4GUZA

Structure of the arylamine n-acetyltransferase from mycobacterium abscessus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
284
Chain Sequence
VPRGSHMWNGDELQLDEYLAFIGFDGDRSPTLETLRRLQRGHVLNIKWENLDAVLHKHVALDIPAVQAKLLRSPRGGYCYEHVALFGAVLQRLGFDFYGIQGRVQMGATTIRPATHGMLVVRLAAEQWLCDVGFGTSPLAPIRLVDEAVVADESWTYRLRRGEVTPGADGWTLSEAAGDGSEPGWLSRHTFVLEPQYPIDYRAASYFVASSPHSPFSTRAFVQQISPDHAYILDHRELHEIQPGVGRKTRQLTPAEVLATLREIFGIELGADDSTLLLERLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords Probable arylamine n-acetyl transferase
total genus 86
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4guzA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4guzA01
1E2TA 3LTWA 4GUZA 4NV7A 4NV8A 2VFCA 1W5RA 1W4TA 2BSZA 1GX3A 4C5PA 4B55A 2VFBA 4BGFA 1W6FA 3D9WA
chains in the Genus database with same CATH superfamily
4OMWA 3FENA 1NQNA 4LZVA 1MDCA 5LJCA 1ZNGA 1DFVA 4ZGUA 1OBPA 3KFHA 2QM9A 2RTCB 1YP7A 3D9WA 1AB0A 1SLGB 4AYHA 4GJVA 3RSWA 4XMDA 2PI3O 4CDFA 2AL0X 2MWHA 4O4UA 3ZW1A 2DM5A 3SOTA 3CQNA 3SZHA 1YUPA 3ZW1B 4C5PA 2A2UA 1E2TA 1NGLA 3RE5A 4GNYA 1YWCA 2FHNX 3BSZE 1NP1A 4NYRA 1QWDA 2KTDA 3FR5A 3FR2A 4O9SA 4RUUA 4UU3A 5EEEA 3U9PC 1Y9LA 1NBXA 1NP4A 2C1QA 4INNA 1BSOA 4AW8A 1LCWA 3NX1A 2RTLA 4UU2A 3SAOA 4CV7A 5LJDA 1JYDA 4I3CA 4D6BA 3WOVA 1PM1X 4AZNA 3RBYA 2GTFX 1MK5A 4ES7A 3PH5A 4YH0A 3WJDA 3P6EA 2LA7A 3VGWA 1GX8A 1Y55X 2W2FA 1EXSA 1FELA 1AQBA 3FA7A 4BVMA 1BLRA 1UYOX 5L8OA 1YP6A 4GU8A 1CRBA 2WWPA 4QZTA 5EZ2A 3AKNA 5H9NA 3T2XA 1SRJA 1SXXA 3VG5A 2RTBB 4CSBA 4NW4A 1D3SA 1KT4A 2OZQA 3PDFA 4QRLA 4ODDA 3WJCA 1A3YA 2C1SA 4WBKA 2G8CO 2WQ9A 4I6SA 1S7DA 1SA8A 2WEWA 3CKFA 3NPOA 3NQ9A 2JU8A 1JYJA 1TXLA 1LNMA 5JR8A 1SWRA 2QO4A 3EBWA 2OY1O 2LB6A 2X4MA 1EQDA 3BRNA 3BU1A 3PK2A 4BX6A 2X55A 1SREA 5D8JA 3STMX 3EC5A 3LHNA 3QQ2A 2OVAA 2GJ5A 1W5RA 5F6ZA 1MX7A 1AELA 2OL8O 4AZOA 1I05A 3SLJA 5L8IA 2OY8A 1A57A 1X8NA 4EFGA 5LJKA 1T68X 4MVEA 5HTEA 3VHIA 3KFIA 3U0DA 1BSYA 5D48A 5B2AO 3FR4A 3SZJA 2OVSA 1HMSA 2FGSA 2IZGB 4XMHA 1JMXA 1S44A 4WHIA 5D47A 1SXYA 3NQKA 4EEJA 2OF8A 3GE2A 2NNDA 4I60A 3VE2A 3HWGA 1E02A 3CR6A 4O4XA 4GGZA 1ACDA 4YDBA 1SWDA 3EW1A 1ML7A 5FAZA 1W4TA 2RTJA 3BLGA 2JOZA 3OJYC 4I3BA 5AEOA 5IO5A 4NNTA 4ORRA 1MUPA 3EW2A 2L9CA 3UEXA 2OF9A 1SY2A 3FMZA 3MBTA 2JMBA 4ARHA 4CPFA 1WUBA 4QGVA 2X8SA 2IFBA 4IB8A 2HMBA 4OS8A 2OL6O 4I9SA 4IMNA 1GM6A 2KT4B 1T8VA 1VWKB 3HOEA 3KZAA 4MEEA 5F7GA 3WYPA 1ERXA 4ZFXA 1LIDA 3WXQA 3KVNA 4CDCA 3VE1A 1VWJB 1KT6A 3ELXA 5D4AA 3T6LA 3S5VA 3BX7A 4PJ2A 1VWMB 1HY2A 3CQRA 5H8TA 3WZOA 1N0SA 1AVGI 2BS5A 4GJSA 2Z4IA 4MVKA 4Z2OA 2C4IA 3DSZA 4MVIA 3ZUIA 1EIIA 2FLJA 1KZWA 5KIDA 1BM5A 1DZPA 4YBUA 3FW5A 4A1HA 4GGTA 2BSZA 3NR3A 5IRAA 4CPHB 4NYQA 1VWNB 1EPAA 2X56A 1G85A 2AVIA 2OVEA 4HPBA 4BGFA 4XMFA 1RXHA 3IA8A 3HPEA 2OY5O 2IZKA 3VU1A 4GZVA 4WFVA 4ZH9A 1RBPA 4ALOA 3CKGA 3MG5A 1FJ1E 1U0XA 2CZUA 4NLJA 2WQAE 1XKIA 1FE3A 4L1NA 2AKQA 4ZCBA 5EPQA 4B55A 1MM9A 1TW4A 1X71A 2A0AA 1GXAA 2X34A 3P6HA 1IKJA 2QO6A 3CBSA 1CBSA 2KTSA 1KXOA 4BJ8A 1SWOA 4IB9A 4MVLA 1EPBA 3ZW2A 3P24A 3S60A 5K68A 2G7BA 4QNIA 4YFRA 3BX8A 1LICA 4K19A 4OKAA 3OE3A 4RUNA 4N7CA 1JZUA 4R0BA 4OEMA 3B2HA 2FKJA 2NNQA 2LBVA 1KQXA 2RTKA 3H3IA 1E00A 4ORWA 2GH7A 1LFOA 1AVDA 1HMTA 1QFVA 4O3ZA 5F1EA 2RTPB 