4GUZA

Structure of the arylamine n-acetyltransferase from mycobacterium abscessus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
284
Chain Sequence
VPRGSHMWNGDELQLDEYLAFIGFDGDRSPTLETLRRLQRGHVLNIKWENLDAVLHKHVALDIPAVQAKLLRSPRGGYCYEHVALFGAVLQRLGFDFYGIQGRVQMGATTIRPATHGMLVVRLAAEQWLCDVGFGTSPLAPIRLVDEAVVADESWTYRLRRGEVTPGADGWTLSEAAGDGSEPGWLSRHTFVLEPQYPIDYRAASYFVASSPHSPFSTRAFVQQISPDHAYILDHRELHEIQPGVGRKTRQLTPAEVLATLREIFGIELGADDSTLLLERLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable arylamine n-acetyl transferase
publication title Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 86
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4guzA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4guzA01
1W4TA 3LTWA 1GX3A 1W5RA 3D9WA 4NV8A 4GUZA 2BSZA 2VFCA 4C5PA 4BGFA 4NV7A 1E2TA 1W6FA 2VFBA 4B55A
chains in the Genus database with same CATH superfamily
3O2YA 3I0AA 3WJCA 3X00A 1SLGB 5IRWA 1IKEA 1JJUA 3WVMA 5LKFA 2FKJA 3SOTA 1VWMB 5L3YA 1Y9TA 2BS5A 2RTLA 1SXWA 5IXGA 2CBSA 5F58A 1SLDB 1VWHB 2RN4A 4DNEA 1QWDA 4GNWA 4PSQA 4WBKA 3JSQA 4YBUA 3PH6A 3ZUIA 4BQUA 1VWCB 1HBQA 1SRFA 4ZGFA 2G79A 2X46A 1CBRA 2WSJA 5AEOA 1BSYA 4CDEA 4XMEA 1ZNDA 3VHIA 1MOYA 3T1DA 3G7XA 2PI3O 4KC7A 5D47A 3VGWA 1LICA 2AH7X 1LDQA 1DF3A 2Q2MA 3NQKA 2WEXA 3F6ZB 3NADA 4ML7B 4OELA 4U9CA 1UYOX 4UU2A 1SMPI 4DQ4A 4IMOA 1PMPA 1N9YA 1X71A 4U8UM 4YFRA 1T68X 5HZ5A 4JGLA 4CPFA 2K62A 3HWFA 4MEEA 2ACOA 5AQ6A 1SY0A 4GGZA 4WHIA 4GJSA 5LJEA 4U3QA 3CR6A 4QYPA 5L8IA 4QGVA 1KQXA 1ERXA 3P24A 1AVGI 2BHVA 4FBOA 4BCSA 3ZW1B 4CPIA 2FR2A 1I06A 1A57A 1QQSA 1YWDA 4MIRA 1EI5A 1AVDA 2ZSCA 3FW5A 4O4XA 4Y0SA 2VDFA 1SA8A 2PY1A 4Y0RA 2F73A 4MVIA 5D48A 3RDUA 3TGBA 2GC9A 3BX8A 4M7MA 2GTLO 3MVFA 3VG3A 4KH8A 1RSUB 3WXQA 4Z6JA 3UEWA 4OEMA 2P8GA 3O22A 4YVBA 1NGLA 3L4RA 2UZ2A 2RTPB 4NV7A 1VWJB 3DSZA 2JU8A 3APVA 3TGCA 2IJAA 1GKAA 3BDRA 1LNMA 3C76X 3RKGA 2JU3A 2OVDA 1TOWA 1H91A 3P6CA 5F2BA 4BX7A 5KIDA 1AVEA 3Q34A 2G78A 4TNNA 3P6HA 4QRLA 4EFGA 1NDJA 2MM3A 1NP1A 2RTMA 3WYQA 1KL4A 2AT8X 1EUOA 4CSBA 4ORUA 4ZHFA 3TZSA 1HQPA 3C78X 5LJHA 1GT4A 1O1UA 5B11O 1KL5A 3EBWA 1TXLA 2FS7A 2JN3A 1OPBA 2A8GA 4KCAA 1B4MA 2WUTA 2NNDA 1G85A 1I05A 3D95A 2QOSC 1DZPA 2UYWA 4WFUA 3HK1A 3FIQA 4ORXA 4CPEA 2HZRA 1MX8A 2W2FA 1SWTA 3KFHA 3QQ2A 4GDZA 4Y0QA 5HZ6A 2CM9A 1I9HA 2MJIA 3RY2A 3AUMO 3APXA 1CBQA 4XMCA 2HZQA 1BSQA 4ZR2A 3PPTA 4NYQA 3VG4A 3RSWA 4KIIA 2QOMA 2HMBA 2A2UA 2OFAA 1LUQA 1VWRB 3ZW0B 2FR3A 2OY8A 3VHHA 5DG4A 1HMRA 2FHNX 2IZCB 2Q2PA 4HPBA 1VWNB 2WQ9A 3BLGA 5IO6A 3Q6LA 1ZNKA 3RY1A 4CK4A 1SWEA 2WR6A 4GJVA 3HWDA 4ZHGA 3LNBA 2JOZA 2GTFX 4I9SA 3T6LA 3CWKA 1W6FA 4I3CA 4QYNA 3UEUA 3ZZVA 4ZHDA 1OEKA 4IB8A 3EC5A 4UU3A 4YKMA 3UAQA 1JJXA 1D3SA 2MHDA 3RE5A 3STMX 4A60A 1MK5A 2QO4A 2AVIA 2L67A 1Y53X 2X8FA 4IB9A 5LJKA 1EIIA 3RDQA 1SRGA 4YDAA 4CPHB 1XCAA 5HZ8A 1Y55X 4Z2OA 3B2IA 1LFOA 3FEKA 4Y0PA 1W5RA 3B2KA 4GKCA 3PEDA 1VWQB 4EXZA 3GE2A 4YMYA 1OBPA 1IW2A 2CZTA 3D96A 3GAQA 3ZI8A 1Y9LA 3E3CA 3KFGA 4ZH9A 4AYHA 1PBYA 3PQUA 4ORSA 1N4JA 1SXXA 1G74A 2NNEA 1I04A 4GH7A 3T2XA 2FRSA 3FELA 4OKAA 1QY0A 1SWQA 1T0VA 5LJDA 1QY1A 1S2PA 3WZNA 1LCZA 3BU9A 1NBXA 1OEEA 4MVEA 1SY1A 3WJEA 4I95A 2O62A 1SWDA 5B2AO 1JV4A 2RTDB 1EXSA 3C77X 1AQBA 1STRB 1K3BA 4MVLA 4XMHA 1IKJA 