4GUZA

Structure of the arylamine n-acetyltransferase from mycobacterium abscessus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
284
Chain Sequence
b'VPRGSHMWNGDELQLDEYLAFIGFDGDRSPTLETLRRLQRGHVLNIKWENLDAVLHKHVALDIPAVQAKLLRSPRGGYCYEHVALFGAVLQRLGFDFYGIQGRVQMGATTIRPATHGMLVVRLAAEQWLCDVGFGTSPLAPIRLVDEAVVADESWTYRLRRGEVTPGADGWTLSEAAGDGSEPGWLSRHTFVLEPQYPIDYRAASYFVASSPHSPFSTRAFVQQISPDHAYILDHRELHEIQPGVGRKTRQLTPAEVLATLREIFGIELGADDSTLLLERLAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable arylamine n-acetyl transferase
publication title Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 86
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4guzA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4guzA01
2VFBA 4B55A 1GX3A 1W6FA 4GUZA 4NV8A 1E2TA 2BSZA 1W5RA 4NV7A 4BGFA 1W4TA 3LTWA 4C5PA 2VFCA 3D9WA
chains in the Genus database with same CATH superfamily
1HMTA 2LBAA 2W2BA 4AZRA 4BCSA 4ID2A 3MG5A 4I9SA 4TKHA 4MVKA 2BSZA 2RTJA 3F6ZB 1AELA 4YGZA 4CDEA 2RTPB 3VE1A 2JN3A 3FYFA 3VG6A 1G85A 1MEPA 2BLGA 3DSZA 3PQUA 4O3XB 1LUQA 1FDQA 1ERXA 1KT7A 2BS5A 2X4MA 3CKFA 4JGLA 3CBSA 4NV8A 1XKIA 3U0DA 1IFCA 4YKMA 3GE2A 5B29A 1EXSA 2RTQB 2G78A 4Y0QA 5IRUA 3OJYC 1N9YA 3APXA 3BDRA 1MVGA 1I9HA 1PMPA 2FR3A 3BX8A 4N7CA 5B2AO 3S5XA 1VWIB 4AZNA 4IAXA 5B11O 3BSZE 3APUA 4O3YA 3SLTA 3UEUA 5LJBA 1BRQA 3WJFA 1DF8A 2HNXA 4KH8A 1NQNA 1SLGB 1GKAB 1JQPA 1CRBA 3UEVA 2RTBB 2RTOB 1OPBA 3P24A 1SWEA 3JS1A 5LJHA 1VWAB 2FHNX 4L3RA 1UYNX 4NYQA 4OELA 4GNWA 2R56A 3RKGA 4DMOA 2MF6A 4YH0A 4BX5B 4Z27A 5L8NA 2L5PA 1SMPI 3BX7A 1QFTA 5DPQA 1NGLA 1VWDB 1HQPA 1EI5A 1P6PA 1EUOA 4NNTA 3BU9A 3EW2A 4ON1A 4GU8A 4U9CA 1VYGA 4DQ4A 4I3CA 1A18A 2A2GA 1OEEA 3PK2A 4QAEA 2GH7A 3ZW0A 2IZIA 1VPRA 2IZGB 1CBIA 1LIBA 5L8IA 2X45A 3DTQA 3KFIA 2WEXA 3E3CA 2OYBO 5BYPA 5K67A 2IZLB 4FBOA 2QM9A 2RA6A 1EPBA 4TKBA 4ORXA 3MM0A 1SXXA 2OVAA 1SWBA 2BS6A 1T68X 2IFBA 1A57A 4CPFA 4MISA 1HMSA 1LCWA 4DNEA 2CAMA 2POAA 4O4XA 5D45A 4AZOA 3C76X 3C77X 2RTNB 1E2TA 1KT4A 3LV4A 1VWMB 2IZHB 2OFAA 1ALBA 1Y55X 2XSTA 2I5ZO 3FEKA 1Y0GA 2Z4IA 2X8SA 4QGWA 2YG2A 1I04A 1LCVA 1RXKA 5D8JA 1SWCA 1SWGA 2OL6O 4AYHA 2HZQA 3IFBA 2OVDA 1Z24A 3FA8A 3I0AA 1AQBA 3WJCA 2IZKA 3FLLA 5H9LA 3WOVA 1SLFB 2WEWA 3KZAA 4A60A 1UZ2X 1X89A 3AUMO 4UU2A 1UREA 4U8UM 5BVQA 1RBPA 2Y3EA 4CDCA 4GKCA 1A2DA 1E02A 1SLDB 1LDQA 1E5PA 1SWQA 2W2FA 3VG3A 5HCCC 2JW1A 4Y0RA 1ADLA 3AKMA 3VG5A 3P6FA 1K3BA 3N91A 1OBUA 2ANSA 4WFUA 4GETA 4TLJA 1I78A 4A8ZA 5LJEA 2ACPX 2QOMA 3MVFA 4ZCBA 1I05A 1JV4A 4OS0A 2Y3FA 1QG5A 3OD9A 1IJ8A 2OFMX 1KL5A 3HOLA 4IAWA 1IKEA 1PTSA 1VWCB 2RN4A 3G7XA 4IMNA 4U8UN 1T8VA 3OBLA 3SLOA 3T6LA 3RZYA 3C78X 2LA7A 1O8VA 4ODDA 1GT5A 5CYBA 4HPDA 1OEKA 2NP1A 1SY0A 4WFVA 1JBHA 1SWLA 1LPJA 1AVEA 1MX8A 2XKLA 1FENA 2FKGA 5CHKA 5FFHA 4IB6A 1X8QA 1ZNDA 2F09A 4Z2OA 4TQ2A 3FIQA 2K62A 5B5FA 5D48A 2RTFB 2JMBA 2OY7A 4FBRA 1BJ7A 1JMXA 5HWZA 1IW2A 1QFVA 2IZAA 3EBWA 2AL0X 1CBSA 2WUTA 1BM5A 3STKA 4YFPA 2Y32A 4AW8A 5EDCA 1LF7A 4BX6A 4U46A 4IABA 1AB0A 1RXJA 4XMEA 1W5RA 1FJ1E 4O3ZA 2BC3A 5C0NA 2GTFX 1ZNGA 1D3SA 1ICNA 2C1QA 2L9CA 3F9DA 1SRHA 4GD9A 3STNA 3T2XA 3ZUOA 3APVA 2FT9A 4KT5A 1G5WA 4FBVA 1QY2A 2Q2MA 5EEDA 5F7GA 1EW3A 3EBKA 1T0VA 2FS6A 2X55A 3CBCA 1HXLA 1SRGA 1ZRYA 4HWMA 4NLIA 