1SY1A 1LIFA 3VPJE 4FBVA 4BX5B 1N9YA 2YG2A 3RDQA 3WVMA 4NNSA 1KOIA 4ORYA 2UZ2A 5BVTA 1BJ7A 2WSJA 1JIWI 1NDJA 1N4JA 3MM0A 2F01A 2PQTA 2AT3X 1B0OA 2CZTA 1BRPA 2I5VO 2IZFB 1L6MA 5AJBA 4JNJA 5LKEA 3FIQA 1I06A 3BU9A 2W2BA 5K06A 1VYOA 3JSQA 3Q34A 4BX7B 2GTLO 4YFPA 4TNNA 1K3BA 3HWFA 1MOYA 3EYCA 1VWDB 2R74A 2VFCA 3CWKA 3ZZVA 2GTLM 2Q2PA 1QY1A 3OBLA 1LCZA 3WJEA 1IW2A 1E5PA 4YFQA 1ZNDA 2IZCB 4O3YA 3STKA 4DQ4A 2Q9SA 3KFGA 1SY3A 1VYGA 3FYFA 5HZ6A 5FQ7E 1VWFB 1VWOB 5B5GA 3L4RA 4AZQA 1EIOA 4EQAC 1JBHA 2VFBA 1B8EA 3P6CA 4IB7A 4JGLA 5EEDA 4ORUA 1RSUB 3K3LA 5EDCA 5HAEA 1RAVA 2ACPX 3EM0A 3O22A 4IRWA 4Y5DA 1SXUA 1X8UA 2IZBA 2WEXA 4NV8A 1GKAA 3FEPA 3O19A 4GGRA 2A13A 1ZRYA 3NP1A 5HZ8A 2RTIB 4YMYA 2QOMA 5HWZA 2Q4NA 1KFFA 2R73A 4YKMA 4D6AA 1BBPA 1RXKA 4YBPA 3C78X 2GTLN 2AF5A 3WYQA 4CPHA 2IZLB 1W6FA 5DPQA 3WBGA 2RTOB 2Y3EA 4ML7B 4ZH6A 1SWUA 4N7DA 3RWXA 5F2BA 4KH8A 3FIDA 1YIVA 1SMPI 2OFRX 2RTFB 1ZNEA 3WJFA 1SRGA 1I4UA 1SLEB 1VWEB 1KZXA 1SWSA 3VHHA 2O62A 1SRFA 4BQUA 2AH7X 4HWMA 4ID2A 4Z6JA 2FWVA 2A2GA 4GKCA 1LELA 4QQ1A 1ALBA 2RN4A 2Y32A 1STRB 4QYNA 4A60A 2VDFA 2MHDA 1LUQA 2IJAA 3JS1A 2CM9A 1BRQA 4U46A 4YGZA 1CBIA 1VWHB 4JHQA 1AVEA 2ASNX 2UYWA 4GRJA 3RZYA 3S5XA 1DV9A 1JV4A 1UZ2X 5LJHA 2RTMA 1PBOA 3APWA 1STPA 3PEDA 4PSQA 2IZJA 1BEBA 1ICNA 1HXLA 4Y0QA 1SWLA 1CJ5A 2JN3A 4HFOA 3D97A 4OELA 4NLIA 3SLTA 5IRWA 3HWDA 4CDEA 1S2PA 1B56A 1OSPO 2MF6A 2L68A 1VWIB 1TOUA 3ZUOA 1GKAB 4Z28A 2RTRB 2X8FA 3APXA 1KL3A 1Z24A 1DF8A 1IIUA 2RTAA 1K24A 1IJ8A 2DJGA 5BYPA 4AZRA 1IFCA 1QY0A 3TF6A 4KT5A 3FA9A 1O8VA 4Y0RA 5CHKA 3ZW0B 1FDQA 3FA6A 1SWGA 2ZAGA 4IABA 1LIEA 4EKVA 1JJXA 4IAXA 4A8ZA 1FEMA 1EUOA 2A8GA 4KIIA 4Z2PA 1QABE 1I04A 1N43A 4M7MA 4ZR2A 3NQ3A 1LDQA 1VWBB 2RTNB 2QOSC 4QGXA 1PBYA 2MO5A 1KT3A 3VG2A 1R0UA 2RTGB 4DCBA 4LKPA 4IMOA 1SWAA 3HWEA 1SWJA 2OFBA 4QGWA 3T1DA 2G5LA 1VWQB 2NP1A 2R56A 3B2LA 1JMZA 2YMSA 4M6SA 3TGBA 1OEEA 2CBSA 3B2JA 1DF3A 2F09A 5C0NA 3ZI8A 1JJJA 2X46A 3F8AA 4IB6A 4COTA 3MX7A 2G78A 2A5BA 2FS6A 2WPUA 1A2DA 1E06A 3D96A 4I3DA 1VWRB 1XCAA 1VWAB 2OY7A 4BX5A 4DMOA 2FTBA 3T6FA 2QCBA 3ZQ3A 2HZRA 3C77X 3FEKA 2JU3A 2RTEB 3APUA 1QFTA 2MM3A 2GC9A 1PTSA 2Q39A 1OEJA 3MVFA 2G79A 4DQ3A 3P02A 5FENA 2Z4HA 1SRHA 3IFBA 1IKEA 1MEPA 1GT3A 4ZJ0A 2FHLA 2WR6A 3NX2A 1TVQA 5KHPA 2FS7A 5FFHA 3TGCA 1OPAA 1X8OA 1OBUA 3AUMO 1MVGA 3FDCA 1LPJA 1A18A 2CBRA 3PECA 5H9AA 4GE1A 5HA1A 3SZIA 3WZPA 4HPDA 5CSEA 2FR3A 5B3MO 1LDOA 2AMMX 5IO6A 3D95A 3ZW0A 3LTWA 4JO6A 1VWPB 4CPIA 2OFMX 4GH7A 2A5CA 2X45A 4AZPA 3LNBA 2DJFA 3V8UA 5F58A 5LKFA 3RDUA 2AT8X 1DC9A 2FR2A 2RTDB 3HOLA 4FGIB 4XMCA 3BY0A 3X00A 2NNEA 1HQPA 1GX9A 1RXJA 4ZHGA 5HZ5A 4Y59A 1ZNKA 1MX8A 1VWCB 4YGGA 4BX6B 4U9CA 1RSTB 2HKDA 3UEWA 4FBRA 5F6BA 2L67A 4TKHA 4A1YA 1SWPA 1Y0GA 1KQWA 3KFFA 2RTHB 3VG6A 1SWQA 1SLFB 2ANSA 1PEEA 4ZHDA 3EMMA 2AT5X 1KT7A 2CAMA 3ZWEA 2BS6A 3CMPA 2POAA 5D45A 2BLGA 4ZHHA 1SY0A 3VHMA 1KT5A 1QY2A 1G7NA 2I5ZO 3N91A 5HCDC 5HA0A 1PMPA 5B11O 1KGLA 4GNWA 2LFOA 3VG7A 2MJIA 1CBQA 2BT9A 2W2AA 2X32A 4O4OA 1ERBA 1SWFA 3CBCA 4EXZA 1D2UA 5IXGA 1ADLA 1O1UA 1X8PA 3RE6A 3G7XA 2AT0X 2FKGA 5LJGA 4YDAA 2RCQA 3LV4A 2AT6X 5K67A 4TQ2A 1JJUA 3VG4A 4HPCA 1FTPA 3AEHA 3SLOA 4ZHCA 4ON1A 5KICA 1HXZA 2QMIA 3FLLA 4BBOA 2N93A 1GT1A 2OL7A 4TJZA 2ALLX 4YVBA 1UREA 