9Y A;  4NV8 A;  2R74 A;  3KFF A;  1MX7 A;  4XMH A;  5EDC A;  3HTY A;  5H9N A;  2RTD B;  1SY3 A;  2DM5 A;  3MX7 A;  4NLJ A;  4ZHD A;  4I9S A;  1BEB A;  1HN2 A;  1Y9L A;  3CBC A;  3X00 A;  1JMX A;  4MIS A;  2IZB A;  1LFO A;  1MM9 A;  4QGX A;  1EUO A;  2OVS A;  2G8C O;  4GJV A;  4NNT A;  1B0O A;  3FR5 A;  4CK4 A;  4ZGF A;  3I17 A;  3WJB A;  4ZHH A;  4I3C A;  3HOL A;  3VG5 A;  5AEO A;  1ZNL A;  4IMN A;  4KII A;  3VGW A;  2VFB A;  4HPA A;  5HTE A;  5HZ9 A;  1AEL A;  2ANS A;  1DZJ A;  3BX7 A;  1JJU A;  3ZW1 B;  1ZND A;  5CE4 A;  3KFH A;  1FJ1 E;  3OBL A;  4CSB A;  1B4M A;  2GH7 A;  5KID A;  4OS3 A;  1MK5 A;  3DSZ A;  1VWF B;  1BM5 A;  1DV9 A;  1ZNK A;  3VE1 A;  3RY2 A;  4BX6 A;  3TGB A;  2JU7 A;  1IKJ A;  4NLI A;  1LIB A;  3O19 A;  3PK2 A;  5IRU A;  1GX3 A;  1VWD B;  5FEN A;  1G5W A;  1RSU B;  2A3F X;  2MHD A;  1SWL A;  1KOI A;  4ORR A;  1ALB A;  2AT0 X;  2RTE B;  4LKP A;  5B10 O;  1OBP A;  4IBA A;  2AH7 X;  3ZW0 B;  4ZHF A;  4QQ1 A;  2Z4H A;  1SWE A;  2RTF B;  3FW5 A;  1U0X A;  3RDM A;  4PSQ A;  2BC3 A;  1WUB A;  2WPU A;  5H9L A;  5D48 A;  5LJD A;  1OBU A;  1QAB E;  2FWV A;  2RCQ A;  2UYW A;  5FFH A;  5B3M O;  3ZW2 A;  1A2D A;  1NQN A;  3ZI8 A;  4MVL A;  5FQ8 E;  1W6F A;  4HPC A;  3C76 X;  4YKO A;  1FE3 A;  2PFR A;  4HPD A;  4ALO A;  2FKG A;  5AJC A;  1JJX A;  3GE2 A;  1FDQ A;  1EXS A;  3P6E A;  5FAZ A;  4Z2V A;  5LJB A;  1JZU A;  2IZE B;  4WFV A;  2AMM X;  3NR3 A;  5B27 A;  1KQW A;  1HQP A;  1VWG B;  4OS0 A;  3LV4 A;  1NC9 A;  3D9W A;  1X71 A;  5CHK A;  3PEC A;  2Y32 A;  3KFG A;  4QYP A;  5K67 A;  4QZU A;  2EU7 X;  4NV7 A;  2IZK A;  3APX A;  3Q34 A;  3RY1 A;  3SLO A;  3SAO A;  4ARH A;  4DMO A;  2C1S A;  4U8U M;  4Z2P A;  1VWK B;  4GRJ A;  2X8T A;  2RA6 A;  2MJI A;  3FEL A;  2FR3 A;  1W4T A;  1VWC B;  2KTS A;  5HWZ A;  1IW2 A;  2RTN B;  3WZN A;  3RE6 A;  1NGL A;  1VWJ B;  3IA8 A;  1QY2 A;  1SY1 A;  1XCA A;  2OF9 A;  3BS2 A;  4GZV A;  3TGA A;  2RTR B;  4BQU A;  4ODD A;  1LDQ A;  1QFT A;  3GAQ A;  4BBO A;  3T6F A;  1DC9 A;  4IB8 A;  4BVM A;  1BWY A;  3B2L A;  1PTS A;  5B2A O;  4YDA A;  3T2W A;  5LKE A;  4WHI A;  2RN4 A;  1EW3 A;  4KH8 A;  1Y53 X;  2I5V O;  4WFU A;  4BX7 