1SWNA 3ZW1A 4BOEA 1EPAA 1TW4A 2FR2A 2GJ5A 1RXHA 3HWFA 2R74A 1VWOB 1MX7A 5FENA 4Y0PA 5L3YA 2FRSA 1X8UA 1B8EA 1SWJA 3FDCA 3WYQA 4O4SA 1N43A 2AT6X 5AJBA 4ML7B 3ELXA 2CM4A 4TKJA 1YIVA 3WBGA 2PFRA 2LFOA 4ORUA 1B0OA 2WR6A 5HZ8A 1KZXA 2AT3X 3TGAA 3BU1A 3F8AA 3WZPA 3O2YA 3RDQA 2KTSA 1VWQB 4TNNA 4ZGFA 5LKEA 3CQNA 1NP4A 3OE3A 2FGSA 5HZQA 3MBTA 2CZTA 3JQOA 1I4UA 1IIUA 1VYFA 2OF9A 2OL8O 2PY1A 2RTKA 3V8UA 3VHIA 1QQSA 2NNDA 3FW5A 4N7DA 5F6BA 1KXOA 1SWUA 1SXWA 2L67A 2NNEA 3D4RA 2G79A 4PSQA 3KFHA 1U18A 2ZSCA 3T6FA 4GH7A 2FWVA 2MO5A 3B2IA 3CMPA 1STPA 2W2AA 3FR5A 4XMHA 5B27A 5HTDA 1OBQA 1IFBA 5HTEA 4CV7A 2G5LA 1PBYA 4GE1A 4GK9A 1VWJB 3VG2A 1E00A 1IKJA 1KT6A 3EM0A 3H3IA 4RUNA 2WPUA 5EPQA 2CBSA 1AVGI 1SRJA 2BHVA 2RTCB 2KTDA 3EMMA 5H9AA 3PH5A 2A2UA 4ORSA 1ML7A 1VWFB 2ALLX 2RCTA 3QQ2A 4YBUA 5AEOA 5KHPA 3SZIA 1DZMA 1RAVA 1U17A 2JOZA 4ZH9A 1K24A 5K06A 1YWCA 2IZJA 2JU7A 5EEEA 1N7YA 3S26A 3ZW0B 4KIIA 3LTWA 2A13A 1S44A 2AT8X 2EU7X 1ZNLA 3SAOA 2OFBA 5IO6A 4ZR2A 2AMMX 2QO4A 5FQ6E 1YUPA 3VHHA 2QOSC 4CSBA 2WQ9A 4ZGUA 4ZH6A 1B56A 3D9WA 2IZCB 4GGTA 3HTYA 5H9NA 3D96A 3RY1A 5JR8A 2X32A 4Z2VA 4EXZA 1HXZA 3ZW2A 2RTDB 1VWKB 2KT4B 3FR2A 3BRNA 3PP6A 1N0SA 1STRB 2N93A 1KT5A 4MVIA 1SY3A 1O1UA 3BS2A 3FA6A 4GRJA 1KT3A 4NW4A 1X8PA 2PI3O 1S2PA 2Q9SA 4IB7A 2HKDA 2O62A 3JSQA 4Y5DA 4CDDA 4ALBA 4D6AA 4O4UA 4A1YA 1RSTB 2HMBA 2BT9A 2VFCA 3RDMA 4D6BA 4GGRA 1BWYA 4FQBB 4U3QA 1N4JA 2UZ2A 4MIRA 2CM9A 1EQDA 3WJEA 3RDSA 4ZHFA 4OMWA 4COTA 1BBPA 4YMYA 2AT0X 3X00A 4CDFA 1GX9A 4MEEA 4GUZA 1ZNKA 1GT3A 1KOIA 1N9MA 1OBPA 5K68A 1PBOA 1G74A 1SWKA 5DG4A 4OEMA 4I60A 3FENA 5H8TA 2RCQA 5BVSA 2JU8A 4INNA 1PEEA 4I6SA 4BGFA 4CPHA 2GTLM 1YP7A 4ORYA 3GAQA 1SWFA 1Y53X 4LZVA 1RSUB 2OY8A 1SWSA 4IBAA 2C1SA 3FA7A 3KFFA 1HMRA 4WHIA 2M4LA 2FKJA 2KD2A 1FE3A 1DZPA 1DFVA 4NNSA 2X56A 1SWAA 2IZFB 4XMDA 1LICA 3AEHA 2GTLN 2X8FA 3AKNA 3RE5A 2A8GA 3VU1A 1JJJA 4AZQA 3WXQA 3WJGA 4GGZA 4O4OA 4QZUA 1YWBA 2F73A 3UEXA 1Y9TA 1SXUA 3NP1A 3RDXA 3TZSA 4YDAA 1GT4A 1ICMA 2DJGA 2OL7A 3LNBA 1BSQA 2Q4NA 1BSOA 2GC9A 1CJ5A 1VWLB 2G7BA 5F1EA 4M7MA 1NBXA 1AVDA 4KC8A 3VG4A 4C5PA 4Z6JA 4OKAA 2IZEB 4KC7A 2RTGB 4BX6B 5HZ5A 1EIOA 1VYOA 4UU3A 1LIDA 1SWRA 4R0BA 1YWDA 1EIIA 3O19A 1KZWA 3Q6LA 4YCHA 3VHMA 1JZUA 3ZWEA 1BRPA 1VWPB 4O9SA 4QYNA 5LJDA 2AVIA 5HCDC 2K23A 1CBRA 4QRLA 1SRIA 2MJIA 4OS8A 1LIEA 4U8UO 1NDJA 1TOWA 3KFGA 1LKEA 1WUBA 1GX3A 3L4RA 3RDOA 3ZW1B 2UYWA 4ALOA 1U0XA 3FR4A 3APWA 4NLJA 3SLJA 3P6HA 4YGHA 1SXYA 4I9RA 1SWOA 1NC9A 3VE2A 1A3YA 1HBPA 1YP6A 2RD7C 4QGXA 1OEJA 1X8OA 2AF5A 2NNQA 3VPJE 3KVNA 2A3FX 4BX7A 1L6MA 2FTBA 3SOTA 5JD2A 3NQ9A 2A0AA 3SZHA 3EW1A 3D97A 1JIWI 1SWPA 1MDCA 3PEDA 4HPAA 2CBRA 3P6GA 3P6CA 1KQWA 5KIDA 3K3LA 5L8OA 3U03A 4EDEA 1KFFA 4A1HA 4BVMA 1ZNEA 2Q39A 4ZHHA 4TJZA 3NX2A 4HPBA 1EALA 1G7NA 2QO5A 3CWKA 4GNYA 4IB9A 4KCAA 2MHDA 4ORRA 3O22A 2AKQA 5F58A 1VWRB 1SWDA 2X8TA 3FEPA 3ELZA 2LB6A 3IA8A 4LQZA 2E4JA 4ZHDA 1SWTA 3FW4A 1DC9A 5EZ2A 2L68A 4QZTA 3I17A 4ZHCA 2ASNX 3CR6A 1BLRA 1SA8A 4I3BA 4DCBA 2RTIB 2IJAA 2PQTA 2OVSA 1QWDA 1BEBA 4Y0SA 4L1NA 1FELA 1MOYA 5KICA 3HK1A 3WJDA 1WBIA 2G8CO 4XMFA 3TGCA 3FMZA 4QYPA 2WSJA 2ZAGA 4Y59A 5F6ZA 5IO7A 2OFRX 1KL3A 1X71A 1GXAA 5CSEA 3WZOA 2R73A 4BJ8A 5HZ9A 1HN2A 1SLEB 4IMOA 2VFBA 2RQ0A 3BY0A 1NQMA 1VWGB 