2QO5A 4LZUA 5CYBA 1SLDB 3DTQA 5L8NA 1HQQA 5HCCC 4CK4A 1JQPA 3HTYA 3APVA 2RQ0A 3B2IA 4HPAA 1NQMA 5FQ6E 4YKOA 5AJCA 3RDXA 3EBKA 1I9HA 2XKLA 2RA6A 4MIRA 3T2WA 2IZDB 1SWNA 4IBAA 4KCAA 5B27A 1YWAA 4Y0SA 2ZAIA 4YGHA 2LKKA 3U03A 3PPTA 2ACOA 3FW4A 2RCTA 2BC3A 3BS2A 1HN2A 3P6DA 4XMEA 5CE4A 1VYFA 4TLJA 2PFRA 4QZUA 5DG4A 3D4RA 4GDAA 3WZNA 2HNXA 1LIBA 3RDOA 4BCSA 2K23A 1U17A 4NP1A 3TGAA 1HMRA 1EALA 1ICMA 4GD9A 4Y0PA 1G5WA 5HZ9A 3PQSA 4ORSA 4MISA 1DZKA 1H91A 2OVDA 1GT5A 1IFBA 1NC9A 4U8UO 2RTQB 2JGSA 3RKGA 5LJEA 1OEKA 3FELA 3RY2A 4BOEA 4Z2VA 3FA8A 1SWHA 2JW1A 1VWLB 4QAEA 3VG3A 1T0VA 2FRSA 3P6GA 3HK1A 3STNA 3S26A 4O3XB 3NBXX 1LF7A 1OBQA 3JQOA 2F73A 4I9RA 1YWBA 3Q6LA 1Y53X 1SWEA 4OMXA 2K62A 3RDSA 3WZQA 2KD2A 4FBOA 5BVSA 1QG5A 5IRUA 4O4SA 4IAWA 1EW3A 1QQSA 1STSB 1O1VA 3GAQA 2RD7C 4GDZA 3P6FA 3I17A 1LCVA 1SWTA 2OYBO 5H9KA 1TOWA 4ZGFA 4I95A 4GETA 3NADA 1YWDA 2HYSA 4FQBB 1OPBA 4LKTA 4O49A 4YCEA 3UEVA 3PH6A 3OD9A 3WJGA 2WUTA 3PP6A 5IO7A 5LJBA 1LKEA 2CM4A 1G74A 2E4JA 4U8UM 4YCHA 1WBIA 3O2YA 2KW1A 4QYPA 4U8UN 1DZJA 1ZNHA 4WFUA 5FQ8E 1CBRA 3C76X 4OS0A 5H9LA 1Y9TA 1DZMA 1ZNLA 2Y3FA 2M4LA 1SWBA 4DNEA 3F9DA 3F6ZB 4TKBA 2IZIA 2OFAA 5HBSA 4Z27A 3BDRA 2A3FX 1SRIA 4CPEA 3AKMA 3TZSA 1U18A 1VPRA 1VWGB 2IZAA 4KC8A 4NV7A 4KC7A 5JD2A 2XSTA 4CDDA 1RLBE 2EU7X 1FENA 1X89A 5HTDA 5L3YA 2LBAA 1X8QA 4EDEA 1BWYA 1GX3A 1Y52X 3B2KA 2IZHB 4O3WA 1KL5A 4GUZA 3WJBA 1HBPA 1KL4A 2ZSCA 3E3CA 4XMGA 1B4MA 4GK9A 4BX7A 4AZMA 1P6PA 1N9MA 1GGLA 3KQ0A 5B10O 1N7YA 1SWKA 1EI5A 2PY1A 4OS3A 5EDBA 5HCEC 1SXWA 2X8TA 3PQUA 5B29A 3ELZA 4L3RA 3QKGA 4ALBA 2P8GA 2FT9A 3UEUA 1GT4A 5BVQA 4TKJA 1BSQA 3I0AA 3RY1A 3UAQA 1I78A 4ORXA 2JU7A 2L5PA 2HZQA 2Q2MA 5B5FA 1HBQA 2HLVA 2BHVA 5HZQA 3RDMA 4ZHFA 1SWCA 1UYNX 5AQ6A 2IZEB 4LQZA 4U3QA
chains in the Genus database with same CATH topology
1CJLA 3H89A 3WXGA 2B1MA 1NLJA 4YYUA 2VHFA 1BY8A 1CTEA 3D9WA 3PBHA 1YVBA 3KWBX 1BGOA 2HXZA 3BPFA 4C5PA 2DCCA 2P7UA 3MORA 3ZUAA 1E2TA 3BCNA 3H7DA 3MHHA 2DZYA 3K9MA 4PADA 1VSNA 1AECA 4AXLA 1Q6KA 3RVVA 2F1GA 5A24A 2VHSA 3KFQA 3PDFA 1VJVA 3TNXA 2Y6EA 3N4CA 3NHEA 1DEUA 3IUTA 2FYEA 1PXVA 2CB5A 1W5RA 2DCDA 1ITOA 4YYQA 3MHSA 3WXEA 3RVWA 2PREA 2DC9A 4W5CA 2C0YA 1GMYA 3H6SA 2E01A 3IMAA 1THEA 5CHTA 1U9VA 3GCBA 1O0EA 1TU6A 3KW9A 2DZZA 4ZUXU 1W4TA 4DMYA 1AU0A 3USVA 5CVMA 4CZWA 5PADA 2F7DA 3P5VA 4PP2E 4BS6A 1CB5A 1PPDA 4MSXA 1QXPA 2E00A 2FTDA 3OISA 2GFOA 2HH5A 4BSQA 1AU2A 1MEMA 4FK5A 4YYVA 1PPOA 4YVAA 2AU1A 4YYSA 5JH3A 1CS8A 1ME4A 2BSZA 1YT7A 4BGFA 2DC7A 4P6EA 7PCKA 3PW3A 2AUZA 1QOLA 2OZ2A 3PNRA 4CDCB 4G54A 4W5BA 1MIRA 4Q8GA 1Y08A 2DJFB 3B79A 2BDZA 1AU3A 1ICFA 4B55A 3OVXA 3KKUA 1AYWA 4DMXA 4XR7A 3F5VA 3QJ3A 3P5UA 2AIMA 1SP4B 2FUDA 1POPA 3I06A 4OEMA 4I05A 2DC8A 1STFE 2AS8A 3QT4A 3D6SA 2XU3A 2R9NA 4X6JA 1GLOA 2JQFR 1F2BA 4CDFB 1GCBA 3CH2X 1Y4HA 2WBFX 3MTNA 9PAPA 4QH6A 1NQCA 1K3BB 3RVXA 1ZCMA 2VFCA 3C9EA 2ARYA 1U9QX 1U9WA 2VFBA 5CVNB 6PADA 3H8CA 2FRQA 3O0UA 5JA7A 2G8EA 1XKGA 3KX1A 4NV8A 1BP4A 3K8UA 4KLBA 1AU4A 2O6XA 1EWPA 3H8BA 4X6IA 3KSEA 2PBHA 1W6FA 4I07A 4AXMA 2G7YA 2XU1A 1PPPA 1U5IA 4W4UA 4N4ZA 5FPWA 3N3KA 5K16A 5J94A 3BOWA 1CPJA 2YJ2A 3IOQA 2R9OA 3S3RA 3S3QA 3BWKA 2DCAA 4HWYA 4QRXA 1ATKA 1ME3A 4OELA 2P0RA 2R9FA 2DC6A 1EWLA 1PADA 5EF4A 4XUIA 