B;  4CPF A;  5F2B A;  1NP4 A;  1E5P A;  1S44 A;  4COT A;  2VFC A;  4Y59 A;  4EQA C;  1KT4 A;  1VPR A;  4KC8 A;  1N4J A;  3OJY C;  2GTL O;  4K19 A;  1GT4 A;  4YCH A;  1Y52 X;  1A18 A;  2OVE A;  3WZQ A;  5F6Z A;  5F1E A;  3AKM A;  4IAX A;  1SWD A;  5D47 A;  2NNE A;  1R0U A;  2OVA A;  3WOV A;  1B56 A;  2Q9S A;  2OL6 O;  4GK9 A;  2C1Q A;  1G85 A;  3VG2 A;  5HA1 A;  3BLG A;  4OS8 A;  5HCD C;  4CDC A;  3WYQ A;  3VG3 A;  2IFB A;  1X89 A;  1ZNE A;  3FMZ A;  1AVG I;  2BS5 A;  4O4O A;  4CPH A;  1SWK A;  4FBR A;  3U03 A;  1SWS A;  2RQ0 A;  2K23 A;  2F09 A;  3OD9 A;  2KT4 B;  3FIQ A;  2X45 A;  3JQO A;  4MVE A;  4OMW A;  5IXG A;  1K3B A;  1SLF B;  5BVS A;  3SZH A;  5EPQ A;  1JYD A;  4CPE A;  5F7G A;  5FQ6 E;  4A60 A;  1SWC A;  1VWH B;  1JBH A;  1VWP B;  2AT6 X;  2QMI A;  4TKH A;  1SWA A;  3B2J A;  3LHN A;  3PQU A;  1CRB A;  1JV4 A;  2QM9 A;  4FQB B;  3F6Z B;  5JR8 A;  3FA9 A;  1DF8 A;  1RXJ A;  3BDR A;  3PED A;  2JMB A;  2LB6 A;  3FYF A;  1GKA B;  2X32 A;  1D2U A;  1PBY A;  4GH7 A;  2Q4N A;  5L8I A;  5B29 A;  4MVI A;  4LKT A;  1CBR A;  2IZF B;  1HBP A;  3VG6 A;  2HZQ A;  5HCE C;  2AL0 X;  3WJG A;  4WBK A;  4O49 A;  2RTJ A;  2L5P A;  4YDB A;  1SWQ A;  2LBA A;  4ZGU A;  3S60 A;  1EI5 A;  5IRW A;  1SRE A;  4XMD A;  4TKB A;  1SY2 A;  2A2U A;  1SA8 A;  3O22 A;  1KZX A;  2RTK A;  1TXL A;  1YWD A;  2W2B A;  3E3C A;  4BX5 A;  5BVT A;  1LCW A;  1NQM A;  2GC9 A;  3APW A;  4YVB A;  2HLV A;  2W2A A;  3WJD A;  1IFB A;  1KXO A;  3KFI A;  1QY0 A;  5AQ6 A;  2OL8 O;  1YIV A;  2YG2 A;  2FLJ A;  2QCB A;  4L1N A;  3T1D A;  4RUN A;  5EEE A;  1KGL A;  3ZWE A;  1SMP I;  4GE1 A;  4A8Z A;  4GNY A;  4ZH6 A;  4BOE A;  3KQ0 A;  4GNW A;  3FLL A;  3NQ3 A;  4ZCB A;  5B11 O;  5LJC A;  2F73 A;  5HZQ A;  1GM6 A;  1IFC A;  4TNN A;  1TOU A;  1LIC A;  4FBV A;  2ALL X;  3T6L A;  2OY1 O;  2NP1 A;  3EM0 A;  2X8F A;  4GDA A;  3P6C A;  4QZT A;  2GTL N;  3RWX A;  4ORX A;  3CR6 A;  4LZV A;  1SWH A;  2UZ2 A;  1S2P A;  3WZP A;  4AZP A;  3H3I A;  3LTW A;  3NQ9 A;  5HZ8 A;  5D8J A;  1I05 A;  1I06 A;  2OFR X;  1JQP A;  5H9A A;  1Y0G A;  4MVK A;  3P02 A;  1S7D A;  4NW4 A;  4Y0R A;  4CDE A;  5LJH A;  2FHL A;  4IAW A;  4B55 A;  