2K23A 3KFFA 1T8VA 4GGRA 2LFOA 2AT5X 5CE4A 4NNSA 3UEVA 1SWNA 4A1YA 1QFTA 1ACDA 4IB6A 2Z4IA 2RTFB 3PECA 5B5GA 5B5FA 2QO5A 3BSZE 1RSTB 3FENA 4YDBA 5L8NA 1MUPA 4IABA 2CAMA 3SZJA 1HMSA 1SREA 1I78A 4TJZA 1QFVA 2AT6X 3ZW2A 1CBIA 1AB0A 1JQPA 2ALLX 3FLLA 3LHNA 1GGLA 4QZUA 1X8PA 2RTAA 2HKDA 3FA9A 1LDOA 3NX2A 1WBIA 5KHPA 2FWVA 5EPQA 4NYRA 4XMFA 3FA7A 4U46A 1SXYA 2QCBA 3B2LA 3RDMA 2KTDA 3STNA 3RE6A 3VPJE 1YWBA 4YGHA 1KZWA 4YFPA 2Y3FA 1BM5A 1GT1A 2JGSA 2OVSA 3FR2A 1TVQA 4QAEA 1R0UA 3OE3A 5HA0A 5CSEA 2POAA 5EDCA 3T6FA 5HCCC 4GUZA 3OD9A 1SWUA 2C4IA 2JU7A 3D4RA 3FEPA 4GK9A 3WOVA 1SWRA 2NNQA 3WZQA 4A1HA 5HAEA 1BWYA 4TKHA 1DC9A 1UREA 3BS2A 2R73A 4D6AA 2OY5O 3STKA 1E06A 2IZBA 3OJYC 2RTOB 4M6SA 4GE1A 4WFVA 4O4OA 3ZUOA 2WQAE 3NBXX 1BRPA 4BX6A 5F1EA 1GKAB 2OYBO 3UEXA 3VU1A 1EPAA 1CRBA 1QABE 4HPAA 5BVSA 2FHLA 2RTCB 5D4AA 4BX7B 5FENA 1LPJA 5IO5A 3AKNA 1WUBA 1X8QA 4ORYA 4Y59A 1JYDA 5B29A 1U17A 1IIUA 4OS3A 4KT5A 4HFOA 2C1QA 3PK2A 2L9CA 1SWBA 3MG5A 2DJFA 5B10O 5H9LA 3RDXA 1ZRYA 1ALBA 1DZJA 2BT9A 1OSPO 2XSTA 1JZUA 1Z24A 5LJBA 1PTSA 4R0BA 4GD9A 4YFQA 1PM1X 2ACPX 5B3MO 1EW3A 2BLGA 4BX5B 2LBVA 1STPA 2EU7X 2BS6A 2RTEB 2RTRB 4LKPA 5BVQA 3VE2A 4D6BA 4ODDA 2X56A 1HY2A 3U03A 1MX7A 4ZFXA 2FGSA 2WWPA 3RZYA 1KXOA 3EW1A 5K06A 3FMZA 4HPCA 4IBAA 5BVTA 3U9PC 1JJJA 5H9AA 2M4LA 2DJGA 3BX7A 1OBUA 2X34A 3WJGA 1GXAA 1RXKA 3NQ3A 5FQ8E 1NP4A 1OBQA 1K24A 4I9RA 3BRNA 5F6BA 1MDCA 2CBRA 4ORWA 1SWFA 2ANSA 5HTEA 2RQ0A 1SRHA 1SWCA 1FDQA 1HBPA 2ZAIA 2L68A 4TKJA 2OY7A 2Q9SA 2PFRA 3HWGA 4XMDA 1OPAA 3S60A 3RWXA 4FGIB 1BLRA 2W2BA 3VG7A 4FBRA 1EQDA 5F6ZA 2X32A 3VG6A 3WZPA 4CDCA 4DMOA 2GTLM 3HTYA 2A5BA 4FQBB 4JNJA 4B55A 1KQWA 3LTWA 3AEHA 4ZCBA 1MVGA 1JIWI 1X8UA 2QMIA 4IAWA 3K3LA 2RA6A 1VWIB 1UZ2X 2Q4NA 5B27A 1VPRA 4OMWA 4AZOA 4BBOA 4ES7A 1EPBA 3NQ9A 4ORRA 4U8UN 1SWSA 1GX3A 1RAVA 2R74A 3HOEA 3S26A 1KFFA 5D8JA 3SLJA 4EDEA 2IZFB 4YKOA 1ZNGA 3EYCA 1S7DA 5LJGA 5LJCA 2LB6A 3RDSA 3SZIA 5K68A 1VWBB 3D97A 4O3YA 4ZGUA 3JS1A 1IFBA 2FS6A 4IMNA 3NP1A 1N43A 3B2JA 1IJ8A 3WJFA 4ALBA 4C5PA 3FR4A 4XMGA 3NX1A 1ICNA 1DZMA 1RBPA 4PJ2A 5H8TA 1E5PA 2HNXA 3P6GA 5DPQA 2N93A 2ZAGA 1GT5A 2IZAA 2Y32A 3CKGA 5HBSA 3SLOA 5HZ9A 1SLFB 1SWHA 3S5VA 3CBSA 1A18A 1L6MA 4QGWA 3NPOA 3EMMA 3PDFA 3HOLA 1U18A 1SWJA 2OZQA 3D9WA 1SWOA 2IFBA 2WPUA 3WBGA 3I17A 1QG5A 5FFHA 2VFCA 4COTA 1VWAB 4DCBA 2AF5A 2KW1A 1E2TA 2I5VO 3CQNA 3SAOA 2A3FX 1LF7A 1B8EA 4O3WA 1LCVA 3QKGA 1VYFA 3FW4A 2RTIB 1KT7A 4I6SA 3KQ0A 4MISA 4YBPA 3ELZA 5FQ7E 1DV9A 5L8OA 4MVKA 2X45A 1JYJA 3VG2A 2A2GA 4GU8A 1N0SA 1P6PA 1HN2A 2CZUA 3LV4A 3VE1A 1JMXA 2R56A 2XKLA 2F01A 4O4UA 4QNIA 1KT4A 3ZWEA 4N7DA 4CPHA 3ZW1A 3MM0A 3AKMA 1SRJA 4EQAC 2LBAA 1QY2A 2OFBA 4TLJA 3BU1A 3OBLA 4O4SA 4YCEA 5HWZA 4K19A 2OVAA 4HPDA 1LIEA 1BBPA 1ZNEA 4NW4A 1LCWA 3MX7A 2AT0X 2Z4HA 4A8ZA 1YP6A 2RCQA 4I60A 4BX6B 3FA6A 4Y5DA 1HXZA 4BVMA 4LZUA 1KT3A 2OFMX 1VWEB 2OL7A 1CBSA 1VWLB 2G8CO 2G5LA 2CM4A 2C1SA 2RTJA 3U0DA 1PEEA 2GTLN 2YG2A 3APWA 1B0OA 1YIVA 2QO6A 4JHQA 4RUUA 4O3XB 3TF6A 4Z28A 1KT6A 2OL8O 1N7YA 1STSB 2RTKA 3BY0A 1VWOB 3HWEA 4AZRA 4IAXA 3FR5A 4HWMA 4QZTA 2GJ5A 1KL3A 3S5XA 1BRQA 5LKEA 5EZ2A 4L1NA 5EEEA 1RXJA 4N7CA 5HCDC 4DQ3A 3EM0A 2G7BA 3HPEA 1VWFB 2FT9A 4CV7A 1E02A 3EW2A 2MO5A 1XKIA 4ALOA 4ZHHA 2BSZA 4EEJA 2X55A 