1ZIVA 4X6HA 3I3TA 3WXFA 1AIMA 5F02A 2ACTA 4FJCA 1NL6A 1S4VA 3BC3A 2ATOA 3HD3A 3V6EA 3F75A 1NB3A 1AYUA 2NQIA 1F2CA 2Y5BA 3IEJA 1PPNA 2AYOA 4BS5A 3CH3X 3ERVA 1GECE 1TL9A 3KWZA 2E03A 3CBJA 2OULA 2YJ8A 1PCIA 1U9XA 2PADA 3LTWA 2IPPB 4N8WA 1KHPA 2NQAA 8PCHA 1CSBB 3U8EA 1PBHA 4FIPA 2BDLA 1F2AA 3V6CA 4QRVA 2YJBA 1AYVA 1KFUL 2G8JA 3OF9A 3LXSA 1IWDA 1M6DA 4N79A 4K7CA 2FO5A 1EWOA 4PI3A 2DCBA 1QDQA 3LFYA 2JQGR 1QMYA 2AVWA 2IBIA 1NB5A 4QBBA 3AI8A 3E1ZB 1PIPA 1A6RA 5CVOB 1PE6A 1NPZA 2R9MA 2GHUA 2FT2A 3QSDA 2B1NA 3HHAA 1JQPA 2NQGA 1KXRA 2AUXA 3O1GA 1YK8A 1CQDA 4QRGA 1DF0A 2DJGB 3CBKA 4I04A 1KFXL 2XU5A 3M99A 3DF0A 1F29A 3IV2A 4BQVA 1MDWA 1FH0A 1MS6A 4P6GA 3HHIA 1SNKA 2R6NA 3P5WA 2P86A 1EF7A 2G6DA 3N3GA 1X9YA 1KHQA 2CIOA 1YK7A 4PP1A 1TLOA 4CDDB 4Q8HA 2PNSA 2YJCA 4YYRA 2XU4A 5CHVA 4YYWA 3OVZA 2E02A 2R9CA 4WA6A 2FQ9A 4MZOA 3OF8A 1CVZA 4NV7A 3P5XA 1YALA 1CV8A 4MZSA 4BPVA 2OP3A 1GX3A 3IHPA 4GUZA 2YJ9A 2HD5A 4RY2A 5EGWA 3K24A 2AYNA 4CDEB 2NQDB 3HWNA 4YV8A 2HHNA 2FRAA 1HUCB 1BQIA 1EWMA 1MHWA 2H7JA 1MEGA 3BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2T A;  3LTW A;  4GUZ A;  4NV7 A;  4NV8 A;  2VFC A;  1W5R A;  1W4T A;  2BSZ A;  1GX3 A;  4C5P A;  4B55 A;  2VFB A;  4BGF A;  1W6F A;  3D9W A; 
#chains in the Genus database with same CATH topology
 4OMW A;  3FEN A;  1NQN A;  4LZV A;  1MDC A;  5LJC A;  1ZNG A;  1DFV A;  4ZGU A;  1OBP A;  3KFH A;  2QM9 A;  2RTC B;  1YP7 A;  3D9W A;  1AB0 A;  1SLG B;  4AYH A;  4GJV A;  3RSW A;  4XMD A;  2PI3 O;  4CDF A;  2AL0 X;  2MWH A;  4O4U A;  3ZW1 A;  2DM5 A;  3SOT A;  3CQN A;  3SZH A;  1YUP A;  3ZW1 B;  4C5P A;  2A2U A;  1E2T A;  1NGL A;  3RE5 A;  4GNY A;  1YWC A;  2FHN X;  3BSZ E;  1NP1 A;  4NYR A;  1QWD A;  2KTD A;  3FR5 A;  3FR2 A;  4O9S A;  4RUU A;  4UU3 A;  5EEE A;  3U9P C;  1Y9L A;  1NBX A;  1NP4 A;  2C1Q A;  4INN A;  1BSO A;  4AW8 A;  1LCW A;  3NX1 A;  2RTL A;  4UU2 A;  3SAO A;  4CV7 A;  5LJD A;  1JYD A;  4I3C A;  4D6B A;  3WOV A;  1PM1 X;  4AZN A;  3RBY A;  2GTF X;  1MK5 A;  4ES7 A;  3PH5 A;  4YH0 A;  3WJD A;  3P6E A;  2LA7 A;  3VGW A;  1GX8 A;  1Y55 X;  2W2F A;  1EXS A;  1FEL A;  1AQB A;  3FA7 A;  4BVM A;  1BLR A;  1UYO X;  5L8O A;  1YP6 A;  4GU8 A;  1CRB A;  2WWP A;  4QZT A;  5EZ2 A;  3AKN A;  5H9N A;  3T2X A;  1SRJ A;  1SXX A;  3VG5 A;  2RTB B;  4CSB A;  4NW4 A;  1D3S A;  1KT4 A;  2OZQ A;  3PDF A;  4QRL A;  4ODD A;  3WJC A;  1A3Y A;  2C1S A;  4WBK A;  2G8C O;  2WQ9 A;  4I6S A;  1S7D A;  1SA8 A;  2WEW A;  3CKF A;  3NPO A;  3NQ9 A;  2JU8 A;  1JYJ A;  1TXL A;  1LNM A;  5JR8 A;  1SWR A;  2QO4 A;  3EBW A;  2OY1 O;  2LB6 A;  2X4M A;  1EQD A;  3BRN A;  3BU1 A;  3PK2 A;  4BX6 A;  2X55 A;  1SRE A;  5D8J A;  3STM X;  3EC5 A;  3LHN A;  3QQ2 A;  2OVA A;  2GJ5 A;  1W5R A;  5F6Z A;  1MX7 A;  1AEL A;  2OL8 O;  4AZO A;  1I05 A;  3SLJ A;  5L8I A;  2OY8 A;  1A57 A;  1X8N A;  4EFG A;  5LJK A;  1T68 X;  4MVE A;  5HTE A;  3VHI A;  3KFI A;  3U0D A;  1BSY A;  5D48 A;  5B2A O;  3FR4 A;  3SZJ A;  2OVS A;  1HMS A;  2FGS A;  2IZG B;  4XMH A;  1JMX A;  1S44 A;  4WHI A;  5D47 A;  1SXY A;  3NQK A;  4EEJ A;  2OF8 A;  3GE2 A;  2NND A;  4I60 A;  3VE2 A;  3HWG A;  1E02 A;  3CR6 A;  4O4X A;  4GGZ A;  1ACD A;  4YDB A;  1SWD A;  3EW1 A;  1ML7 