4GUZA

Structure of the arylamine n-acetyltransferase from mycobacterium abscessus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
284
Chain Sequence
VPRGSHMWNGDELQLDEYLAFIGFDGDRSPTLETLRRLQRGHVLNIKWENLDAVLHKHVALDIPAVQAKLLRSPRGGYCYEHVALFGAVLQRLGFDFYGIQGRVQMGATTIRPATHGMLVVRLAAEQWLCDVGFGTSPLAPIRLVDEAVVADESWTYRLRRGEVTPGADGWTLSEAAGDGSEPGWLSRHTFVLEPQYPIDYRAASYFVASSPHSPFSTRAFVQQISPDHAYILDHRELHEIQPGVGRKTRQLTPAEVLATLREIFGIELGADDSTLLLERLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable arylamine n-acetyl transferase
publication title Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
rcsb
source organism Mycobacterium abscessus
total genus 86
structure length 284
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4guzA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4guzA01
4C5PA 1W5RA 4NV8A 1E2TA 2BSZA 4GUZA 4B55A 3LTWA 1W6FA 2VFBA 4NV7A 4BGFA 1GX3A 2VFCA 1W4TA 3D9WA
chains in the Genus database with same CATH superfamily
5H8TA 1ALBA 2A13A 3B2LA 2QOMA 4FQBB 2IZEB 3DSZA 4QGXA 4KC7A 4RUNA 1LUQA 5D47A 4AZRA 1ERBA 1OPBA 2M4LA 4GGZA 4ORSA 1SWTA 1A18A 3B2IA 4R0BA 1HQPA 3AEHA 1ZRYA 1AVGI 2OF9A 4CDEA 4EFGA 3FEPA 4NP1A 1KFFA 2BSZA 3NQ9A 2FLJA 5IRUA 5BVQA 2QMIA 4O4OA 2FKJA 5FQ6E 3VG4A 4NV7A 2CBRA 5F2BA 2MHDA 1D2UA 3P6GA 3TGCA 4YCHA 2P8GA 5HZ5A 1JYDA 1PBYA 4IB7A 1E2TA 4XMHA 2IZHB 2RTJA 2X46A 4Z6JA 1EW3A 4HPBA 2OY1O 2OVSA 1LIDA 1EPAA 1X8OA 4DMOA 3OBLA 2X56A 3EYCA 2XSTA 1SA8A 2N93A 2RTAA 1BRQA 3WBGA 1OEKA 4MEEA 2RQ0A 5K67A 2PFRA 3FA8A 1S44A 1IJ8A 1SMPI 1O8VA 1DF3A 1JJXA 1X8QA 1LIEA 5H9KA 4HPCA 2Q39A 4OMXA 4O4UA 3VHHA 3JQOA 5FENA 4KH8A 1LICA 2KW1A 1OBPA 1B0OA 5KHPA 3FIQA 1RXJA 1ICNA 3SLOA 3D96A 2CBSA 3ZI8A 5LJCA 2FRSA 3P24A 5AEOA 2FWVA 4ZFXA 5LJDA 3RDOA 2FR3A 3WZQA 1JYJA 1UYOX 4OS0A 1SRHA 4FBVA 3RDQA 1OEEA 3FW5A 3HOEA 3PQUA 1A2DA 1RXHA 1VWCB 2I5ZO 2MJIA 4GZVA 4CK4A 5L3YA 1GKAA 1VYOA 1KZWA 3EW1A 