4K19A 3STMX 5D4AA 3CKGA 4NV7A 5B5GA 1SY2A 1GKAA 1TXLA 5IRWA 3ZZVA 3D95A 1HY2A 3B2KA 4I3DA 1KL4A 1I06A 4ORWA 3ZUIA 1R0UA 4BX5A 1W4TA 3HWGA 3PDFA 4YKOA 5HA1A 1LELA 2F01A 1VWBB 2QO6A 4O3WA 5FQ7E 3RWXA 3QKGA 3EC5A 4EEJA 4JO6A 4MVLA 4QNIA 4RUUA 1SY1A 3Q34A 2DJFA 5HZ6A 3S5VA 1BSYA 1S7DA 2QMIA 4YFQA 3NQKA 3CQRA 3NR3A 2LKKA 2X34A 1LNMA 4QQ1A 1SWHA 1VWHB 5HAEA 4BBOA 4XMGA 3U9PC 4OMXA 1SRFA 2P8GA 1FEMA 3B2JA 2A5BA 3T1DA 4CPEA 1X8NA 4CPHB 4LKTA 2HLVA 3PECA 1E06A 4PJ2A 4EQAC 1JJXA 4ZJ0A 4GJVA 5D47A 2OY5O 2HYSA 2X46A 2FLJA 1Y52X 1GX8A 3RSWA 1MUPA 2VDFA 3VG7A 4QGVA 2AT5X 1PM1X 4ARHA 1HQQA 4YCEA 1HBQA 3TGBA 2QCBA 1FTPA 5AQ6A 4Z2PA 1H91A 4MVEA 3HWDA 3NBXX 5AJCA 4ES7A 1SREA 1W6FA 3FA9A 1JYDA 4I95A 5LJGA 4LZUA 1DF3A 4M6SA 4HPCA 1D2UA 5B10O 2KW1A 4NYRA 1XCAA 3PPTA 3HPEA 1STSB 4HFOA 3LHNA 2RTHB 2RTAA 3RDUA 4YVBA 2YMSA 3VGWA 4LKPA 1NP1A 4EKVA 2OVEA 3EYCA 3P6EA 4IB8A 1RLBE 1QY1A 2Z4HA 2MWHA 5HBSA 1ACDA 2JGSA 3UAQA 2Q2PA 2CZUA 3NX1A 4GDZA 3NQ3A 3ZI8A 1GM6A 1VWNB 1Y9LA 2RTEB 5FQ8E 4CK4A 4ZFXA 5IO5A 5IXGA 2HZRA 1OPAA 3B2LA 2A5CA 1UYOX 1TVQA 3FELA 2AH7X 3SZJA 1VWEB 2ACOA 3KQ0A 3T2WA 2I5VO 4EFGA 2IZBA 1MM9A 3S60A 1KGLA 4YDBA 5B3MO 3BLGA 2RTRB 2RTMA 4OS3A 4CPIA 3HOEA 2GTLO 4JHQA 1MK5A 1ZNHA 3WZNA 1CBQA 3NADA 1JJUA 2JU3A 3WZQA 4YBPA 5H9KA 1KQXA 1DZJA 1LIFA 4NP1A 4O49A 3B2HA 3UEWA 5LJKA 1OSPO 5FAZA 3HWEA 1QY0A 4BQUA 4ZHGA 3RY2A 2C4IA 2MM3A 2WWPA 4GDAA 3PH6A 2ZAIA 1TOUA 1JYJA 4JNJA 3WVMA 2LBVA 4BX7B 2IZDB 5EDBA 4AZPA 1B4MA 2RTLA 3WJBA 2FHLA 3P6DA 3P02A 4YFRA 1DZKA 2WQAE 4XMCA 4IRWA 1GT1A 5HCEC 3MX7A 1QABE 1LCZA 3NPOA 3TF6A 3RE6A 5HA0A 2OZQA 2DM5A 5F2BA 3ZQ3A 4AZMA 4FGIB 4GJSA 2OF8A 1ERBA 1JMZA 2FS7A 1O1VA 2OY1O 4WBKA 1GGLA 3RBYA 5BVTA 1YWAA 5LKFA 5CE4A 1DV9A 4B55A 4GZVA 4Z28A 1LDOA 3FIDA 4YGGA 3WYPA 5LJCA 3PQSA 4DQ3A 1LFOA 5IRAA
chains in the Genus database with same CATH topology
1QMYA 2VHSA 3P5WA 2BSZA 4K7CA 4Q8GA 1YT7A 2FT2A 3H6SA 1CJLA 4NV8A 2AYNA 4PI3A 1MHWA 3KWZA 2CIOA 2G8JA 1JQPA 1PPDA 1CB5A 2C0YA 2AYOA 4OELA 3IHPA 3N4CA 1AU2A 3BWKA 1A6RA 2BDZA 2DZZA 4ZUXU 4KLBA 2Y6EA 3ZUAA 2OZ2A 1TLOA 1NL6A 1CQDA 5FPWA 4P6GA 1QDQA 1AYVA 2DCCA 3IEJA 1PIPA 1YALA 3F5VA 3V6EA 1CPJA 5CVOB 2NQIA 1F2BA 3OF8A 3BPMA 1E2TA 3IV2A 3MHSA 1F29A 1CS8A 3PBHA 2YJ9A 1ITOA 1IWDA 2DC9A 1M6DA 2YJCA 4PADA 3USVA 1EF7A 1U9QX 1PE6A 1VJVA 1F2AA 1GECE 3QT4A 3HD3A 3P5XA 4XR7A 3TNXA 2G6DA 2XU4A 4W5BA 1ME4A 4CZWA 2B1MA 1X9YA 2YJ8A 2R9MA 4YYSA 3BPFA 2IPPB 1W5RA 3RVVA 4QRGA 4AXMA 2O6XA 2P86A 4N4ZA 3DF0A 1MDWA 1KHPA 4QH6A 4DMXA 2P0RA 4FJCA 2ARYA 3IMAA 4CDEB 1CV8A 1Y4HA 2P7UA 4QRVA 5CHVA 3S3QA 4FIPA 2E03A 3KKUA 1AU0A 3LFYA 4P6EA 1BGOA 1NB3A 2WBFX 3WXEA 1AYUA 2ATOA 3BC3A 2B1NA 3O1GA 3BCNA 2F1GA 4YYVA 2NQDB 1AIMA 1MEGA 4YYWA 1EWMA 4RY2A 2DJFB 1ICFA 2DC6A 4N8WA 1NQCA 4YYRA 1PPNA 1Q6KA 3LTWA 4QBBA 2FUDA 2R6NA 4BSQA 4N79A 4WA6A 1NPZA 1BQIA 3D9WA 1POPA 3I3TA 3CH2X 1THEA 4YYUA 3U8EA 4PP2E 2Y5BA 1ZCMA 1Y08A 2HD5A 2VFCA 1YK8A 2GFOA 4BS6A 2G7YA 3CBKA 1U9WA 2DCAA 1KFUL 3PNRA 2G8EA 2FQ9A 4GUZA 1PADA 2R9CA 2AU1A 3C9EA 4OEMA 4BGFA 1PXVA 2DZYA 3OVXA 4QRXA 4CDCB 2E02A 1ATKA 1MIRA 3IOQA 2PREA 3MORA 4Q8HA 1K3BB 5F02A 3P5VA 4X6HA 1XKGA 1VSNA 3HHAA 1EWOA 2ACTA 1SNKA 4I04A 5JH3A 2NQGA 1AYWA 7PCKA 4YYQA 8PCHA 4C5PA 2NQAA 1DEUA 2R9FA 1GMYA 