A;  5FAZ A;  1W4T A;  2RTJ A;  3BLG A;  2JOZ A;  3OJY C;  4I3B A;  5AEO A;  5IO5 A;  4NNT A;  4ORR A;  1MUP A;  3EW2 A;  2L9C A;  3UEX A;  2OF9 A;  1SY2 A;  3FMZ A;  3MBT A;  2JMB A;  4ARH A;  4CPF A;  1WUB A;  4QGV A;  2X8S A;  2IFB A;  4IB8 A;  2HMB A;  4OS8 A;  2OL6 O;  4I9S A;  4IMN A;  1GM6 A;  2KT4 B;  1T8V A;  1VWK B;  3HOE A;  3KZA A;  4MEE A;  5F7G A;  3WYP A;  1ERX A;  4ZFX A;  1LID A;  3WXQ A;  3KVN A;  4CDC A;  3VE1 A;  1VWJ B;  1KT6 A;  3ELX A;  5D4A A;  3T6L A;  3S5V A;  3BX7 A;  4PJ2 A;  1VWM B;  1HY2 A;  3CQR A;  5H8T A;  3WZO A;  1N0S A;  1AVG I;  2BS5 A;  4GJS A;  2Z4I A;  4MVK A;  4Z2O A;  2C4I A;  3DSZ A;  4MVI A;  3ZUI A;  1EII A;  2FLJ A;  1KZW A;  5KID A;  1BM5 A;  1DZP A;  4YBU A;  3FW5 A;  4A1H A;  4GGT A;  2BSZ A;  3NR3 A;  5IRA A;  4CPH B;  4NYQ A;  1VWN B;  1EPA A;  2X56 A;  1G85 A;  2AVI A;  2OVE A;  4HPB A;  4BGF A;  4XMF A;  1RXH A;  3IA8 A;  3HPE A;  2OY5 O;  2IZK A;  3VU1 A;  4GZV A;  4WFV A;  4ZH9 A;  1RBP A;  4ALO A;  3CKG A;  3MG5 A;  1FJ1 E;  1U0X A;  2CZU A;  4NLJ A;  2WQA E;  1XKI A;  1FE3 A;  4L1N A;  2AKQ A;  4ZCB A;  5EPQ A;  4B55 A;  1MM9 A;  1TW4 A;  1X71 A;  2A0A A;  1GXA A;  2X34 A;  3P6H A;  1IKJ A;  2QO6 A;  3CBS A;  1CBS A;  2KTS A;  1KXO A;  4BJ8 A;  1SWO A;  4IB9 A;  4MVL A;  1EPB A;  3ZW2 A;  3P24 A;  3S60 A;  5K68 A;  2G7B A;  4QNI A;  4YFR A;  3BX8 A;  1LIC A;  4K19 A;  4OKA A;  3OE3 A;  4RUN A;  4N7C A;  1JZU A;  4R0B A;  4OEM A;  3B2H A;  2FKJ A;  2NNQ A;  2LBV A;  1KQX A;  2RTK A;  3H3I A;  1E00 A;  4ORW A;  2GH7 A;  1LFO A;  1AVD A;  1HMT A;  1QFV A;  4O3Z A;  5F1E A;  2RTP B;  1SY1 A;  1LIF A;  3VPJ E;  4FBV A;  4BX5 B;  1N9Y A;  2YG2 A;  3RDQ A;  3WVM A;  4NNS A;  1KOI A;  4ORY A;  2UZ2 A;  5BVT A;  1BJ7 A;  2WSJ A;  1JIW I;  1NDJ A;  1N4J A;  3MM0 A;  2F01 A;  2PQT A;  2AT3 X;  1B0O A;  2CZT A;  1BRP A;  2I5V O;  2IZF B;  1L6M A;  5AJB A;  4JNJ A;  5LKE A;  3FIQ A;  1I06 A;  3BU9 A;  2W2B A;  5K06 A;  1VYO A;  3JSQ A;  3Q34 A;  4BX7 B;  2GTL O;  4YFP A;  4TNN A;  1K3B A;  3HWF A;  1MOY A;  3EYC A;  1VWD B;  2R74 A;  2VFC A;  3CWK A;  3ZZV A;  2GTL M;  2Q2P A;  1QY1 A;  3OBL A;  1LCZ A;  3WJE A;  1IW2 A;  1E5P A;  4YFQ A;  1ZND A;  2IZC B;  4O3Y A;  3STK A;  4DQ4 A;  2Q9S A;  3KFG A;  1SY3 A;  1VYG A;  3FYF A;  5HZ6 A;  5FQ7 E;  1VWF B;  1VWO B;  5B5G A;  3L4R A;  4AZQ A;  1EIO A;  4EQA C;  1JBH A;  2VFB A;  1B8E A;  3P6C A;  4IB7 A;  4JGL A;  5EED A;  4ORU A;  1RSU B;  3K3L A;  5EDC A;  5HAE A;  1RAV A;  2ACP X;  3EM0 A;  3O22 A;  4IRW A;  4Y5D A;  1SXU A;  1X8U A;  2IZB A;  2WEX A;  4NV8 A;  1GKA A;  3FEP A;  3O19 A;  4GGR A;  2A13 A;  1ZRY A;  3NP1 A;  5HZ8 A;  2RTI B;  4YMY A;  2QOM A;  5HWZ A;  2Q4N A;  1KFF A;  2R73 A;  4YKM A;  4D6A A;  1BBP A;  1RXK A;  4YBP A;  3C78 X;  2GTL N;  2AF5 A;  3WYQ A;  4CPH A;  2IZL B;  1W6F A;  5DPQ A;  3WBG A;  2RTO B;  2Y3E A;  4ML7 B;  4ZH6 A;  1SWU A;  4N7D A;  3RWX A;  5F2B A;  4KH8 A;  3FID A;  1YIV A;  1SMP I;  2OFR X;  2RTF B;  1ZNE A;  3WJF A;  1SRG A;  1I4U A;  1SLE B;  1VWE B;  1KZX A;  1SWS A;  3VHH A;  2O62 A;  1SRF A;  4BQU A;  2AH7 X;  4HWM A;  4ID2 A;  4Z6J A;  2FWV A;  2A2G A;  4GKC A;  1LEL A;  4QQ1 A;  1ALB A;  2RN4 A;  