4L3RA 2RD7C 2E4JA 2WEWA 1DZKA 1S44A 2GH7A 3MBTA 3P02A 4AZMA 1A3YA 2OVEA 4GRJA 4QQ1A 1SWGA 3TGAA 3ZQ3A 1VWDB 4OS0A 4AZQA 1MEPA 1RLBE 2AT3X 4GDAA 4ARHA 1SWKA 2IZIA 3FA8A 3PQSA 4GETA 2OF8A 4O49A 2IZGB 2IZKA 1EALA 4Z2VA 2RTGB 2ASNX 3O19A 1I4UA 2X8TA 1NQNA 5HZQA 1ADLA 3PH5A 1VYGA 4LQZA 2W2AA 4INNA 1SY2A 1U0XA 1KT5A 2AKQA 4O3ZA 1B56A 5AJCA 1SLEB 3CQRA 1ERBA 1SWLA 1SY3A 1YWCA 1TOUA 2HYSA 1YUPA 2PQTA 5JD2A 2IZEB 3EBKA 5CHKA 4Z2PA 1AELA 3V8UA 1FTPA 2Y3EA 1YWAA 3WYPA 1BSOA 4YGZA 1SWPA 4QGXA 1LELA 2F09A 4LKTA 3WZOA 4TQ2A 5D45A 1HXLA 3N91A 3FYFA 4FBVA 3SZHA 2BC3A 1ZNHA 1N9MA 2A13A 1Y52X 2FLJA 2LA7A 1IFCA 4IRWA 4NLJA 5FAZA 1LKEA 2OFRX 3H3IA 1DF8A 2Q39A 1E00A 2VFBA 4KC8A 3WJBA 4YCHA 1VYOA 2RTBB 5H9NA 1JBHA 2HLVA 1LIDA 2IZHB 2RCTA 1VWGB 1VWPB 5F7GA 1MM9A 2IZDB 4OS8A 1UYNX 3ELXA 3P6FA 2IZJA 4O9SA 4YH0A 1GM6A 4GZVA 3VG5A 4AW8A 3CBCA 4BX5A 4ZHCA 2X8SA 5K67A 4GGTA 1GX9A 3IA8A 4ZH6A 2JMBA 1D2UA 2I5ZO 2DM5A 4NP1A 1RXHA 5IRUA 2MWHA 1W4TA 4RUNA 5IO7A 2LKKA 2A0AA 1SXUA 3F9DA 2KT4B 1ZNLA 2NP1A 1OEJA 1BJ7A 2RTHB 3KFIA 5CYBA 4BJ8A 2RTNB 4EKVA 3PP6A 1LIBA 2IZLB 4AZNA 1JMZA 3FIDA 1X8NA 4ON1A 3WJDA 2JW1A 1KOIA 2L5PA 2AMMX 1YP7A 5EDBA 1GX8A 1O1VA 1A2DA 5H9KA 4ZJ0A 4GNYA 1LIFA 5AJBA 3ZW0A 4LZVA 4TKBA 4Z27A 3SLTA 5IRAA 2OL6O 2YMSA 2A5CA 3RDOA 2AL0X 5HTDA 1G5WA 2MF6A 1NQMA 3CKFA 4OMXA 1TW4A 4NV8A 2RTQB 1KGLA 2FKGA 1GT3A 3P6DA 4BOEA 1Y0GA 3P6EA 4CDFA 3KZAA 5KICA 1G7NA 1X8OA 2FTBA 1KZXA 4YGGA 1PBOA 1ML7A 2KD2A 2QM9A 4JO6A 1DFVA 1O8VA 2OY1O 4U8UO 1SRIA 3VHMA 5BYPA 4CDDA 1FELA 3FDCA 1VWKB 5C0NA 3IFBA 5HA1A 3RBYA 1FE3A 4I3DA 2KTSA 3B2HA 3JQOA 3KVNA 1CJ5A 5FQ6E 4AZPA 1ICMA 1FJ1E 2X4MA 3T2WA 1NC9A 1SWAA 5JR8A 5HCEC 1BEBA 1HMTA 2OF9A 3APUA 5EEDA 4IB7A 4NLIA 4NNTA 1X89A 4I3BA 3F8AA 3CMPA 4BGFA 3NR3A 3DTQA 4ID2A 1HQQA 1EIOA 1FEMA 1FENA
chains in the Genus database with same CATH topology
1AIMA 1GECE 4X6IA 2E01A 3HWNA 3USVA 4QH6A 1GCBA 2GFOA 4MZOA 4WA6A 4KLBA 2HXZA 3BPFA 3KWBX 3S3QA 1KHPA 1MS6A 1M6DA 4PP1A 4XUIA 2AUZA 4YYSA 1EWMA 4OELA 3PBHA 2JQFR 2FO5A 1VSNA 2AYNA 3C9EA 3PNRA 5J94A 3RVXA 1AYVA 1X9YA 1BP4A 4OEMA 3IUTA 2G7YA 2F7DA 3IHPA 4NV7A 1GLOA 2OULA 3MHSA 1EWOA 1F2AA 3HHAA 3IV2A 1PPPA 1A6RA 1F2BA 2Y5BA 2AYOA 1STFE 3RVWA 1XKGA 2FRAA 2DZYA 4FK5A 3BWKA 1Y08A 3V6CA 4G54A 1TLOA 3D6SA 1MDWA 2P86A 3H6SA 3K8UA 4QRGA 4FIPA 1DEUA 1AECA 2FTDA 4PP2E 3IOQA 2ARYA 4HWYA 3O1GA 3WXEA 1CB5A 1YT7A 3KW9A 1W6FA 4CDDB 1YALA 2R6NA 3P5WA 1BY8A 2B1MA 3E1ZB 1ZIVA 1KFXL 1VJVA 2P7UA 1YK8A 3BCNA 1U9WA 4I05A 4MZSA 1W5RA 2YJ8A 2AU1A 2HD5A 3P5VA 1NLJA 1TL9A 5EGWA 2BDZA 2BDLA 1CVZA 1U9VA 2OZ2A 3BPMA 2HHNA 3U8EA 4QRVA 2NQAA 3BC3A 1BQIA 1PIPA 4YYUA 1MIRA 1SNKA 2O6XA 4P6GA 2NQDB 2G8JA 1PXVA 2E00A 1JQPA 1BGOA 3GCBA 3OVXA 1O0EA 2R9OA 5EF4A 2XU4A 2PBHA 4AXLA 3KFQA 2FYEA 3BOWA 3KX1A 9PAPA 3HHIA 4GUZA 3OISA 3CBKA 2ATOA 3F75A 3B79A 5CVNB 1QOLA 3ERVA 3LXSA 3NHEA 1MEMA 3LFYA 2AS8A 2DCAA 1PBHA 1ITOA 5FPWA 2NQGA 1U9QX 1CTEA 2FT2A 1ATKA 3P5UA 3CBJA 4YYVA 1HUCB 3IMAA 5CHVA 4BPVA 4BSQA 4DMXA 3N4CA 5JA7A 2GHUA 1ME3A 1QXPA 1NPZA 3MORA 3OF9A 1EWPA 1POPA 6PADA 4BS5A 4N8WA 2H7JA 5JH3A 1YK7A 4I07A 4YV8A 1QMYA 1F2CA 4W5BA 4RY2A 1NQCA 2DC9A 1CPJA 2G6DA 4W5CA 1AU2A 2XU5A 1AU0A 1ICFA 4YYWA 5CHTA 2DC8A 4CDFB 4B55A 2PREA 3LTWA 1MEGA 1CQDA 