3B79A 5CVNB 3O0UA 4BS5A 1U5IA 4X6IA 1GX3A 3HHIA 3NHEA 3OISA 4MZOA 3KSEA 3WXGA 3WXFA 1AU3A 2H7JA 2FYEA 3KWBX 1ZIVA 3CH3X 4YV8A 9PAPA 3AI8A 1U9VA 2FRQA 5EF4A 2BDLA 2HH5A 3OVZA 3M99A 3K8UA 5PADA 3PW3A 4I07A 1PBHA 2VHFA 2XU1A 5JA7A 2FO5A 1BY8A 3IUTA 2CB5A 3H8CA 1GCBA 1O0EA 5CHTA 4X6JA 3F75A 2YJ2A 1CVZA 1S4VA 1EWLA 2VFBA 2OULA 4NV7A 4HWYA 2YJBA 1AU4A 2DC8A 1QXPA 1W4TA 3PDFA 5CVMA 2JQFR 4CDDB 2E01A 2PNSA 3QSDA 4BPVA 1F2CA 4CDFB 2AUXA 3ERVA 1ME3A 1MS6A 2R9OA 1HUCB 4AXLA 1QOLA 1TL9A 1BP4A 1PCIA 2PBHA 6PADA 2IBIA 4BQVA 3QJ3A 1DF0A 3GCBA 3K24A 1GLOA 1W6FA 1CTEA 3LXSA 4DMYA 2OP3A 3RVXA 3HWNA 5EGWA 2DC7A 3OF9A 4XUIA 3BOWA 3H89A 2DJGB 1PPOA 1MEMA 1PPPA 4I05A 4PP1A 1AECA 5K16A 1KFXL 2FRAA 1STFE 3MHHA 3S3RA 3RVWA 3P5UA 3E1ZB 1TU6A 2R9NA 2AS8A 2HXZA 3H7DA 3I06A 3V6CA 3D6SA 2HHNA 4W4UA 1EWPA 2AVWA 3KX1A 5A24A 1YK7A 4YVAA 2JQGR 5J94A 1NB5A 4G54A 2AIMA 3N3GA 2FTDA 3CBJA 2XU3A 4W5CA 1FH0A 1YVBA 1KHQA 3N3KA 3KW9A 1NLJA 3H8BA 2E00A 3KFQA 2AUZA 4MZSA 1U9XA 2DCBA 4MSXA 2PADA 2DCDA 3K9MA 2GHUA 4B55A 1CSBB 2F7DA 2XU5A 1SP4B 1KXRA 4FK5A 3MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFB A;  4B55 A;  1GX3 A;  1W6F A;  4GUZ A;  4NV8 A;  1E2T A;  2BSZ A;  1W5R A;  4NV7 A;  4BGF A;  1W4T A;  3LTW A;  4C5P A;  2VFC A;  3D9W A; 
#chains in the Genus database with same CATH topology
 1HMT A;  2LBA A;  2W2B A;  4AZR A;  4BCS A;  4ID2 A;  3MG5 A;  4I9S A;  4TKH A;  4MVK A;  2BSZ A;  2RTJ A;  3F6Z B;  1AEL A;  4YGZ A;  4CDE A;  2RTP B;  3VE1 A;  2JN3 A;  3FYF A;  3VG6 A;  1G85 A;  1MEP A;  2BLG A;  3DSZ A;  3PQU A;  4O3X B;  1LUQ A;  1FDQ A;  1ERX A;  1KT7 A;  2BS5 A;  2X4M A;  3CKF A;  4JGL A;  3CBS A;  4NV8 A;  1XKI A;  3U0D A;  1IFC A;  4YKM A;  3GE2 A;  5B29 A;  1EXS A;  2RTQ B;  2G78 A;  4Y0Q A;  5IRU A;  3OJY C;  1N9Y A;  3APX A;  3BDR A;  1MVG A;  1I9H A;  1PMP A;  2FR3 A;  3BX8 A;  4N7C A;  5B2A O;  3S5X A;  1VWI B;  4AZN A;  4IAX A;  5B11 O;  3BSZ E;  3APU A;  4O3Y A;  3SLT A;  3UEU A;  5LJB A;  1BRQ A;  3WJF A;  1DF8 A;  2HNX A;  4KH8 A;  1NQN A;  1SLG B;  1GKA B;  1JQP A;  1CRB A;  3UEV A;  2RTB B;  2RTO B;  1OPB A;  3P24 A;  1SWE A;  3JS1 A;  5LJH A;  1VWA B;  2FHN X;  4L3R A;  1UYN X;  4NYQ A;  4OEL A;  4GNW A;  2R56 A;  3RKG A;  4DMO A;  2MF6 A;  4YH0 A;  4BX5 B;  4Z27 A;  5L8N A;  2L5P A;  1SMP I;  3BX7 A;  1QFT A;  5DPQ A;  1NGL A;  1VWD B;  1HQP A;  1EI5 A;  1P6P A;  1EUO A;  4NNT A;  3BU9 A;  3EW2 A;  4ON1 A;  4GU8 A;  4U9C A;  1VYG A;  4DQ4 A;  4I3C A;  1A18 A;  2A2G A;  1OEE A;  3PK2 A;  4QAE A;  2GH7 A;  3ZW0 A;  2IZI A;  1VPR A;  2IZG B;  1CBI A;  1LIB A;  5L8I A;  2X45 A;  3DTQ A;  3KFI A;  2WEX A;  3E3C A;  2OYB O;  5BYP A;  5K67 A;  2IZL B;  4FBO A;  2QM9 A;  2RA6 A;  1EPB A;  4TKB A;  4ORX A;  3MM0 A;  1SXX A;  2OVA A;  1SWB A;  2BS6 A;  1T68 X;  2IFB A;  1A57 A;  4CPF A;  4MIS A;  1HMS A;  1LCW A;  4DNE A;  2CAM A;  2POA A;  4O4X A;  5D45 A;  4AZO A;  3C76 X;  3C77 X;  2RTN B;  1E2T A;  1KT4 A;  3LV4 A;  1VWM B;  2IZH B;  2OFA A;  1ALB A;  1Y55 X;  2XST A;  2I5Z O;  3FEK A;  1Y0G A;  2Z4I A;  2X8S A;  4QGW A;  2YG2 A;  1I04 A;  1LCV A;  1RXK A;  5D8J A;  1SWC A;  1SWG A;  2OL6 O;  4AYH A;  2HZQ A;  3IFB A;  2OVD A;  1Z24 A;  3FA8 A;  3I0A