2Y32 A;  1STR B;  4QYN A;  4A60 A;  2VDF A;  2MHD A;  1LUQ A;  2IJA A;  3JS1 A;  2CM9 A;  1BRQ A;  4U46 A;  4YGZ A;  1CBI A;  1VWH B;  4JHQ A;  1AVE A;  2ASN X;  2UYW A;  4GRJ A;  3RZY A;  3S5X A;  1DV9 A;  1JV4 A;  1UZ2 X;  5LJH A;  2RTM A;  1PBO A;  3APW A;  1STP A;  3PED A;  4PSQ A;  2IZJ A;  1BEB A;  1ICN A;  1HXL A;  4Y0Q A;  1SWL A;  1CJ5 A;  2JN3 A;  4HFO A;  3D97 A;  4OEL A;  4NLI A;  3SLT A;  5IRW A;  3HWD A;  4CDE A;  1S2P A;  1B56 A;  1OSP O;  2MF6 A;  2L68 A;  1VWI B;  1TOU A;  3ZUO A;  1GKA B;  4Z28 A;  2RTR B;  2X8F A;  3APX A;  1KL3 A;  1Z24 A;  1DF8 A;  1IIU A;  2RTA A;  1K24 A;  1IJ8 A;  2DJG A;  5BYP A;  4AZR A;  1IFC A;  1QY0 A;  3TF6 A;  4KT5 A;  3FA9 A;  1O8V A;  4Y0R A;  5CHK A;  3ZW0 B;  1FDQ A;  3FA6 A;  1SWG A;  2ZAG A;  4IAB A;  1LIE A;  4EKV A;  1JJX A;  4IAX A;  4A8Z A;  1FEM A;  1EUO A;  2A8G A;  4KII A;  4Z2P A;  1QAB E;  1I04 A;  1N43 A;  4M7M A;  4ZR2 A;  3NQ3 A;  1LDQ A;  1VWB B;  2RTN B;  2QOS C;  4QGX A;  1PBY A;  2MO5 A;  1KT3 A;  3VG2 A;  1R0U A;  2RTG B;  4DCB A;  4LKP A;  4IMO A;  1SWA A;  3HWE A;  1SWJ A;  2OFB A;  4QGW A;  3T1D A;  2G5L A;  1VWQ B;  2NP1 A;  2R56 A;  3B2L A;  1JMZ A;  2YMS A;  4M6S A;  3TGB A;  1OEE A;  2CBS A;  3B2J A;  1DF3 A;  2F09 A;  5C0N A;  3ZI8 A;  1JJJ A;  2X46 A;  3F8A A;  4IB6 A;  4COT A;  3MX7 A;  2G78 A;  2A5B A;  2FS6 A;  2WPU A;  1A2D A;  1E06 A;  3D96 A;  4I3D A;  1VWR B;  1XCA A;  1VWA B;  2OY7 A;  4BX5 A;  4DMO A;  2FTB A;  3T6F A;  2QCB A;  3ZQ3 A;  2HZR A;  3C77 X;  3FEK A;  2JU3 A;  2RTE B;  3APU A;  1QFT A;  2MM3 A;  2GC9 A;  1PTS A;  2Q39 A;  1OEJ A;  3MVF A;  2G79 A;  4DQ3 A;  3P02 A;  5FEN A;  2Z4H A;  1SRH A;  3IFB A;  1IKE A;  1MEP A;  1GT3 A;  4ZJ0 A;  2FHL A;  2WR6 A;  3NX2 A;  1TVQ A;  5KHP A;  2FS7 A;  5FFH A;  3TGC A;  1OPA A;  1X8O A;  1OBU A;  3AUM O;  1MVG A;  3FDC A;  1LPJ A;  1A18 A;  2CBR A;  3PEC A;  5H9A A;  4GE1 A;  5HA1 A;  3SZI A;  3WZP A;  4HPD A;  5CSE A;  2FR3 A;  5B3M O;  1LDO A;  2AMM X;  5IO6 A;  3D95 A;  3ZW0 A;  3LTW A;  4JO6 A;  1VWP B;  4CPI A;  2OFM X;  4GH7 A;  2A5C A;  2X45 A;  4AZP A;  3LNB A;  2DJF A;  3V8U A;  5F58 A;  5LKF A;  3RDU A;  2AT8 X;  1DC9 A;  2FR2 A;  2RTD B;  3HOL A;  4FGI B;  4XMC A;  3BY0 A;  3X00 A;  2NNE A;  1HQP A;  1GX9 A;  1RXJ A;  4ZHG A;  5HZ5 A;  4Y59 A;  1ZNK A;  1MX8 A;  1VWC B;  4YGG A;  4BX6 B;  4U9C A;  1RST B;  2HKD A;  3UEW A;  4FBR A;  5F6B A;  2L67 A;  4TKH A;  4A1Y A;  1SWP A;  1Y0G A;  1KQW A;  3KFF A;  2RTH B;  3VG6 A;  1SWQ A;  1SLF B;  2ANS A;  1PEE A;  4ZHD A;  3EMM A;  2AT5 X;  1KT7 A;  2CAM A;  3ZWE A;  2BS6 A;  3CMP A;  2POA A;  5D45 A;  2BLG A;  4ZHH A;  1SY0 A;  3VHM A;  1KT5 A;  1QY2 A;  1G7N A;  2I5Z O;  3N91 A;  5HCD C;  5HA0 A;  1PMP A;  5B11 O;  1KGL A;  4GNW A;  2LFO A;  3VG7 A;  2MJI A;  1CBQ A;  2BT9 A;  2W2A A;  2X32 A;  4O4O A;  1ERB A;  1SWF A;  3CBC A;  4EXZ A;  1D2U A;  5IXG A;  1ADL A;  1O1U A;  1X8P A;  3RE6 A;  3G7X A;  2AT0 X;  2FKG A;  5LJG A;  4YDA A;  2RCQ A;  3LV4 A;  2AT6 X;  5K67 A;  4TQ2 A;  1JJU A;  3VG4 A;  4HPC A;  1FTP A;  3AEH A;  3SLO A;  4ZHC A;  4ON1 A;  5KIC A;  1HXZ A;  2QMI A;  3FLL A;  4BBO A;  2N93 A;  1GT1 A;  2OL7 A;  4TJZ A;  2ALL X;  