3F6ZB 1VWGB 2GC9A 4CDCA 2R74A 4MVLA 4EEJA 5IRWA 3BRNA 3D95A 3LHNA 1X71A 4NNTA 3RY1A 1KXOA 1NQNA 5B5GA 3WJCA 5D4AA 2LB6A 2IZGB 3GAQA 4Y0QA 3S5XA 4BX5B 1GT5A 4Z2OA 4I95A 2RTIB 4NNSA 1CRBA 4BX7B 1DZPA 2AVIA 5HCDC 3C78X 4ZGUA 2CZTA 3FR5A 4YGHA 3NQ3A 2WWPA 3RE5A 5HBSA 2JN3A 1I05A 1SRIA 2RTNB 2FS7A 1CBQA 1ZNDA 5F1EA 3EMMA 3K3LA 2L9CA 3HWEA 3VE1A 3WYPA 1DFVA 4KC8A 2Y32A 3WJGA 1DZJA 3F9DA 3PEDA 4RUUA 4ZCBA 1SRGA 3VG5A 4QZTA 1GM6A 1HXLA 3DTQA 2UZ2A 4ZHCA 4U3QA 3B2JA 2AMMX 3WJDA 3T2XA 3CMPA 2RD7C 2W2BA 3WJFA 1AELA 4OELA 4TKHA 5C0NA 1EXSA 4NLJA 1MEPA 1T68X 2Q9SA 5IXGA 4AZPA 1SLGB 4AZMA 3I0AA 4GJVA 4BJ8A 3SOTA 5CE4A 4AZNA 2IZBA 1I06A 2LKKA 2RTQB 1ZNGA 1KT6A 1EALA 1AVEA 1VWIB 3Q6LA 1RSUB 2RTHB 4A1YA 4ZHDA 2HYSA 3P6HA 3FR4A 1LIFA 5B10O 3PH5A 2R73A 4XMFA 3RKGA 2AT8X 2RTGB 1SWQA 1JBHA 2A8GA 2WQ9A 1PMPA 2RTKA 3T2WA 3FIDA 5D8JA 2K62A 5LJKA 3LTWA 3SZJA 4ORUA 5HCCC 3P6FA 1SLEB 3IFBA 3UEWA 1PBOA 1X8PA 5D45A 1HMTA 2MM3A 3MBTA 4ZR2A 1BEBA 5HZ9A 1BLRA 2L67A 1ML7A 1QY2A 3U0DA 2RTEB 3ELZA 1QY1A 2ACPX 1D3SA 2QO6A 4WFUA 2G7BA 1RSTB 2RTBB 3C77X 3FA9A 3KFFA 4ARHA 4HPDA 5L8OA 2WSJA 4D6BA 4NYQA 4BCSA 3HWDA 4YMYA 1SWBA 2HNXA 4QZUA 2OFMX 1DF8A 5LJHA 3L4RA 2X8TA 3WYQA 1VWKB 1X8NA 1HBPA 4CPHA 2IZAA 1NP4A 3BX8A 1LDOA 2RTMA 1BBPA 4N7DA 4ORYA 1S7DA 4GNWA 1FTPA 1Y55X 3RY2A 4EXZA 5DPQA 2PI3O 1NC9A 5EDCA 4M6SA 1VWOB 1SWNA 3N91A 1IFCA 2PQTA 1SXYA 3P02A 3VG2A 4AZQA 1RBPA 5IRAA 1MUPA 2JW1A 2RTCB 5LJBA 3BU1A 1SWGA 3UEVA 1BWYA 3C76X 1EIOA 4FGIB 1VWFB 3FW4A 1I78A 4I6SA 1SXWA 1TOWA 3O19A 3WJBA 1Z24A 3STNA 1S2PA 4FBOA 1OBQA 5JD2A 2WQAE 4TQ2A 4ES7A 4ZHGA 3P6EA 1U17A 4TNNA 2OVAA 3FYFA 3EC5A 2OY7A 1Y52X 2Q4NA 2WEWA 1DZKA 4GDAA 4IAWA 4BX6B 1VWDB 3P6DA 1HN2A 5FQ7E 3FMZA 4ON1A 2C1SA 4O3XB 1BSYA 5HCEC 2KD2A 4L3RA 1MX8A 1P6PA 3HOLA 4XMGA 4INNA 1N7YA 3APVA 1Y53X 2BLGA 3MX7A 4L1NA 4MVKA 4U8UN 4CDDA 3APUA 4GH7A 1VWNB 4Y59A 1SWLA 4BVMA 1LKEA 5HTDA 1N0SA 5H9LA 