A;  1AQB A;  3WJC A;  2IZK A;  3FLL A;  5H9L A;  3WOV A;  1SLF B;  2WEW A;  3KZA A;  4A60 A;  1UZ2 X;  1X89 A;  3AUM O;  4UU2 A;  1URE A;  4U8U M;  5BVQ A;  1RBP A;  2Y3E A;  4CDC A;  4GKC A;  1A2D A;  1E02 A;  1SLD B;  1LDQ A;  1E5P A;  1SWQ A;  2W2F A;  3VG3 A;  5HCC C;  2JW1 A;  4Y0R A;  1ADL A;  3AKM A;  3VG5 A;  3P6F A;  1K3B A;  3N91 A;  1OBU A;  2ANS A;  4WFU A;  4GET A;  4TLJ A;  1I78 A;  4A8Z A;  5LJE A;  2ACP X;  2QOM A;  3MVF A;  4ZCB A;  1I05 A;  1JV4 A;  4OS0 A;  2Y3F A;  1QG5 A;  3OD9 A;  1IJ8 A;  2OFM X;  1KL5 A;  3HOL A;  4IAW A;  1IKE A;  1PTS A;  1VWC B;  2RN4 A;  3G7X A;  4IMN A;  4U8U N;  1T8V A;  3OBL A;  3SLO A;  3T6L A;  3RZY A;  3C78 X;  2LA7 A;  1O8V A;  4ODD A;  1GT5 A;  5CYB A;  4HPD A;  1OEK A;  2NP1 A;  1SY0 A;  4WFV A;  1JBH A;  1SWL A;  1LPJ A;  1AVE A;  1MX8 A;  2XKL A;  1FEN A;  2FKG A;  5CHK A;  5FFH A;  4IB6 A;  1X8Q A;  1ZND A;  2F09 A;  4Z2O A;  4TQ2 A;  3FIQ A;  2K62 A;  5B5F A;  5D48 A;  2RTF B;  2JMB A;  2OY7 A;  4FBR A;  1BJ7 A;  1JMX A;  5HWZ A;  1IW2 A;  1QFV A;  2IZA A;  3EBW A;  2AL0 X;  1CBS A;  2WUT A;  1BM5 A;  3STK A;  4YFP A;  2Y32 A;  4AW8 A;  5EDC A;  1LF7 A;  4BX6 A;  4U46 A;  4IAB A;  1AB0 A;  1RXJ A;  4XME A;  1W5R A;  1FJ1 E;  4O3Z A;  2BC3 A;  5C0N A;  2GTF X;  1ZNG A;  1D3S A;  1ICN A;  2C1Q A;  2L9C A;  3F9D A;  1SRH A;  4GD9 A;  3STN A;  3T2X A;  3ZUO A;  3APV A;  2FT9 A;  4KT5 A;  1G5W A;  4FBV A;  1QY2 A;  2Q2M A;  5EED A;  5F7G A;  1EW3 A;  3EBK A;  1T0V A;  2FS6 A;  2X55 A;  3CBC A;  1HXL A;  1SRG A;  1ZRY A;  4HWM A;  4NLI A;  1SWN A;  3ZW1 A;  4BOE A;  1EPA A;  1TW4 A;  2FR2 A;  2GJ5 A;  1RXH A;  3HWF A;  2R74 A;  1VWO B;  1MX7 A;  5FEN A;  4Y0P A;  5L3Y A;  2FRS A;  1X8U A;  1B8E A;  1SWJ A;  3FDC A;  3WYQ A;  4O4S A;  1N43 A;  2AT6 X;  5AJB A;  4ML7 B;  3ELX A;  2CM4 A;  4TKJ A;  1YIV A;  3WBG A;  2PFR A;  2LFO A;  4ORU A;  1B0O A;  2WR6 A;  5HZ8 A;  1KZX A;  2AT3 X;  3TGA A;  3BU1 A;  3F8A A;  3WZP A;  3O2Y A;  3RDQ A;  2KTS A;  1VWQ B;  4TNN A;  4ZGF A;  5LKE A;  3CQN A;  1NP4 A;  3OE3 A;  2FGS A;  5HZQ A;  3MBT A;  2CZT A;  3JQO A;  1I4U A;  1IIU A;  1VYF A;  2OF9 A;  2OL8 O;  2PY1 A;  2RTK A;  3V8U A;  3VHI A;  1QQS A;  2NND A;  3FW5 A;  4N7D A;  5F6B A;  1KXO A;  1SWU A;  1SXW A;  2L67 A;  2NNE A;  3D4R A;  2G79 A;  4PSQ A;  3KFH A;  1U18 A;  2ZSC A;  3T6F A;  4GH7 A;  2FWV A;  2MO5 A;  3B2I A;  3CMP A;  1STP A;  2W2A A;  3FR5 A;  4XMH A;  5B27 A;  5HTD A;  1OBQ A;  1IFB A;  5HTE A;  4CV7 A;  2G5L A;  1PBY A;  4GE1 A;  4GK9 A;  1VWJ B;  3VG2 A;  1E00 A;  1IKJ A;  1KT6 A;  3EM0 A;  3H3I A;  4RUN A;  2WPU A;  5EPQ A;  2CBS A;  1AVG I;  1SRJ A;  2BHV A;  2RTC B;  2KTD A;  3EMM A;  5H9A A;  3PH5 A;  2A2U A;  4ORS A;  1ML7 A;  1VWF B;  2ALL X;  2RCT A;  3QQ2 A;  4YBU A;  5AEO A;  5KHP A;  3SZI A;  1DZM A;  1RAV A;  1U17 A;  2JOZ A;  4ZH9 A;  1K24 A;  5K06 A;  1YWC A;  2IZJ A;  2JU7 A;  5EEE A;  1N7Y A;  3S26 A;  3ZW0 B;  4KII A;  3LTW A;  2A13 A;  1S44 A;  2AT8 X;  2EU7 X;  1ZNL A;  3SAO A;  2OFB A;  5IO6 A;  4ZR2 A;  2AMM X;  2QO4 A;  5FQ6 E;  1YUP A;  3VHH A;  2QOS C;  4CSB A;  2WQ9 A;  4ZGU A;  4ZH6 A;  1B56 A;  3D9W A;  2IZC B;  4GGT A;  3HTY A;  5H9N A;  3D96 A;  3RY1 