4YVB A;  1URE A;  2QO5 A;  4LZU A;  5CYB A;  1SLD B;  3DTQ A;  5L8N A;  1HQQ A;  5HCC C;  4CK4 A;  1JQP A;  3HTY A;  3APV A;  2RQ0 A;  3B2I A;  4HPA A;  1NQM A;  5FQ6 E;  4YKO A;  5AJC A;  3RDX A;  3EBK A;  1I9H A;  2XKL A;  2RA6 A;  4MIR A;  3T2W A;  2IZD B;  1SWN A;  4IBA A;  4KCA A;  5B27 A;  1YWA A;  4Y0S A;  2ZAI A;  4YGH A;  2LKK A;  3U03 A;  3PPT A;  2ACO A;  3FW4 A;  2RCT A;  2BC3 A;  3BS2 A;  1HN2 A;  3P6D A;  4XME A;  5CE4 A;  1VYF A;  4TLJ A;  2PFR A;  4QZU A;  5DG4 A;  3D4R A;  4GDA A;  3WZN A;  2HNX A;  1LIB A;  3RDO A;  4BCS A;  2K23 A;  1U17 A;  4NP1 A;  3TGA A;  1HMR A;  1EAL A;  1ICM A;  4GD9 A;  4Y0P A;  1G5W A;  5HZ9 A;  3PQS A;  4ORS A;  4MIS A;  1DZK A;  1H91 A;  2OVD A;  1GT5 A;  1IFB A;  1NC9 A;  4U8U O;  2RTQ B;  2JGS A;  3RKG A;  5LJE A;  1OEK A;  3FEL A;  3RY2 A;  4BOE A;  4Z2V A;  3FA8 A;  1SWH A;  2JW1 A;  1VWL B;  4QAE A;  3VG3 A;  1T0V A;  2FRS A;  3P6G A;  3HK1 A;  3STN A;  3S26 A;  4O3X B;  3NBX X;  1LF7 A;  1OBQ A;  3JQO A;  2F73 A;  4I9R A;  1YWB A;  3Q6L A;  1Y53 X;  1SWE A;  4OMX A;  2K62 A;  3RDS A;  3WZQ A;  2KD2 A;  4FBO A;  5BVS A;  1QG5 A;  5IRU A;  4O4S A;  4IAW A;  1EW3 A;  1QQS A;  1STS B;  1O1V A;  3GAQ A;  2RD7 C;  4GDZ A;  3P6F A;  3I17 A;  1LCV A;  1SWT A;  2OYB O;  5H9K A;  1TOW A;  4ZGF A;  4I95 A;  4GET A;  3NAD A;  1YWD A;  2HYS A;  4FQB B;  1OPB A;  4LKT A;  4O49 A;  4YCE A;  3UEV A;  3PH6 A;  3OD9 A;  3WJG A;  2WUT A;  3PP6 A;  5IO7 A;  5LJB A;  1LKE A;  2CM4 A;  1G74 A;  2E4J A;  4U8U M;  4YCH A;  1WBI A;  3O2Y A;  2KW1 A;  4QYP A;  4U8U N;  1DZJ A;  1ZNH A;  4WFU A;  5FQ8 E;  1CBR A;  3C76 X;  4OS0 A;  5H9L A;  1Y9T A;  1DZM A;  1ZNL A;  2Y3F A;  2M4L A;  1SWB A;  4DNE A;  3F9D A;  3F6Z B;  4TKB A;  2IZI A;  2OFA A;  5HBS A;  4Z27 A;  3BDR A;  2A3F X;  1SRI A;  4CPE A;  3AKM A;  3TZS A;  1U18 A;  1VPR A;  1VWG B;  2IZA A;  4KC8 A;  4NV7 A;  4KC7 A;  5JD2 A;  2XST A;  4CDD A;  1RLB E;  2EU7 X;  1FEN A;  1X89 A;  5HTD A;  5L3Y A;  2LBA A;  1X8Q A;  4EDE A;  1BWY A;  1GX3 A;  1Y52 X;  3B2K A;  2IZH B;  4O3W A;  1KL5 A;  4GUZ A;  3WJB A;  1HBP A;  1KL4 A;  2ZSC A;  3E3C A;  4XMG A;  1B4M A;  4GK9 A;  4BX7 A;  4AZM A;  1P6P A;  1N9M A;  1GGL A;  3KQ0 A;  5B10 O;  1N7Y A;  1SWK A;  1EI5 A;  2PY1 A;  4OS3 A;  5EDB A;  5HCE C;  1SXW A;  2X8T A;  3PQU A;  5B29 A;  3ELZ A;  4L3R A;  3QKG A;  4ALB A;  2P8G A;  2FT9 A;  3UEU A;  1GT4 A;  5BVQ A;  4TKJ A;  1BSQ A;  3I0A A;  3RY1 A;  3UAQ A;  1I78 A;  4ORX A;  2JU7 A;  2L5P A;  2HZQ A;  2Q2M A;  5B5F A;  1HBQ A;  2HLV A;  2BHV A;  5HZQ A;  3RDM A;  4ZHF A;  1SWC A;  1UYN X;  5AQ6 A;  2IZE B;  4LQZ A;  4U3Q A; 
#chains in the Genus database with same CATH homology
 1CJL A;  3H89 A;  3WXG A;  2B1M A;  1NLJ A;  4YYU A;  2VHF A;  1BY8 A;  1CTE A;  3D9W A;  3PBH A;  1YVB A;  3KWB X;  1BGO A;  2HXZ A;  3BPF A;  4C5P A;  2DCC A;  2P7U A;  3MOR A;  3ZUA A;  1E2T A;  3BCN A;  3H7D A;  3MHH A;  2DZY A;  3K9M A;  4PAD A;  1VSN A;  1AEC A;  4AXL A;  1Q6K A;  3RVV A;  2F1G A;  5A24 A;  2VHS A;  3KFQ A;  3PDF A;  1VJV A;  3TNX A;  2Y6E A;  3N4C A;  3NHE A;  1DEU A;  3IUT A;  2FYE A;  1PXV A;  2CB5 A;  1W5R A;  2DCD A;  1ITO A;  4YYQ A;  3MHS A;  3WXE A;  