1PCIA 3RVVA 1KFUL 2XU3A 1GX3A 3KWZA 2C0YA 3O0UA 3HD3A 2P0RA 2YJBA 2ACTA 3H8BA 3OVZA 4C5PA 2OP3A 4CZWA 2DCDA 3MTNA 7PCKA 5K16A 3K9MA 3PW3A 1DF0A 1K3BB 1KXRA 1AU3A 3N3GA 3PDFA 4AXMA 1QDQA 1TU6A 3D9WA 5F02A 2VHSA 3F5VA 2VFCA 1E2TA 3WXGA 1F29A 4FJCA 4CDEB 3I3TA 4BQVA 2JQGR 2AUXA 2IPPB 2FQ9A 2XU1A 2DZZA 2PADA 1NL6A 3QJ3A 3CH2X 3OF8A 1PPOA 4X6JA 2DC7A 1AYWA 3MHHA 2R9CA 1CSBB 2E02A 1AYUA 2DJFB 3H8CA 1Y4HA 3WXFA 1IWDA 3CH3X 2F1GA 2BSZA 2AVWA 3ZUAA 4QBBA 1ZCMA 1PPNA 4Q8GA 4YYQA 2DJGB 2AIMA 3M99A 1Q6KA 2CB5A 4K7CA 4PADA 1NB3A 1NB5A 2FUDA 3QSDA 4Q8HA 1YVBA 2YJ9A 4YVAA 4DMYA 3H89A 4CDCB 2IBIA 2CIOA 3TNXA 1AU4A 2E03A 1GMYA 1PADA 1CJLA 4MSXA 4N79A 3QT4A 1PE6A 1EWLA 5CVMA 2VFBA 2Y6EA 1KHQA 2B1NA 8PCHA 2R9NA 5CVOB 2DC6A 2R9MA 4N4ZA 2YJ2A 1W4TA 2YJCA 1S4VA 1ME4A 3K24A 2FRQA 4YYRA 4PI3A 3H7DA 2DCCA 2VHFA 1FH0A 3KSEA 3IEJA 2WBFX 2R9FA 3DF0A 4X6HA 1U9XA 4W4UA 1CV8A 4NV8A 4ZUXU 1PPDA 4P6EA 3AI8A 3I06A 2HH5A 3P5XA 2DCBA 1THEA 1MHWA 4BS6A 4QRXA 1SP4B 3V6EA 2PNSA 2G8EA 1CS8A 3N3KA 3KKUA 1U5IA 2NQIA 1EF7A 5PADA 4BGFA 4XR7A 5A24A 3S3RA 4I04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  3LTW A;  1GX3 A;  1W5R A;  3D9W A;  4NV8 A;  4GUZ A;  2BSZ A;  2VFC A;  4C5P A;  4BGF A;  4NV7 A;  1E2T A;  1W6F A;  2VFB A;  4B55 A; 
#chains in the Genus database with same CATH topology
 3O2Y A;  3I0A A;  3WJC A;  3X00 A;  1SLG B;  5IRW A;  1IKE A;  1JJU A;  3WVM A;  5LKF A;  2FKJ A;  3SOT A;  1VWM B;  5L3Y A;  1Y9T A;  2BS5 A;  2RTL A;  1SXW A;  5IXG A;  2CBS A;  5F58 A;  1SLD B;  1VWH B;  2RN4 A;  4DNE A;  1QWD A;  4GNW A;  4PSQ A;  4WBK A;  3JSQ A;  4YBU A;  3PH6 A;  3ZUI A;  4BQU A;  1VWC B;  1HBQ A;  1SRF A;  4ZGF A;  2G79 A;  2X46 A;  1CBR A;  2WSJ A;  5AEO A;  1BSY A;  4CDE A;  4XME A;  1ZND A;  3VHI A;  1MOY A;  3T1D A;  3G7X A;  2PI3 O;  4KC7 A;  5D47 A;  3VGW A;  1LIC A;  2AH7 X;  1LDQ A;  1DF3 A;  2Q2M A;  3NQK A;  2WEX A;  3F6Z B;  3NAD A;  4ML7 B;  4OEL A;  4U9C A;  1UYO X;  4UU2 A;  1SMP I;  4DQ4 A;  4IMO A;  1PMP A;  1N9Y A;  1X71 A;  4U8U M;  4YFR A;  1T68 X;  5HZ5 A;  4JGL A;  4CPF A;  2K62 A;  3HWF A;  4MEE A;  2ACO A;  5AQ6 A;  1SY0 A;  4GGZ A;  4WHI A;  4GJS A;  5LJE A;  4U3Q A;  3CR6 A;  4QYP A;  5L8I A;  4QGV A;  1KQX A;  1ERX A;  3P24 A;  1AVG I;  2BHV A;  4FBO A;  4BCS A;  3ZW1 B;  4CPI A;  2FR2 A;  1I06 A;  1A57 A;  1QQS A;  1YWD A;  4MIR A;  1EI5 A;  1AVD A;  2ZSC A;  3FW5 A;  4O4X A;  4Y0S A;  2VDF A;  1SA8 A;  2PY1 A;  4Y0R A;  2F73 A;  4MVI A;  5D48 A;  3RDU A;  3TGB A;  2GC9 A;  3BX8 A;  4M7M A;  2GTL O;  3MVF A;  3VG3 A;  4KH8 A;  1RSU B;  3WXQ A;  4Z6J A;  3UEW A;  4OEM A;  2P8G A;  3O22 A;  4YVB A;  1NGL A;  3L4R A;  2UZ2 A;  2RTP B;  4NV7 A;  1VWJ B;  3DSZ A;  2JU8 A;  3APV A;  3TGC A;  2IJA A;  1GKA A;  3BDR A;  1LNM A;  3C76 X;  3RKG A;  2JU3 A;  2OVD A;  1TOW A;  1H91 A;  3P6C A;  5F2B A;  4BX7 A;  5KID A;  1AVE A;  3Q34 A;  2G78 A;  4TNN A;  3P6H A;  4QRL A;  4EFG A;  1NDJ A;  2MM3 A;  1NP1 A;  2RTM A;  3WYQ A;  1KL4 A;  2AT8 X;  1EUO A;  4CSB A;  4ORU A;  4ZHF A;  3TZS A;  1HQP A;  3C78 X;  5LJH A;  1GT4 A;  1O1U A;  5B11 O;  1KL5 A;  3EBW A;  1TXL A;  2FS7 A;  2JN3 A;  1OPB A;  2A8G A;  4KCA A;  1B4M A;  2WUT A;  2NND A;  1G85 A;  