5CYB A;  2KTD A;  3EMM A;  1SWB A;  2OY7 A;  3AUM O;  1EPA A;  2QO6 A;  1OPB A;  4KCA A;  3VG4 A;  3F9D A;  2OFM X;  4LZU A;  1SWR A;  2M4L A;  4BX5 B;  1IJ8 A;  3ZUI A;  4R0B A;  1U18 A;  1U17 A;  1ZNH A;  4NYQ A;  1LPJ A;  4ZH9 A;  3NX2 A;  1E2T A;  1OSP O;  3EBW A;  1RXH A;  1HY2 A;  2E4J A;  2OFA A;  3AKN A;  5IO6 A;  1JJJ A;  2G7B A;  3PQS A;  2O62 A;  2CM9 A;  1VWL B;  1EPB A;  1EQD A;  2DJF A;  1YP7 A;  2FT9 A;  1BSY A;  1O1U A;  1Z24 A;  2QO5 A;  3STM X;  3V8U A;  4YBP A;  2PQT A;  5L8O A;  1KT7 A;  1GT3 A;  2HMB A;  4I95 A;  3TF6 A;  2OZQ A;  5L8N A;  1G7N A;  1WBI A;  2OFB A;  3BSZ E;  1LDO A;  2AKQ A;  2G79 A;  1JMZ A;  1SXW A;  1QWD A;  4EFG A;  2QOS C;  2HNX A;  2JGS A;  2A5B A;  3EYC A;  4L3R A;  4OMX A;  2X4M A;  3PH5 A;  2A13 A;  5IO7 A;  2WEW A;  2AT8 X;  3F8A A;  3FID A;  1SWT A;  2FS7 A;  1E00 A;  1JIW I;  4U8U O;  3RDU A;  2BSZ A;  2AVI A;  1SWF A;  2IZC B;  3N91 A;  1STP A;  4M7M A;  3UEW A;  1FEN A;  3UAQ A;  4XMF A;  1LKE A;  1LUQ A;  1ERX A;  1UYO X;  3FA6 A;  3C77 X;  3HWE A;  2P8G A;  4GU8 A;  2I5Z O;  1EAL A;  3CKF A;  1SWN A;  2HYS A;  1MDC A;  1E02 A;  2AT3 X;  2KD2 A;  3WJF A;  4IB7 A;  2AT5 X;  1QG5 A;  1YWB A;  4JGL A;  5HTD A;  3HWF A;  3HK1 A;  1URE A;  2L9C A;  3MVF A;  2MF6 A;  1LCZ A;  3S5V A;  3FR4 A;  2G78 A;  1HMR A;  1T0V A;  3NX1 A;  4I3D A;  3SOT A;  1BRQ A;  1ZRY A;  1ERB A;  1LCV A;  1PMP A;  4ORU A;  5FQ7 E;  3FW4 A;  2WWP A;  2X34 A;  4YGZ A;  4XMG A;  4QRL A;  4N7C A;  3STN A;  1SWP A;  1O1V A;  1LF7 A;  4I3B A;  4CV7 A;  1IIU A;  2Q2P A;  2JU3 A;  1ACD A;  3K3L A;  3P6F A;  5D45 A;  3UEX A;  4AZN A;  1STR B;  4TJZ A;  3APU A;  5IRA A;  3FA7 A;  4HPB A;  4N7D A;  2L67 A;  2Z4I A;  4QNI A;  1ICM A;  3NBX X;  2Y3F A;  4IMO A;  5H8T A;  3D95 A;  1VWA B;  4GUZ A;  4AZO A;  2RTA A;  4YH0 A;  1MVG A;  4ZJ0 A;  3MM0 A;  3T2X A;  4M6S A;  1UYN X;  1FEL A;  1BSQ A;  1YWA A;  2N93 A;  3S5X A;  2ZAI A;  5LJK A;  2A5C A;  3S26 A;  2FTB A;  1DZP A;  1N43 A;  3NAD A;  4O3X B;  1DF3 A;  1SLG B;  3UEV A;  3CWK A;  5L3Y A;  4EKV A;  4IAB A;  2RCT A;  1GX9 A;  4CDF A;  1I78 A;  3FDC A;  5K06 A;  1SWG A;  1X8Q A;  2Y3E A;  3U9P C;  