3RVW A;  2PRE A;  2DC9 A;  4W5C A;  2C0Y A;  1GMY A;  3H6S A;  2E01 A;  3IMA A;  1THE A;  5CHT A;  1U9V A;  3GCB A;  1O0E A;  1TU6 A;  3KW9 A;  2DZZ A;  4ZUX U;  1W4T A;  4DMY A;  1AU0 A;  3USV A;  5CVM A;  4CZW A;  5PAD A;  2F7D A;  3P5V A;  4PP2 E;  4BS6 A;  1CB5 A;  1PPD A;  4MSX A;  1QXP A;  2E00 A;  2FTD A;  3OIS A;  2GFO A;  2HH5 A;  4BSQ A;  1AU2 A;  1MEM A;  4FK5 A;  4YYV A;  1PPO A;  4YVA A;  2AU1 A;  4YYS A;  5JH3 A;  1CS8 A;  1ME4 A;  2BSZ A;  1YT7 A;  4BGF A;  2DC7 A;  4P6E A;  7PCK A;  3PW3 A;  2AUZ A;  1QOL A;  2OZ2 A;  3PNR A;  4CDC B;  4G54 A;  4W5B A;  1MIR A;  4Q8G A;  1Y08 A;  2DJF B;  3B79 A;  2BDZ A;  1AU3 A;  1ICF A;  4B55 A;  3OVX A;  3KKU A;  1AYW A;  4DMX A;  4XR7 A;  3F5V A;  3QJ3 A;  3P5U A;  2AIM A;  1SP4 B;  2FUD A;  1POP A;  3I06 A;  4OEM A;  4I05 A;  2DC8 A;  1STF E;  2AS8 A;  3QT4 A;  3D6S A;  2XU3 A;  2R9N A;  4X6J A;  1GLO A;  2JQF R;  1F2B A;  4CDF B;  1GCB A;  3CH2 X;  1Y4H A;  2WBF X;  3MTN A;  9PAP A;  4QH6 A;  1NQC A;  1K3B B;  3RVX A;  1ZCM A;  2VFC A;  3C9E A;  2ARY A;  1U9Q X;  1U9W A;  2VFB A;  5CVN B;  6PAD A;  3H8C A;  2FRQ A;  3O0U A;  5JA7 A;  2G8E A;  1XKG A;  3KX1 A;  4NV8 A;  1BP4 A;  3K8U A;  4KLB A;  1AU4 A;  2O6X A;  1EWP A;  3H8B A;  4X6I A;  3KSE A;  2PBH A;  1W6F A;  4I07 A;  4AXM A;  2G7Y A;  2XU1 A;  1PPP A;  1U5I A;  4W4U A;  4N4Z A;  5FPW A;  3N3K A;  5K16 A;  5J94 A;  3BOW A;  1CPJ A;  2YJ2 A;  3IOQ A;  2R9O A;  3S3R A;  3S3Q A;  3BWK A;  2DCA A;  4HWY A;  4QRX A;  1ATK A;  1ME3 A;  4OEL A;  2P0R A;  2R9F A;  2DC6 A;  1EWL A;  1PAD A;  5EF4 A;  4XUI A;  1ZIV A;  4X6H A;  3I3T A;  3WXF A;  1AIM A;  5F02 A;  2ACT A;  4FJC A;  1NL6 A;  1S4V A;  3BC3 A;  2ATO A;  3HD3 A;  3V6E A;  3F75 A;  1NB3 A;  1AYU A;  2NQI A;  1F2C A;  2Y5B A;  3IEJ A;  1PPN A;  2AYO A;  4BS5 A;  3CH3 X;  3ERV A;  1GEC E;  1TL9 A;  3KWZ A;  2E03 A;  3CBJ A;  2OUL A;  2YJ8 A;  1PCI A;  1U9X A;  2PAD A;  3LTW A;  2IPP B;  4N8W A;  1KHP A;  2NQA A;  8PCH A;  1CSB B;  3U8E A;  1PBH A;  4FIP A;  2BDL A;  1F2A A;  3V6C A;  4QRV A;  2YJB A;  1AYV A;  1KFU L;  2G8J A;  3OF9 A;  3LXS A;  1IWD A;  1M6D A;  4N79 A;  4K7C A;  2FO5 A;  1EWO A;  4PI3 A;  2DCB A;  1QDQ A;  3LFY A;  2JQG R;  1QMY A;  2AVW A;  2IBI A;  1NB5 A;  4QBB A;  3AI8 A;  3E1Z B;  1PIP A;  1A6R A;  5CVO B;  1PE6 A;  1NPZ A;  2R9M A;  2GHU A;  2FT2 A;  3QSD A;  2B1N A;  3HHA A;  1JQP A;  2NQG A;  1KXR A;  2AUX A;  3O1G A;  1YK8 A;  1CQD A;  4QRG A;  1DF0 A;  2DJG B;  3CBK A;  4I04 A;  1KFX L;  2XU5 A;  3M99 A;  3DF0 A;  1F29 A;  3IV2 A;  4BQV A;  1MDW A;  1FH0 A;  1MS6 A;  4P6G A;  3HHI A;  1SNK A;  2R6N A;  3P5W A;  2P86 A;  1EF7 A;  2G6D A;  3N3G A;  1X9Y A;  1KHQ A;  2CIO A;  1YK7 A;  4PP1 A;  1TLO A;  4CDD B;  4Q8H A;  2PNS A;  2YJC A;  4YYR A;  2XU4 A;  5CHV A;  4YYW A;  3OVZ A;  2E02 A;  2R9C A;  4WA6 A;  2FQ9 A;  4MZO A;  3OF8 A;  1CVZ A;  4NV7 A;  3P5X A;  1YAL A;  1CV8 A;  4MZS A;  4BPV A;  2OP3 A;  1GX3 A;  3IHP A;  4GUZ A;  2YJ9 A;  2HD5 A;  4RY2 A;  5EGW A;  3K24 A;  2AYN A;  4CDE B;  2NQD B;  3HWN A;  4YV8 A;  2HHN A;  2FRA A;  1HUC B;  1BQI A;  1EWM A;  1MHW A;  2H7J A;  1MEG A;  3BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...