3BS2A 4IMNA 5BVTA 1IKJA 3WJEA 5IO5A 3SZHA 5JR8A 1VWJB 3EW2A 3ZW1B 3STKA 2WPUA 1SWRA 4WFVA 1MVGA 1SY0A 1KOIA 4YGGA 1HQQA 4NW4A 4GKCA 3PQSA 3E3CA 5HTEA 3ZW0A 2GH7A 1I9HA 4UU2A 5D48A 4Y0PA 1SREA 3BSZE 4ZGFA 2X32A 3PECA 1HY2A 1SWCA 3RDSA 5IO7A 1SWKA 2BS6A 2IZLB 2PY1A 3B2KA 1JJUA 1KT3A 4GD9A 1YWBA 2AKQA 1PEEA 2X8FA 4IBAA 4MVEA 4O3WA 4DQ4A 2HKDA 4GJSA 4I3BA 4I9SA 1JMXA 1JZUA 4IRWA 2NNQA 2O62A 5EDBA 1DV9A 1SWHA 1Y9TA 5L8NA 3KFIA 1KQWA 4EKVA 2WEXA 1JJJA 5AJCA 2LFOA 1EIIA 4PJ2A 1MOYA 3ELXA 3FLLA 1KZXA 3WZPA 1NDJA 2F09A 4CDFA 5B5FA 3SLJA 4ORRA 2L5PA 2L68A 3FDCA 3H3IA 2MWHA 3HK1A 3VG6A 2G5LA 1RLBE 3JS1A 1O1VA 1B4MA 2X55A 1MK5A 1VWLB 2CM9A 2X8SA 2YMSA 3D97A 3FA6A 4BX6A 2IZFB 2RTRB 1MDCA 2BC3A 1WBIA 3I17A 4IABA 1FDQA 1VPRA 3APWA 4CPIA 2A2GA 1SWEA 5HWZA 1QY0A 2KTSA 4IB9A 4YKMA 3RE6A 2OVEA 2CAMA 4QYPA 2VFCA 1UREA 4YH0A 2R56A 3PK2A 3ZUOA 4YBPA 3F8AA 4KT5A 4I3DA 2Q2MA 4A1HA 1SWFA 1HMSA 1B56A 4CSBA 2ZAGA 4JO6A 1FENA 1STSB 1LELA 2JU3A 2WR6A 4HFOA 4A60A 2QOSC 2FT9A 2LBAA 3ZW1A 3O2YA 3PPTA 1YWCA 5F6ZA 4KIIA 4Z27A 1OEJA 4NLIA 2QM9A 4WHIA 3P6CA 5F6BA 4U8UM 3T1DA 3UEXA 2JU8A 2C4IA 1QFTA 1JMZA 5L8IA 1SWUA 4IAXA 3RDUA 3PH6A 2AT6X 4Z2VA 3VGWA 2VDFA 1TXLA 2E4JA 1E5PA 4QYNA 3X00A 4JHQA 4ZH9A 1FJ1E 2OFBA 1SXXA 4YVBA 4U46A 3TF6A 1NBXA 2DJFA 3CWKA 4NYRA 1YWAA 1N9YA 4U8UO 3GE2A 1ZNLA 4GRJA 1JIWI 2RCTA 3LV4A 2LBVA 4BX5A 2ZSCA 3CKFA 4BX7A 2BHVA 1IFBA 2Z4IA 3CKGA 2AH7X 2K23A 1NQMA 3KFGA 2RTOB 1SWOA 2JGSA 1SWJA 2Z4HA 2OF8A 5B3MO 2LA7A 4K19A 1GT3A 2OL7A 5LJGA 3RWXA 4GDZA 4BGFA 3U9PC 2CZUA 2F01A 3SLTA 4KCAA 1A57A 4GUZA 1LCWA 4YFPA 1LCVA 3UEUA 1CJ5A 3HWFA 2FHLA 1QG5A 4M7MA 1HBQA 3HWGA 4OEMA 5CYBA 1OPAA 1IKEA 2EU7X 2JU7A 1IIUA 2BS5A 3O22A 1KGLA 1JV4A 2KT4B 1N9MA 1SLFB 5BVSA 2RTFB 4A8ZA 2FR2A 1STRB 3FA7A 3ZUIA 1IW2A 4YFQA 3S5VA 4GE1A 3T6LA 2YG2A 1STPA 1ACDA 4JGLA 2OFAA 3VU1A 1KL3A 4O3YA 3ZQ3A 2DJGA 2UYWA 1GT1A 3WZNA 5HA0A 1KT4A 1SLDB 