1I05 A;  3D95 A;  2QOS C;  1DZP A;  2UYW A;  4WFU A;  3HK1 A;  3FIQ A;  4ORX A;  4CPE A;  2HZR A;  1MX8 A;  2W2F A;  1SWT A;  3KFH A;  3QQ2 A;  4GDZ A;  4Y0Q A;  5HZ6 A;  2CM9 A;  1I9H A;  2MJI A;  3RY2 A;  3AUM O;  3APX A;  1CBQ A;  4XMC A;  2HZQ A;  1BSQ A;  4ZR2 A;  3PPT A;  4NYQ A;  3VG4 A;  3RSW A;  4KII A;  2QOM A;  2HMB A;  2A2U A;  2OFA A;  1LUQ A;  1VWR B;  3ZW0 B;  2FR3 A;  2OY8 A;  3VHH A;  5DG4 A;  1HMR A;  2FHN X;  2IZC B;  2Q2P A;  4HPB A;  1VWN B;  2WQ9 A;  3BLG A;  5IO6 A;  3Q6L A;  1ZNK A;  3RY1 A;  4CK4 A;  1SWE A;  2WR6 A;  4GJV A;  3HWD A;  4ZHG A;  3LNB A;  2JOZ A;  2GTF X;  4I9S A;  3T6L A;  3CWK A;  1W6F A;  4I3C A;  4QYN A;  3UEU A;  3ZZV A;  4ZHD A;  1OEK A;  4IB8 A;  3EC5 A;  4UU3 A;  4YKM A;  3UAQ A;  1JJX A;  1D3S A;  2MHD A;  3RE5 A;  3STM X;  4A60 A;  1MK5 A;  2QO4 A;  2AVI A;  2L67 A;  1Y53 X;  2X8F A;  4IB9 A;  5LJK A;  1EII A;  3RDQ A;  1SRG A;  4YDA A;  4CPH B;  1XCA A;  5HZ8 A;  1Y55 X;  4Z2O A;  3B2I A;  1LFO A;  3FEK A;  4Y0P A;  1W5R A;  3B2K A;  4GKC A;  3PED A;  1VWQ B;  4EXZ A;  3GE2 A;  4YMY A;  1OBP A;  1IW2 A;  2CZT A;  3D96 A;  3GAQ A;  3ZI8 A;  1Y9L A;  3E3C A;  3KFG A;  4ZH9 A;  4AYH A;  1PBY A;  3PQU A;  4ORS A;  1N4J A;  1SXX A;  1G74 A;  2NNE A;  1I04 A;  4GH7 A;  3T2X A;  2FRS A;  3FEL A;  4OKA A;  1QY0 A;  1SWQ A;  1T0V A;  5LJD A;  1QY1 A;  1S2P A;  3WZN A;  1LCZ A;  3BU9 A;  1NBX A;  1OEE A;  4MVE A;  1SY1 A;  3WJE A;  4I95 A;  2O62 A;  1SWD A;  5B2A O;  1JV4 A;  2RTD B;  1EXS A;  3C77 X;  1AQB A;  1STR B;  1K3B A;  4MVL A;  4XMH A;  1IKJ A;  2K23 A;  3KFF A;  1T8V A;  4GGR A;  2LFO A;  2AT5 X;  5CE4 A;  4NNS A;  3UEV A;  1SWN A;  4A1Y A;  1QFT A;  1ACD A;  4IB6 A;  2Z4I A;  2RTF B;  3PEC A;  5B5G A;  5B5F A;  2QO5 A;  3BSZ E;  1RST B;  3FEN A;  4YDB A;  5L8N A;  1MUP A;  4IAB A;  2CAM A;  3SZJ A;  1HMS A;  1SRE A;  1I78 A;  4TJZ A;  1QFV A;  2AT6 X;  3ZW2 A;  1CBI A;  1AB0 A;  1JQP A;  2ALL X;  3FLL A;  3LHN A;  1GGL A;  4QZU A;  1X8P A;  2RTA A;  2HKD A;  3FA9 A;  1LDO A;  3NX2 A;  1WBI A;  5KHP A;  2FWV A;  5EPQ A;  4NYR A;  4XMF A;  3FA7 A;  4U46 A;  1SXY A;  2QCB A;  3B2L A;  3RDM A;  2KTD A;  3STN A;  3RE6 A;  3VPJ E;  1YWB A;  4YGH A;  1KZW A;  4YFP A;  2Y3F A;  1BM5 A;  1GT1 A;  2JGS A;  2OVS A;  3FR2 A;  1TVQ A;  4QAE A;  1R0U A;  3OE3 A;  5HA0 A;  5CSE A;  2POA A;  5EDC A;  3T6F A;  5HCC C;  4GUZ A;  3OD9 A;  1SWU A;  2C4I A;  2JU7 A;  3D4R A;  3FEP A;  4GK9 A;  3WOV A;  1SWR A;  2NNQ A;  3WZQ A;  4A1H A;  5HAE A;  1BWY A;  4TKH A;  1DC9 A;  1URE A;  3BS2 A;  2R73 A;  4D6A A;  2OY5 O;  3STK A;  1E06 A;  2IZB A;  3OJY C;  2RTO B;  4M6S A;  4GE1 A;  4WFV A;  4O4O A;  3ZUO A;  2WQA E;  3NBX X;  1BRP A;  4BX6 A;  5F1E A;  1GKA B;  2OYB O;  3UEX A;  3VU1 A;  1EPA A;  1CRB A;  1QAB E;  4HPA A;  5BVS A;  2FHL A;  2RTC B;  5D4A A;  4BX7 B;  5FEN A;  1LPJ A;  5IO5 A;  3AKN A;  1WUB A;  1X8Q A;  4ORY A;  4Y59 A;  1JYD A;  5B29 A;  1U17 A;  1IIU A;  4OS3 A;  4KT5 A;  4HFO A;  2C1Q A;  3PK2 A;  2L9C A;  1SWB A;  3MG5 A;  2DJF A;  5B10 O;  5H9L A;  3RDX A;  1ZRY A;  1ALB A;  1DZJ A;  2BT9 A;  1OSP O;  2XST A;  1JZU A;  1Z24 A;  5LJB A;  1PTS A;  4R0B A;  4GD9 A;  4YFQ A;  1PM1 X;  2ACP X;  