A;  5JR8 A;  2X32 A;  4Z2V A;  4EXZ A;  1HXZ A;  3ZW2 A;  2RTD B;  1VWK B;  2KT4 B;  3FR2 A;  3BRN A;  3PP6 A;  1N0S A;  1STR B;  2N93 A;  1KT5 A;  4MVI A;  1SY3 A;  1O1U A;  3BS2 A;  3FA6 A;  4GRJ A;  1KT3 A;  4NW4 A;  1X8P A;  2PI3 O;  1S2P A;  2Q9S A;  4IB7 A;  2HKD A;  2O62 A;  3JSQ A;  4Y5D A;  4CDD A;  4ALB A;  4D6A A;  4O4U A;  4A1Y A;  1RST B;  2HMB A;  2BT9 A;  2VFC A;  3RDM A;  4D6B A;  4GGR A;  1BWY A;  4FQB B;  4U3Q A;  1N4J A;  2UZ2 A;  4MIR A;  2CM9 A;  1EQD A;  3WJE A;  3RDS A;  4ZHF A;  4OMW A;  4COT A;  1BBP A;  4YMY A;  2AT0 X;  3X00 A;  4CDF A;  1GX9 A;  4MEE A;  4GUZ A;  1ZNK A;  1GT3 A;  1KOI A;  1N9M A;  1OBP A;  5K68 A;  1PBO A;  1G74 A;  1SWK A;  5DG4 A;  4OEM A;  4I60 A;  3FEN A;  5H8T A;  2RCQ A;  5BVS A;  2JU8 A;  4INN A;  1PEE A;  4I6S A;  4BGF A;  4CPH A;  2GTL M;  1YP7 A;  4ORY A;  3GAQ A;  1SWF A;  1Y53 X;  4LZV A;  1RSU B;  2OY8 A;  1SWS A;  4IBA A;  2C1S A;  3FA7 A;  3KFF A;  1HMR A;  4WHI A;  2M4L A;  2FKJ A;  2KD2 A;  1FE3 A;  1DZP A;  1DFV A;  4NNS A;  2X56 A;  1SWA A;  2IZF B;  4XMD A;  1LIC A;  3AEH A;  2GTL N;  2X8F A;  3AKN A;  3RE5 A;  2A8G A;  3VU1 A;  1JJJ A;  4AZQ A;  3WXQ A;  3WJG A;  4GGZ A;  4O4O A;  4QZU A;  1YWB A;  2F73 A;  3UEX A;  1Y9T A;  1SXU A;  3NP1 A;  3RDX A;  3TZS A;  4YDA A;  1GT4 A;  1ICM A;  2DJG A;  2OL7 A;  3LNB A;  1BSQ A;  2Q4N A;  1BSO A;  2GC9 A;  1CJ5 A;  1VWL B;  2G7B A;  5F1E A;  4M7M A;  1NBX A;  1AVD A;  4KC8 A;  3VG4 A;  4C5P A;  4Z6J A;  4OKA A;  2IZE B;  4KC7 A;  2RTG B;  4BX6 B;  5HZ5 A;  1EIO A;  1VYO A;  4UU3 A;  1LID A;  1SWR A;  4R0B A;  1YWD A;  1EII A;  3O19 A;  1KZW A;  3Q6L A;  4YCH A;  3VHM A;  1JZU A;  3ZWE A;  1BRP A;  1VWP B;  4O9S A;  4QYN A;  5LJD A;  2AVI A;  5HCD C;  2K23 A;  1CBR A;  4QRL A;  1SRI A;  2MJI A;  4OS8 A;  1LIE A;  4U8U O;  1NDJ A;  1TOW A;  3KFG A;  1LKE A;  1WUB A;  1GX3 A;  3L4R A;  3RDO A;  3ZW1 B;  2UYW A;  4ALO A;  1U0X A;  3FR4 A;  3APW A;  4NLJ A;  3SLJ A;  3P6H A;  4YGH A;  1SXY A;  4I9R A;  1SWO A;  1NC9 A;  3VE2 A;  1A3Y A;  1HBP A;  1YP6 A;  2RD7 C;  4QGX A;  1OEJ A;  1X8O A;  2AF5 A;  2NNQ A;  3VPJ E;  3KVN A;  2A3F X;  4BX7 A;  1L6M A;  2FTB A;  3SOT A;  5JD2 A;  3NQ9 A;  2A0A A;  3SZH A;  3EW1 A;  3D97 A;  1JIW I;  1SWP A;  1MDC A;  3PED A;  4HPA A;  2CBR A;  3P6G A;  3P6C A;  1KQW A;  5KID A;  3K3L A;  5L8O A;  3U03 A;  4EDE A;  1KFF A;  4A1H A;  4BVM A;  1ZNE A;  2Q39 A;  4ZHH A;  4TJZ A;  3NX2 A;  4HPB A;  1EAL A;  1G7N A;  2QO5 A;  3CWK A;  4GNY A;  4IB9 A;  4KCA A;  2MHD A;  4ORR A;  3O22 A;  2AKQ A;  5F58 A;  1VWR B;  1SWD A;  2X8T A;  3FEP A;  3ELZ A;  2LB6 A;  3IA8 A;  4LQZ A;  2E4J A;  4ZHD A;  1SWT A;  3FW4 A;  1DC9 A;  5EZ2 A;  2L68 A;  4QZT A;  3I17 A;  4ZHC A;  2ASN X;  3CR6 A;  1BLR A;  1SA8 A;  4I3B A;  4DCB A;  2RTI B;  2IJA A;  2PQT A;  2OVS A;  1QWD A;  1BEB A;  4Y0S A;  4L1N A;  1FEL A;  1MOY A;  5KIC A;  3HK1 A;  3WJD A;  1WBI A;  2G8C O;  4XMF A;  3TGC A;  3FMZ A;  4QYP A;  2WSJ A;  2ZAG A;  4Y59 A;  5F6Z A;  5IO7 A;  2OFR X;  1KL3 A;  1X71 A;  1GXA A;  5CSE A;  3WZO A;  2R73 A;  4BJ8 A;  5HZ9 A;  1HN2 A;  1SLE B;  4IMO A;  2VFB A;  2RQ0 A;  3BY0 A;  1NQM A;  1VWG B;  4K19 A;  3STM X;  5D4A A;  3CKG