1JQPA 2JOZA 3VPJE 1N43A 5LKFA 4BOEA 3FEKA 2QCBA 3CQNA 5K06A 4DQ3A 4YFRA 2OVDA 4ZH6A 1SWSA 2A0AA 1E00A 1FELA 4O4XA 3RDXA 1GKAB 4TLJA 1VWBB 4N7CA 3LNBA 2HZRA 2W2FA 3RSWA 4ALBA 1ZNHA 4Y5DA 3WXQA 4BBOA 3U03A 4XMEA 4ZHFA 2OL6O 1EPBA 1AB0A 5H9AA 4YGZA 2AT0X 4HWMA 4B55A 1T8VA 3KVNA 3QQ2A 2IJAA 3FELA 1GXAA 1Y9LA 2OL8O 1QQSA 4NV8A 4ODDA 4GK9A 3VG7A 3FENA 1K24A 3MG5A 2Y3FA 3SZIA 1ADLA 2RCQA 1PM1X 1VWAB 2AF5A 3AKMA 4IMOA 5B2AO 4AW8A 4TKJA 4DNEA 2IZKA 1O1UA 1HXZA 1UZ2X 1VWEB 4OS8A 4YBUA 4YKOA 4MIRA 1G5WA 2POAA 2OY5O 2F73A 1VYGA 1KL4A 2ANSA 3S60A 1AQBA 2X34A 2A5BA 2RTPB 4GGTA 4GNYA 3TZSA 4QGVA 1A3YA 2JMBA 1LNMA 2NNEA 3CBSA 4OS3A 5LKEA 2W2AA 4GETA 2GTLN 2OFRX 3B2HA 2OYBO 1TW4A 1RAVA 4UU3A 1LF7A 1DZMA 3JSQA 2AT3X 1PTSA 2GTFX 3BY0A 4DCBA 1AVDA 2OY8A 2XKLA 3RBYA 1ERXA 1DC9A 4YDAA 1BSOA 5KICA 2AL0X 5CHKA 2X4MA 5IO6A 4LQZA 4LKPA 2VFBA 1GX8A 2ALLX 2QO4A 1ICMA 1SY2A 1W4TA 3D9WA 2BT9A 3D4RA 2C1QA 5LJEA 3AKNA 4HPAA 1G74A 1I04A 1R0UA 1U0XA 3AUMO 3TGBA 3CR6A 4ALOA 4LKTA 1XCAA 4MISA 4COTA 1H91A 1BM5A 1SY3A 1GT4A 1ZNKA 3KQ0A 1SWAA 3NR3A 4Z28A 4XMDA 5HZ6A 3CQRA 3NX2A 3UAQA 4ML7B 4O49A 5FQ8E 4C5PA 1SY1A 4QGWA 3TGAA 4CV7A 4U9CA 2I5VO 4Z2PA 4O9SA 1KQXA 4OMWA 3VG3A 1NP1A 1SWDA 5F58A 1QFVA 5FAZA 3VHIA 4ORXA 5B11O 2Q2PA 1HMRA 1WUBA 3NADA 1I4UA 1TOUA 1KT7A 2X45A 3G7XA 2RN4A 1VWQB 2IZJA 3EBWA 3NBXX 3WVMA 3KZAA 4PSQA 3NX1A 4GU8A 1Y0GA 3FR2A 5EEEA 1YWDA 1BSQA 1SRJA 3STMX 3ZW2A 2FS6A 1VWPB 2MO5A 1VWRB 5HZQA 4I3CA 1BJ7A 2FGSA 2ZAIA 4EDEA 2G8CO 4CPHB 1E02A 4IB6A 4MVIA 1G85A 2IFBA 5CSEA 5FFHA 3QKGA 5AJBA 3EBKA 2MF6A 1LDQA 3ZZVA 4QQ1A 4ZJ0A 4LZVA 4O3ZA 1EI5A 5EZ2A 1GX9A 2Y3EA 3MVFA 5HZ8A 1FEMA 2IZIA 1RXKA 1TVQA 1UYNX 1OBUA 1ZNEA 2FKGA 3ZWEA 1BRPA 1EUOA 5EEDA 1YP7A 2DM5A 2OZQA 3HTYA 2A3FX 5B29A 3V8UA 3VE2A 3WZOA 2IZDB 4QAEA 5AQ6A 1GGLA 4AZOA 4ZHHA 2HLVA 3NPOA 5H9NA 3WOVA 1MM9A 4YDBA 5F7GA 1EQDA 1LIBA 3BU9A 5K68A 3PP6A 4CPFA 3OD9A 4EQAC 