5B3M O;  1EW3 A;  2BLG A;  4BX5 B;  2LBV A;  1STP A;  2EU7 X;  2BS6 A;  2RTE B;  2RTR B;  4LKP A;  5BVQ A;  3VE2 A;  4D6B A;  4ODD A;  2X56 A;  1HY2 A;  3U03 A;  1MX7 A;  4ZFX A;  2FGS A;  2WWP A;  3RZY A;  1KXO A;  3EW1 A;  5K06 A;  3FMZ A;  4HPC A;  4IBA A;  5BVT A;  3U9P C;  1JJJ A;  5H9A A;  2M4L A;  2DJG A;  3BX7 A;  1OBU A;  2X34 A;  3WJG A;  1GXA A;  1RXK A;  3NQ3 A;  5FQ8 E;  1NP4 A;  1OBQ A;  1K24 A;  4I9R A;  3BRN A;  5F6B A;  1MDC A;  2CBR A;  4ORW A;  1SWF A;  2ANS A;  5HTE A;  2RQ0 A;  1SRH A;  1SWC A;  1FDQ A;  1HBP A;  2ZAI A;  2L68 A;  4TKJ A;  2OY7 A;  2Q9S A;  2PFR A;  3HWG A;  4XMD A;  1OPA A;  3S60 A;  3RWX A;  4FGI B;  1BLR A;  2W2B A;  3VG7 A;  4FBR A;  1EQD A;  5F6Z A;  2X32 A;  3VG6 A;  3WZP A;  4CDC A;  4DMO A;  2GTL M;  3HTY A;  2A5B A;  4FQB B;  4JNJ A;  4B55 A;  1KQW A;  3LTW A;  3AEH A;  4ZCB A;  1MVG A;  1JIW I;  1X8U A;  2QMI A;  4IAW A;  3K3L A;  2RA6 A;  1VWI B;  1UZ2 X;  2Q4N A;  5B27 A;  1VPR A;  4OMW A;  4AZO A;  4BBO A;  4ES7 A;  1EPB A;  3NQ9 A;  4ORR A;  4U8U N;  1SWS A;  1GX3 A;  1RAV A;  2R74 A;  3HOE A;  3S26 A;  1KFF A;  5D8J A;  3SLJ A;  4EDE A;  2IZF B;  4YKO A;  1ZNG A;  3EYC A;  1S7D A;  5LJG A;  5LJC A;  2LB6 A;  3RDS A;  3SZI A;  5K68 A;  1VWB B;  3D97 A;  4O3Y A;  4ZGU A;  3JS1 A;  1IFB A;  2FS6 A;  4IMN A;  3NP1 A;  1N43 A;  3B2J A;  1IJ8 A;  3WJF A;  4ALB A;  4C5P A;  3FR4 A;  4XMG A;  3NX1 A;  1ICN A;  1DZM A;  1RBP A;  4PJ2 A;  5H8T A;  1E5P A;  2HNX A;  3P6G A;  5DPQ A;  2N93 A;  2ZAG A;  1GT5 A;  2IZA A;  2Y32 A;  3CKG A;  5HBS A;  3SLO A;  5HZ9 A;  1SLF B;  1SWH A;  3S5V A;  3CBS A;  1A18 A;  1L6M A;  4QGW A;  3NPO A;  3EMM A;  3PDF A;  3HOL A;  1U18 A;  1SWJ A;  2OZQ A;  3D9W A;  1SWO A;  2IFB A;  2WPU A;  3WBG A;  3I17 A;  1QG5 A;  5FFH A;  2VFC A;  4COT A;  1VWA B;  4DCB A;  2AF5 A;  2KW1 A;  1E2T A;  2I5V O;  3CQN A;  3SAO A;  2A3F X;  1LF7 A;  1B8E A;  4O3W A;  1LCV A;  3QKG A;  1VYF A;  3FW4 A;  2RTI B;  1KT7 A;  4I6S A;  3KQ0 A;  4MIS A;  4YBP A;  3ELZ A;  5FQ7 E;  1DV9 A;  5L8O A;  4MVK A;  2X45 A;  1JYJ A;  3VG2 A;  2A2G A;  4GU8 A;  1N0S A;  1P6P A;  1HN2 A;  2CZU A;  3LV4 A;  3VE1 A;  1JMX A;  2R56 A;  2XKL A;  2F01 A;  4O4U A;  4QNI A;  1KT4 A;  3ZWE A;  4N7D A;  4CPH A;  3ZW1 A;  3MM0 A;  3AKM A;  1SRJ A;  4EQA C;  2LBA A;  1QY2 A;  2OFB A;  4TLJ A;  3BU1 A;  3OBL A;  4O4S A;  4YCE A;  5HWZ A;  4K19 A;  2OVA A;  4HPD A;  1LIE A;  1BBP A;  1ZNE A;  4NW4 A;  1LCW A;  3MX7 A;  2AT0 X;  2Z4H A;  4A8Z A;  1YP6 A;  2RCQ A;  4I60 A;  4BX6 B;  3FA6 A;  4Y5D A;  1HXZ A;  4BVM A;  4LZU A;  1KT3 A;  2OFM X;  1VWE B;  2OL7 A;  1CBS A;  1VWL B;  2G8C O;  2G5L A;  2CM4 A;  2C1S A;  2RTJ A;  3U0D A;  1PEE A;  2GTL N;  2YG2 A;  3APW A;  1B0O A;  1YIV A;  2QO6 A;  4JHQ A;  4RUU A;  4O3X B;  3TF6 A;  4Z28 A;  1KT6 A;  2OL8 O;  1N7Y A;  1STS B;  2RTK A;  3BY0 A;  1VWO B;  3HWE A;  4AZR A;  4IAX A;  3FR5 A;  4HWM A;  4QZT A;  2GJ5 A;  1KL3 A;  3S5X A;  1BRQ A;  5LKE A;  5EZ2 A;  4L1N A;  5EEE A;  1RXJ A;  4N7C A;  5HCD C;  4DQ3 A;  3EM0 A;  2G7B A;  3HPE A;  1VWF B;  2FT9 A;  4CV7 A;  1E02 A;  3EW2 A;  2MO5 A;  1XKI A;  4ALO A;  4ZHH A;  2BSZ A;  4EEJ A;  2X55 A;  4L3R A;  2RD7 C;  2E4J A;  