1SRH A;  4ZR2 A;  1YUP A;  4BJ8 A;  2HZR A;  3SLT A;  1HMS A;  1VWM B;  3ELZ A;  4GD9 A;  4Z6J A;  2RTP B;  1LIF A;  2RTB B;  3DTQ A;  3MG5 A;  2WQ9 A;  4MEE A;  5H9K A;  1VWI B;  2WUT A;  2Q39 A;  4Y0S A;  4AZQ A;  5JD2 A;  3SZI A;  3LNB A;  1SLE B;  3BU1 A;  1FTP A;  3JSQ A;  1N0S A;  1W5R A;  3B2H A;  1OEJ A;  4ORY A;  3VHM A;  1BBP A;  2OY5 O;  3FR2 A;  3WZO A;  1VWE B;  2F01 A;  2MWH A;  1QY1 A;  5LJG A;  4DNE A;  1KL5 A;  4OEL A;  3WJC A;  3RBY A;  5C0N A;  2OYB O;  4U9C A;  3SZJ A;  1TOW A;  1QFV A;  2Q2M A;  4GGT A;  4HWM A;  5B5F A;  1SRJ A;  5HCC C; 
#chains in the Genus database with same CATH homology
 9PAP A;  1GMY A;  3RVV A;  4QRX A;  4KLB A;  4W4U A;  4YYU A;  4BS5 A;  3CBJ A;  1PPN A;  3GCB A;  1QXP A;  4N8W A;  1EWM A;  2ACT A;  3CBK A;  1A6R A;  3IMA A;  4FIP A;  1CSB B;  1K3B B;  2ARY A;  1EF7 A;  1PPD A;  3HHI A;  4C5P A;  2DC6 A;  1F29 A;  1SP4 B;  3K8U A;  4BS6 A;  2R9M A;  2AIM A;  2YJ8 A;  4MSX A;  1CQD A;  1CJL A;  4P6G A;  3ZUA A;  1YVB A;  2PAD A;  2E02 A;  4MZO A;  4YYW A;  3B79 A;  2NQI A;  3I06 A;  1GCB A;  1PBH A;  3O1G A;  2E00 A;  2HXZ A;  5EGW A;  1Y4H A;  1NB3 A;  3P5U A;  3D6S A;  1AYV A;  1Q6K A;  4BQV A;  2JQF R;  1CVZ A;  1GLO A;  4OEM A;  1BY8 A;  3V6E A;  1VSN A;  1CB5 A;  3PDF A;  3BWK A;  1YK7 A;  3PNR A;  2HHN A;  1EWL A;  1U9Q X;  2NQG A;  3P5V A;  3E1Z B;  1X9Y A;  1ME4 A;  1YAL A;  3OIS A;  4X6H A;  3WXE A;  4YYS A;  2FT2 A;  4G54 A;  1QDQ A;  4BGF A;  4CDF B;  2CB5 A;  2DZY A;  1YT7 A;  3H8B A;  1MS6 A;  4W5B A;  3V6C A;  2E01 A;  2BDZ A;  4PI3 A;  4DMY A;  2YJ9 A;  4K7C A;  1QMY A;  6PAD A;  2G7Y A;  1YK8 A;  4I05 A;  2OZ2 A;  1NB5 A;  1CV8 A;  1BP4 A;  2DC9 A;  2AYO A;  2B1N A;  1SNK A;  1ICF A;  3RVX A;  4PP1 A;  1ATK A;  2AS8 A;  2XU5 A;  3BC3 A;  3PW3 A;  4FK5 A;  2R9O A;  2DC8 A;  5CHT A;  5FPW A;  2FTD A;  1KFU L;  2FYE A;  4QBB A;  1NPZ A;  1AU2 A;  4QH6 A;  2O6X A;  4NV8 A;  4YV8 A;  5JA7 A;  3S3R A;  1KXR A;  1PXV A;  3IOQ A;  4RY2 A;  3MHH A;  1PE6 A;  3IUT A;  1VJV A;  1MHW A;  4W5C A;  4BSQ A;  4BPV A;  2CIO A;  1Y08 A;  3WXF A;  3LFY A;  1F2A A;  2VFB A;  3AI8 A;  4CDE B;  4Q8H A;  3MTN A;  2F7D A;  4XUI