3APXA 3RDMA 2ASNX 3IA8A 5BYPA 4GGRA 1VWHB 5HA1A 4TKBA 5KIDA 3BLGA 1T0VA 2A2UA 2GTLM 3S26A 4O4SA 3Q34A 4QRLA 3BX7A 4CPEA 4QNIA 4YCEA 1E06A 2A5CA 3OJYC 3RZYA 1XKIA 2QO5A 1QWDA 2WUTA 3EM0A 5DG4A 1K3BA 2FTBA 1N4JA 1G7NA 1OSPO 4Y0RA 3OE3A 2GTLO 2IZCB 4D6AA 1LPJA 3NP1A 4I60A 3SAOA 4BQUA 1GX3A 4FBRA 1U18A 3VHMA 4TJZA 3HPEA 1W5RA 3BDRA 1CBRA 3KFHA 4Y0SA 3PDFA 4ID2A 4XMCA 4ORWA 1YP6A 1FE3A 1X89A 2HZQA 5EPQA 1YUPA 5HAEA 2RA6A 2NP1A 3CBCA 1LCZA 2ACOA 1SRFA 1SXUA 1KT5A 1B8EA 1NGLA 1X8UA 2AT5X 1QABE 1VWMB 2G79A 2RTLA 1W6FA 4I9RA 1SWPA 4JNJA 1VYFA 2G78A 2KTDA 1MX7A 3MM0A 2CM4A 4OKAA 1LFOA 2FHNX 5B27A 3ZW0B 2HMBA 1CBSA 1KL5A 2GJ5A 2RTDB 4IB8A 4LZUA 4AYHA 3T6FA 4WBKA 1YIVA 1L6MA 1CBIA 3NQKA 2NNDA
chains in the Genus database with same CATH topology
4CDCB 4PP2E 3BC3A 1X9YA 2DC8A 2BSZA 2FRQA 4W5CA 4NV7A 1TL9A 1THEA 2DCDA 2PREA 5CHTA 3ERVA 2YJ2A 1E2TA 2OZ2A 3RVVA 2R6NA 3BPMA 4CDFB 4QBBA 4YYWA 3GCBA 1Q6KA 3HHAA 2VHSA 3OISA 1F2CA 4X6JA 2FRAA 3N4CA 4BS6A 3P5UA 1CTEA 1IWDA 4QH6A 7PCKA 1ATKA 3S3QA 3N3KA 2F1GA 2AVWA 3M99A 2XU5A 4MZSA 2YJBA 4BPVA 1MIRA 1S4VA 3CBKA 2B1MA 3I3TA 4BSQA 1GCBA 2WBFX 1MHWA 3KWBX 4P6GA 2DJFB 3ZUAA 2JQFR 4YV8A 2XU4A 2ATOA 1ZIVA 2AYNA 2YJ9A 2NQIA 2YJCA 4P6EA 3KKUA 3IHPA 2FQ9A 4CZWA 3IMAA 1NQCA 3WXEA 3I06A 1U9VA 5CHVA 3KW9A 4K7CA 1YVBA 1GMYA 5K16A 2P86A 2AUXA 4OELA 5CVOB 4FJCA 3USVA 3MTNA 1AYWA 2IPPB 2NQGA 2NQAA 2CIOA 3AI8A 2BDZA 2HXZA 2ARYA 1CS8A 1PPNA 3LTWA 1O0EA 2C0YA 2HHNA 2P7UA 1YT7A 5FPWA 3BCNA 8PCHA 1NL6A 1PE6A 4YYVA 4FK5A 1MS6A 1DF0A 2XU1A 4I05A 6PADA 1ICFA 1AU2A 4HWYA 3QT4A 1ITOA 3S3RA 3BPFA 3OVZA 1CSBB 1QXPA 4MSXA 1Y08A 3F75A 3KSEA 1CPJA 3PBHA 9PAPA 1BY8A 1U5IA 2R9CA 1PPDA 3WXGA 4YVAA 4PP1A 1F2BA 1YK8A 4YYQA 1Y4HA 2VHFA 2AUZA 1PADA 2H7JA 1SP4B 4YYUA 1AU4A 3CBJA 2AS8A 3H89A 1KXRA 1BP4A 2PBHA 2O6XA 1YK7A 1ZCMA 4N4ZA 3HD3A 2R9NA 3OF9A 1U9QX 2DCAA 2DC6A 1PXVA 2JQGR 3K9MA 3P5WA 2G8JA 2Y5BA 1FH0A 