2WEW A;  1DZK A;  1S44 A;  2GH7 A;  3MBT A;  3P02 A;  4AZM A;  1A3Y A;  2OVE A;  4GRJ A;  4QQ1 A;  1SWG A;  3TGA A;  3ZQ3 A;  1VWD B;  4OS0 A;  4AZQ A;  1MEP A;  1RLB E;  2AT3 X;  4GDA A;  4ARH A;  1SWK A;  2IZI A;  3FA8 A;  3PQS A;  4GET A;  2OF8 A;  4O49 A;  2IZG B;  2IZK A;  1EAL A;  4Z2V A;  2RTG B;  2ASN X;  3O19 A;  1I4U A;  2X8T A;  1NQN A;  5HZQ A;  1ADL A;  3PH5 A;  1VYG A;  4LQZ A;  2W2A A;  4INN A;  1SY2 A;  1U0X A;  1KT5 A;  2AKQ A;  4O3Z A;  1B56 A;  5AJC A;  1SLE B;  3CQR A;  1ERB A;  1SWL A;  1SY3 A;  1YWC A;  1TOU A;  2HYS A;  1YUP A;  2PQT A;  5JD2 A;  2IZE B;  3EBK A;  5CHK A;  4Z2P A;  1AEL A;  3V8U A;  1FTP A;  2Y3E A;  1YWA A;  3WYP A;  1BSO A;  4YGZ A;  1SWP A;  4QGX A;  1LEL A;  2F09 A;  4LKT A;  3WZO A;  4TQ2 A;  5D45 A;  1HXL A;  3N91 A;  3FYF A;  4FBV A;  3SZH A;  2BC3 A;  1ZNH A;  1N9M A;  2A13 A;  1Y52 X;  2FLJ A;  2LA7 A;  1IFC A;  4IRW A;  4NLJ A;  5FAZ A;  1LKE A;  2OFR X;  3H3I A;  1DF8 A;  2Q39 A;  1E00 A;  2VFB A;  4KC8 A;  3WJB A;  4YCH A;  1VYO A;  2RTB B;  5H9N A;  1JBH A;  2HLV A;  1LID A;  2IZH B;  2RCT A;  1VWG B;  1VWP B;  5F7G A;  1MM9 A;  2IZD B;  4OS8 A;  1UYN X;  3ELX A;  3P6F A;  2IZJ A;  4O9S A;  4YH0 A;  1GM6 A;  4GZV A;  3VG5 A;  4AW8 A;  3CBC A;  4BX5 A;  4ZHC A;  2X8S A;  5K67 A;  4GGT A;  1GX9 A;  3IA8 A;  4ZH6 A;  2JMB A;  1D2U A;  2I5Z O;  2DM5 A;  4NP1 A;  1RXH A;  5IRU A;  2MWH A;  1W4T A;  4RUN A;  5IO7 A;  2LKK A;  2A0A A;  1SXU A;  3F9D A;  2KT4 B;  1ZNL A;  2NP1 A;  1OEJ A;  1BJ7 A;  2RTH B;  3KFI A;  5CYB A;  4BJ8 A;  2RTN B;  4EKV A;  3PP6 A;  1LIB A;  2IZL B;  4AZN A;  1JMZ A;  3FID A;  1X8N A;  4ON1 A;  3WJD A;  2JW1 A;  1KOI A;  2L5P A;  2AMM X;  1YP7 A;  5EDB A;  1GX8 A;  1O1V A;  1A2D A;  5H9K A;  4ZJ0 A;  4GNY A;  1LIF A;  5AJB A;  3ZW0 A;  4LZV A;  4TKB A;  4Z27 A;  3SLT A;  5IRA A;  2OL6 O;  2YMS A;  2A5C A;  3RDO A;  2AL0 X;  5HTD A;  1G5W A;  2MF6 A;  1NQM A;  3CKF A;  4OMX A;  1TW4 A;  4NV8 A;  2RTQ B;  1KGL A;  2FKG A;  1GT3 A;  3P6D A;  4BOE A;  1Y0G A;  3P6E A;  4CDF A;  3KZA A;  5KIC A;  1G7N A;  1X8O A;  2FTB A;  1KZX A;  4YGG A;  1PBO A;  1ML7 A;  2KD2 A;  2QM9 A;  4JO6 A;  1DFV A;  1O8V A;  2OY1 O;  4U8U O;  1SRI A;  3VHM A;  5BYP A;  4CDD A;  1FEL A;  3FDC A;  1VWK B;  5C0N A;  3IFB A;  5HA1 A;  3RBY A;  1FE3 A;  4I3D A;  2KTS A;  3B2H A;  3JQO A;  3KVN A;  1CJ5 A;  5FQ6 E;  4AZP A;  1ICM A;  1FJ1 E;  2X4M A;  3T2W A;  1NC9 A;  1SWA A;  5JR8 A;  5HCE C;  1BEB A;  1HMT A;  2OF9 A;  3APU A;  5EED A;  4IB7 A;  4NLI A;  4NNT A;  1X89 A;  4I3B A;  3F8A A;  3CMP A;  4BGF A;  3NR3 A;  3DTQ A;  4ID2 A;  1HQQ A;  1EIO A;  1FEM A;  1FEN A; 
#chains in the Genus database with same CATH homology
 1AIM A;  1GEC E;  4X6I A;  2E01 A;  3HWN A;  3USV A;  4QH6 A;  1GCB A;  2GFO A;  4MZO A;  4WA6 A;  4KLB A;  2HXZ A;  3BPF A;  3KWB X;  3S3Q A;  1KHP A;  1MS6 A;  1M6D A;  4PP1 A;  4XUI A;  2AUZ A;  4YYS A;  1EWM A;  4OEL A;  3PBH A;  2JQF R;  2FO5 A;  1VSN A;  2AYN A;  3C9E A;  3PNR A;  5J94 A;  3RVX A;  1AYV A;  1X9Y A;  1BP4 A;  4OEM A;  3IUT A;  2G7Y A;  2F7D A;  3IHP A;  4NV7 A;  1GLO A;  2OUL A;  3MHS A;  1EWO A;  1F2A A;  3HHA A;  3IV2 A;  1PPP A;  1A6R A;  1F2B A;  2Y5B