A;  4NV7 A;  5B5G A;  1SY2 A;  1GKA A;  1TXL A;  5IRW A;  3ZZV A;  3D95 A;  1HY2 A;  3B2K A;  4I3D A;  1KL4 A;  1I06 A;  4ORW A;  3ZUI A;  1R0U A;  4BX5 A;  1W4T A;  3HWG A;  3PDF A;  4YKO A;  5HA1 A;  1LEL A;  2F01 A;  1VWB B;  2QO6 A;  4O3W A;  5FQ7 E;  3RWX A;  3QKG A;  3EC5 A;  4EEJ A;  4JO6 A;  4MVL A;  4QNI A;  4RUU A;  1SY1 A;  3Q34 A;  2DJF A;  5HZ6 A;  3S5V A;  1BSY A;  1S7D A;  2QMI A;  4YFQ A;  3NQK A;  3CQR A;  3NR3 A;  2LKK A;  2X34 A;  1LNM A;  4QQ1 A;  1SWH A;  1VWH B;  5HAE A;  4BBO A;  4XMG A;  3U9P C;  4OMX A;  1SRF A;  2P8G A;  1FEM A;  3B2J A;  2A5B A;  3T1D A;  4CPE A;  1X8N A;  4CPH B;  4LKT A;  2HLV A;  3PEC A;  1E06 A;  4PJ2 A;  4EQA C;  1JJX A;  4ZJ0 A;  4GJV A;  5D47 A;  2OY5 O;  2HYS A;  2X46 A;  2FLJ A;  1Y52 X;  1GX8 A;  3RSW A;  1MUP A;  2VDF A;  3VG7 A;  4QGV A;  2AT5 X;  1PM1 X;  4ARH A;  1HQQ A;  4YCE A;  1HBQ A;  3TGB A;  2QCB A;  1FTP A;  5AQ6 A;  4Z2P A;  1H91 A;  4MVE A;  3HWD A;  3NBX X;  5AJC A;  4ES7 A;  1SRE A;  1W6F A;  3FA9 A;  1JYD A;  4I95 A;  5LJG A;  4LZU A;  1DF3 A;  4M6S A;  4HPC A;  1D2U A;  5B10 O;  2KW1 A;  4NYR A;  1XCA A;  3PPT A;  3HPE A;  1STS B;  4HFO A;  3LHN A;  2RTH B;  2RTA A;  3RDU A;  4YVB A;  2YMS A;  3VGW A;  4LKP A;  1NP1 A;  4EKV A;  2OVE A;  3EYC A;  3P6E A;  4IB8 A;  1RLB E;  1QY1 A;  2Z4H A;  2MWH A;  5HBS A;  1ACD A;  2JGS A;  3UAQ A;  2Q2P A;  2CZU A;  3NX1 A;  4GDZ A;  3NQ3 A;  3ZI8 A;  1GM6 A;  1VWN B;  1Y9L A;  2RTE B;  5FQ8 E;  4CK4 A;  4ZFX A;  5IO5 A;  5IXG A;  2HZR A;  1OPA A;  3B2L A;  2A5C A;  1UYO X;  1TVQ A;  3FEL A;  2AH7 X;  3SZJ A;  1VWE B;  2ACO A;  3KQ0 A;  3T2W A;  2I5V O;  4EFG A;  2IZB A;  1MM9 A;  3S60 A;  1KGL A;  4YDB A;  5B3M O;  3BLG A;  2RTR B;  2RTM A;  4OS3 A;  4CPI A;  3HOE A;  2GTL O;  4JHQ A;  1MK5 A;  1ZNH A;  3WZN A;  1CBQ A;  3NAD A;  1JJU A;  2JU3 A;  3WZQ A;  4YBP A;  5H9K A;  1KQX A;  1DZJ A;  1LIF A;  4NP1 A;  4O49 A;  3B2H A;  3UEW A;  5LJK A;  1OSP O;  5FAZ A;  3HWE A;  1QY0 A;  4BQU A;  4ZHG A;  3RY2 A;  2C4I A;  2MM3 A;  2WWP A;  4GDA A;  3PH6 A;  2ZAI A;  1TOU A;  1JYJ A;  4JNJ A;  3WVM A;  2LBV A;  4BX7 B;  2IZD B;  5EDB A;  4AZP A;  1B4M A;  2RTL A;  3WJB A;  2FHL A;  3P6D A;  3P02 A;  4YFR A;  1DZK A;  2WQA E;  4XMC A;  4IRW A;  1GT1 A;  5HCE C;  3MX7 A;  1QAB E;  1LCZ A;  3NPO A;  3TF6 A;  3RE6 A;  5HA0 A;  2OZQ A;  2DM5 A;  5F2B A;  3ZQ3 A;  4AZM A;  4FGI B;  4GJS A;  2OF8 A;  1ERB A;  1JMZ A;  2FS7 A;  1O1V A;  2OY1 O;  4WBK A;  1GGL A;  3RBY A;  5BVT A;  1YWA A;  5LKF A;  5CE4 A;  1DV9 A;  4B55 A;  4GZV A;  4Z28 A;  1LDO A;  3FID A;  4YGG A;  3WYP A;  5LJC A;  3PQS A;  4DQ3 A;  1LFO A;  5IRA A; 
#chains in the Genus database with same CATH homology
 1QMY A;  2VHS A;  3P5W A;  2BSZ A;  4K7C A;  4Q8G A;  1YT7 A;  2FT2 A;  3H6S A;  1CJL A;  4NV8 A;  2AYN A;  4PI3 A;  1MHW A;  3KWZ A;  2CIO A;  2G8J A;  1JQP A;  1PPD A;  1CB5 A;  2C0Y A;  2AYO A;  4OEL A;  3IHP A;  3N4C A;  1AU2 A;  3BWK A;  1A6R A;  2BDZ A;  2DZZ A;  4ZUX U;  4KLB A;  2Y6E A;  3ZUA A;  2OZ2 A;  1TLO A;  1NL6 A;  1CQD A;  5FPW A;  4P6G A;  1QDQ A;  1AYV A;  2DCC A;  3IEJ A;  1PIP A;  1YAL A;  3F5V A;  3V6E A;  1CPJ A;  5CVO B;  2NQI A;  1F2B A;  3OF8 A;  3BPM