A;  5K16 A;  2G8J A;  2P86 A;  3KSE A;  1GX3 A;  1PCI A;  2H7J A;  3K9M A;  2DC7 A;  2R9C A;  2FUD A;  2HD5 A;  1BQI A;  1EWP A;  3M99 A;  2YJC A;  1MDW A;  3OF9 A;  3QJ3 A;  2B1M A;  2BDL A;  2C0Y A;  1THE A;  1W6F A;  2XU3 A;  1STF E;  1ME3 A;  1QOL A;  2AUZ A;  3QSD A;  4AXL A;  4X6I A;  2OP3 A;  3D9W A;  2FQ9 A;  1F2C A;  4YYV A;  5JH3 A;  3HHA A;  4NV7 A;  3N4C A;  3N3G A;  1W4T A;  4YVA A;  1KHQ A;  1U9X A;  4N4Z A;  1EWO A;  2R9N A;  3H89 A;  3KFQ A;  1CPJ A;  3U8E A;  2DCA A;  2YJ2 A;  1AU4 A;  3PBH A;  1AU0 A;  7PCK A;  2G6D A;  3F5V A;  1XKG A;  2VFC A;  3OF8 A;  2G8E A;  3KWZ A;  3OVZ A;  3H8C A;  2P7U A;  1AYU A;  2WBF X;  3H7D A;  2VHF A;  3MHS A;  4YYQ A;  3DF0 A;  4MZS A;  4PAD A;  1M6D A;  1PPO A;  5EF4 A;  4ZUX U;  4CDC B;  2PBH A;  3BPF A;  3IEJ A;  4Q8G A;  3TNX A;  1DEU A;  2E03 A;  1BGO A;  2F1G A;  1MIR A;  1ITO A;  1AIM A;  3C9E A;  1PAD A;  4I07 A;  1MEG A;  1PPP A;  1NQC A;  2Y5B A;  4WA6 A;  4CZW A;  1GEC E;  2DZZ A;  1NL6 A;  2Y6E A;  1HUC B;  3MOR A;  3P5W A;  1U5I A;  1F2B A;  4FJC A;  1S4V A;  2DCD A;  1AU3 A;  3KWB X;  5CVO B;  3KW9 A;  1U9W A;  3KKU A;  2JQG R;  2IPP B;  1TLO A;  2DCC A;  3LTW A;  3S3Q A;  3IHP A;  1JQP A;  2ATO A;  4AXM A;  2GHU A;  4B55 A;  4XR7 A;  2FRA A;  3I3T A;  5CVM A;  4X6J A;  2PNS A;  3H6S A;  1E2T A;  2PRE A;  1MEM A;  5A24 A;  2AU1 A;  4PP2 E;  3BPM A;  4P6E A;  8PCH A;  2XU4 A;  4DMX A;  4HWY A;  2AVW A;  5CVN B;  1CS8 A;  5CHV A;  1IWD A;  2DCB A;  2OUL A;  3CH2 X;  2NQD B;  2R6N A;  1O0E A;  4I04 A;  1ZCM A;  2XU1 A;  3P5X A;  3O0U A;  2BSZ A;  1DF0 A;  3N3K A;  1ZIV A;  1KFX L;  1PIP A;  1CTE A;  3OVX A;  4CDD B;  1KHP A;  2DJF B;  2IBI A;  3K24 A;  4YYR A;  2NQA A;  2HH5 A;  1AYW A;  3RVW A;  2DJG B;  2GFO A;  5J94 A;  2FRQ A;  3CH3 X;  1AEC A;  3QT4 A;  3BOW A;  1NLJ A;  3KX1 A;  2R9F A;  4GUZ A;  4QRG A;  4N79 A;  2AUX A;  3F75 A;  1TU6 A;  3BCN A;  3HD3 A;  3LXS A;  2AYN A;  3WXG A;  2FO5 A;  5PAD A;  1TL9 A;  3USV A;  3ERV A;  1FH0 A;  1POP A;  1W5R A;  4QRV A;  3IV2 A;  2P0R A;  4OEL A;  2VHS A;  3NHE A;  1U9V A;  3HWN A;  2YJB A;  5F02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...