A;  2AYO A;  1STF E;  3RVW A;  1XKG A;  2FRA A;  2DZY A;  4FK5 A;  3BWK A;  1Y08 A;  3V6C A;  4G54 A;  1TLO A;  3D6S A;  1MDW A;  2P86 A;  3H6S A;  3K8U A;  4QRG A;  4FIP A;  1DEU A;  1AEC A;  2FTD A;  4PP2 E;  3IOQ A;  2ARY A;  4HWY A;  3O1G A;  3WXE A;  1CB5 A;  1YT7 A;  3KW9 A;  1W6F A;  4CDD B;  1YAL A;  2R6N A;  3P5W A;  1BY8 A;  2B1M A;  3E1Z B;  1ZIV A;  1KFX L;  1VJV A;  2P7U A;  1YK8 A;  3BCN A;  1U9W A;  4I05 A;  4MZS A;  1W5R A;  2YJ8 A;  2AU1 A;  2HD5 A;  3P5V A;  1NLJ A;  1TL9 A;  5EGW A;  2BDZ A;  2BDL A;  1CVZ A;  1U9V A;  2OZ2 A;  3BPM A;  2HHN A;  3U8E A;  4QRV A;  2NQA A;  3BC3 A;  1BQI A;  1PIP A;  4YYU A;  1MIR A;  1SNK A;  2O6X A;  4P6G A;  2NQD B;  2G8J A;  1PXV A;  2E00 A;  1JQP A;  1BGO A;  3GCB A;  3OVX A;  1O0E A;  2R9O A;  5EF4 A;  2XU4 A;  2PBH A;  4AXL A;  3KFQ A;  2FYE A;  3BOW A;  3KX1 A;  9PAP A;  3HHI A;  4GUZ A;  3OIS A;  3CBK A;  2ATO A;  3F75 A;  3B79 A;  5CVN B;  1QOL A;  3ERV A;  3LXS A;  3NHE A;  1MEM A;  3LFY A;  2AS8 A;  2DCA A;  1PBH A;  1ITO A;  5FPW A;  2NQG A;  1U9Q X;  1CTE A;  2FT2 A;  1ATK A;  3P5U A;  3CBJ A;  4YYV A;  1HUC B;  3IMA A;  5CHV A;  4BPV A;  4BSQ A;  4DMX A;  3N4C A;  5JA7 A;  2GHU A;  1ME3 A;  1QXP A;  1NPZ A;  3MOR A;  3OF9 A;  1EWP A;  1POP A;  6PAD A;  4BS5 A;  4N8W A;  2H7J A;  5JH3 A;  1YK7 A;  4I07 A;  4YV8 A;  1QMY A;  1F2C A;  4W5B A;  4RY2 A;  1NQC A;  2DC9 A;  1CPJ A;  2G6D A;  4W5C A;  1AU2 A;  2XU5 A;  1AU0 A;  1ICF A;  4YYW A;  5CHT A;  2DC8 A;  4CDF B;  4B55 A;  2PRE A;  3LTW A;  1MEG A;  1CQD A;  1PCI A;  3RVV A;  1KFU L;  2XU3 A;  1GX3 A;  3KWZ A;  2C0Y A;  3O0U A;  3HD3 A;  2P0R A;  2YJB A;  2ACT A;  3H8B A;  3OVZ A;  4C5P A;  2OP3 A;  4CZW A;  2DCD A;  3MTN A;  7PCK A;  5K16 A;  3K9M A;  3PW3 A;  1DF0 A;  1K3B B;  1KXR A;  1AU3 A;  3N3G A;  3PDF A;  4AXM A;  1QDQ A;  1TU6 A;  3D9W A;  5F02 A;  2VHS A;  3F5V A;  2VFC A;  1E2T A;  3WXG A;  1F29 A;  4FJC A;  4CDE B;  3I3T A;  4BQV A;  2JQG R;  2AUX A;  2IPP B;  2FQ9 A;  2XU1 A;  2DZZ A;  2PAD A;  1NL6 A;  3QJ3 A;  3CH2 X;  3OF8 A;  1PPO A;  4X6J A;  2DC7 A;  1AYW A;  3MHH A;  2R9C A;  1CSB B;  2E02 A;  1AYU A;  2DJF B;  3H8C A;  1Y4H A;  3WXF A;  1IWD A;  3CH3 X;  2F1G A;  2BSZ A;  2AVW A;  3ZUA A;  4QBB A;  1ZCM A;  1PPN A;  4Q8G A;  4YYQ A;  2DJG B;  2AIM A;  3M99 A;  1Q6K A;  2CB5 A;  4K7C A;  4PAD A;  1NB3 A;  1NB5 A;  2FUD A;  3QSD A;  4Q8H A;  1YVB A;  2YJ9 A;  4YVA A;  4DMY A;  3H89 A;  4CDC B;  2IBI A;  2CIO A;  3TNX A;  1AU4 A;  2E03 A;  1GMY A;  1PAD A;  1CJL A;  4MSX A;  4N79 A;  3QT4 A;  1PE6 A;  1EWL A;  5CVM A;  2VFB A;  2Y6E A;  1KHQ A;  2B1N A;  8PCH A;  2R9N A;  5CVO B;  2DC6 A;  2R9M A;  4N4Z A;  2YJ2 A;  1W4T A;  2YJC A;  1S4V A;  1ME4 A;  3K24 A;  2FRQ A;  4YYR A;  4PI3 A;  3H7D A;  2DCC A;  2VHF A;  1FH0 A;  3KSE A;  3IEJ A;  2WBF X;  2R9F A;  3DF0 A;  4X6H A;  1U9X A;  4W4U A;  1CV8 A;  4NV8 A;  4ZUX U;  1PPD A;  4P6E A;  3AI8 A;  3I06 A;  2HH5 A;  3P5X A;  2DCB A;  1THE A;  1MHW A;  4BS6 A;  4QRX A;  1SP4 B;  3V6E A;  2PNS A;  2G8E A;  1CS8 A;  3N3K A;  3KKU A;  1U5I A;  2NQI A;  1EF7 A;  5PAD A;  4BGF A;  4XR7 A;  5A24 A;  3S3R A;  4I04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...