A;  1E2T A;  3IV2 A;  3MHS A;  1F29 A;  1CS8 A;  3PBH A;  2YJ9 A;  1ITO A;  1IWD A;  2DC9 A;  1M6D A;  2YJC A;  4PAD A;  3USV A;  1EF7 A;  1U9Q X;  1PE6 A;  1VJV A;  1F2A A;  1GEC E;  3QT4 A;  3HD3 A;  3P5X A;  4XR7 A;  3TNX A;  2G6D A;  2XU4 A;  4W5B A;  1ME4 A;  4CZW A;  2B1M A;  1X9Y A;  2YJ8 A;  2R9M A;  4YYS A;  3BPF A;  2IPP B;  1W5R A;  3RVV A;  4QRG A;  4AXM A;  2O6X A;  2P86 A;  4N4Z A;  3DF0 A;  1MDW A;  1KHP A;  4QH6 A;  4DMX A;  2P0R A;  4FJC A;  2ARY A;  3IMA A;  4CDE B;  1CV8 A;  1Y4H A;  2P7U A;  4QRV A;  5CHV A;  3S3Q A;  4FIP A;  2E03 A;  3KKU A;  1AU0 A;  3LFY A;  4P6E A;  1BGO A;  1NB3 A;  2WBF X;  3WXE A;  1AYU A;  2ATO A;  3BC3 A;  2B1N A;  3O1G A;  3BCN A;  2F1G A;  4YYV A;  2NQD B;  1AIM A;  1MEG A;  4YYW A;  1EWM A;  4RY2 A;  2DJF B;  1ICF A;  2DC6 A;  4N8W A;  1NQC A;  4YYR A;  1PPN A;  1Q6K A;  3LTW A;  4QBB A;  2FUD A;  2R6N A;  4BSQ A;  4N79 A;  4WA6 A;  1NPZ A;  1BQI A;  3D9W A;  1POP A;  3I3T A;  3CH2 X;  1THE A;  4YYU A;  3U8E A;  4PP2 E;  2Y5B A;  1ZCM A;  1Y08 A;  2HD5 A;  2VFC A;  1YK8 A;  2GFO A;  4BS6 A;  2G7Y A;  3CBK A;  1U9W A;  2DCA A;  1KFU L;  3PNR A;  2G8E A;  2FQ9 A;  4GUZ A;  1PAD A;  2R9C A;  2AU1 A;  3C9E A;  4OEM A;  4BGF A;  1PXV A;  2DZY A;  3OVX A;  4QRX A;  4CDC B;  2E02 A;  1ATK A;  1MIR A;  3IOQ A;  2PRE A;  3MOR A;  4Q8H A;  1K3B B;  5F02 A;  3P5V A;  4X6H A;  1XKG A;  1VSN A;  3HHA A;  1EWO A;  2ACT A;  1SNK A;  4I04 A;  5JH3 A;  2NQG A;  1AYW A;  7PCK A;  4YYQ A;  8PCH A;  4C5P A;  2NQA A;  1DEU A;  2R9F A;  1GMY A;  3B79 A;  5CVN B;  3O0U A;  4BS5 A;  1U5I A;  4X6I A;  1GX3 A;  3HHI A;  3NHE A;  3OIS A;  4MZO A;  3KSE A;  3WXG A;  3WXF A;  1AU3 A;  2H7J A;  2FYE A;  3KWB X;  1ZIV A;  3CH3 X;  4YV8 A;  9PAP A;  3AI8 A;  1U9V A;  2FRQ A;  5EF4 A;  2BDL A;  2HH5 A;  3OVZ A;  3M99 A;  3K8U A;  5PAD A;  3PW3 A;  4I07 A;  1PBH A;  2VHF A;  2XU1 A;  5JA7 A;  2FO5 A;  1BY8 A;  3IUT A;  2CB5 A;  3H8C A;  1GCB A;  1O0E A;  5CHT A;  4X6J A;  3F75 A;  2YJ2 A;  1CVZ A;  1S4V A;  1EWL A;  2VFB A;  2OUL A;  4NV7 A;  4HWY A;  2YJB A;  1AU4 A;  2DC8 A;  1QXP A;  1W4T A;  3PDF A;  5CVM A;  2JQF R;  4CDD B;  2E01 A;  2PNS A;  3QSD A;  4BPV A;  1F2C A;  4CDF B;  2AUX A;  3ERV A;  1ME3 A;  1MS6 A;  2R9O A;  1HUC B;  4AXL A;  1QOL A;  1TL9 A;  1BP4 A;  1PCI A;  2PBH A;  6PAD A;  2IBI A;  4BQV A;  3QJ3 A;  1DF0 A;  3GCB A;  3K24 A;  1GLO A;  1W6F A;  1CTE A;  3LXS A;  4DMY A;  2OP3 A;  3RVX A;  3HWN A;  5EGW A;  2DC7 A;  3OF9 A;  4XUI A;  3BOW A;  3H89 A;  2DJG B;  1PPO A;  1MEM A;  1PPP A;  4I05 A;  4PP1 A;  1AEC A;  5K16 A;  1KFX L;  2FRA A;  1STF E;  3MHH A;  3S3R A;  3RVW A;  3P5U A;  3E1Z B;  1TU6 A;  2R9N A;  2AS8 A;  2HXZ A;  3H7D A;  3I06 A;  3V6C A;  3D6S A;  2HHN A;  4W4U A;  1EWP A;  2AVW A;  3KX1 A;  5A24 A;  1YK7 A;  4YVA A;  2JQG R;  5J94 A;  1NB5 A;  4G54 A;  2AIM A;  3N3G A;  2FTD A;  3CBJ A;  2XU3 A;  4W5C A;  1FH0 A;  1YVB A;  1KHQ A;  3N3K A;  3KW9 A;  1NLJ A;  3H8B A;  2E00 A;  3KFQ A;  2AUZ A;  4MZS A;  1U9X A;  2DCB A;  4MSX A;  2PAD A;  2DCD A;  3K9M A;  2GHU A;  4B55 A;  1CSB B;  2F7D A;  2XU5 A;  1SP4 B;  1KXR A;  4FK5 A;  3MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...