4BS5A 4DMYA 1GECE 1EWMA 1QOLA 2HD5A 2CB5A 3H7DA 1NLJA 2PNSA 3KX1A 3H6SA 3PNRA 1K3BB 1BGOA 5CVMA 5F02A 3PW3A 1SNKA 1VSNA 4AXLA 3WXFA 1CV8A 2VFCA 1VJVA 1DEUA 2DC7A 3V6EA 2DJGB 3MHHA 3OVXA 3K24A 1ME4A 1CVZA 2AIMA 2E03A 1NPZA 1NB5A 1EF7A 1PCIA 1F2AA 2F7DA 3MHSA 5EGWA 3H8BA 3IV2A 2G8EA 4MZOA 3LXSA 1ME3A 1GLOA 3QSDA 4G54A 1NB3A 4XR7A 2R9MA 2G7YA 1KHPA 2FYEA 3U8EA 3B79A 1KHQA 4BGFA 3IUTA 5JA7A 4GUZA 1AECA 1MEGA 4OEMA 1STFE 3BOWA 1MEMA 2B1NA 1EWPA 4FIPA 4X6HA 4DMXA 2OP3A 2NQDB 1JQPA 1PIPA 4XUIA 3HHIA 3DF0A 3IOQA 5JH3A 1PPPA 4PADA 1QMYA 3O0UA 1U9XA 1TLOA 2FTDA 1CQDA 3H8CA 4B55A 1PBHA 4W5BA 1POPA 4NV8A 3OF8A 1EWLA 5J94A 4N79A 2FT2A 3F5VA 3CH3X 2FO5A 4N8WA 1HUCB 1KFXL 1TU6A 2AU1A 2GHUA 2R9FA 4QRXA 3KFQA 4ZUXU 2OULA 1AIMA 2G6DA 4W4UA 2VFBA 1W4TA 3D9WA 3HWNA 3LFYA 1XKGA 1KFUL 4PI3A 4KLBA 3BWKA 3D6SA 1AU0A 4X6IA 4C5PA 1CB5A 3RVXA 4Q8HA 4I07A 1YALA 2R9OA 3KWZA 2E00A 3O1GA 5A24A 2HH5A 3IEJA 3TNXA 4AXMA 3P5XA 1QDQA 2DZYA 2AYOA 5CVNB 5EF4A 1AU3A 2E01A 2Y6EA 4CDEB 4WA6A 3RVWA 2YJ8A 2ACTA 2IBIA 2E02A 1EWOA 3N3GA 1AYVA 2DZZA 1CJLA 2GFOA 4BQVA 3NHEA 1M6DA 2PADA 2FUDA 3QJ3A 2P0RA 2DCCA 4QRGA 2DC9A 4CDDB 3K8UA 1GX3A 2XU3A 1W5RA 4I04A 3PDFA 4QRVA 3C9EA 1AYUA 3CH2X 3E1ZB 4YYRA 1U9WA 3V6CA 4YYSA 5PADA 1PPOA 1W6FA 4Q8GA 2BDLA 1A6RA 2DCBA 3P5VA 4RY2A 3MORA 1BQIA 1MDWA 1F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5P A;  1W5R A;  4NV8 A;  1E2T A;  2BSZ A;  4GUZ A;  4B55 A;  3LTW A;  1W6F A;  2VFB A;  4NV7 A;  4BGF A;  1GX3 A;  2VFC A;  1W4T A;  3D9W A; 
#chains in the Genus database with same CATH topology
 5H8T A;  1ALB A;  2A13 A;  3B2L A;  2QOM A;  4FQB B;  2IZE B;  3DSZ A;  4QGX A;  4KC7 A;  4RUN A;  1LUQ A;  5D47 A;  4AZR A;  1ERB A;  1OPB A;  2M4L A;  4GGZ A;  4ORS A;  1SWT A;  1A18 A;  3B2I A;  4R0B A;  1HQP A;  3AEH A;  1ZRY A;  1AVG I;  2OF9 A;  4CDE A;  4EFG A;  3FEP A;  4NP1 A;  1KFF A;  2BSZ A;  3NQ9 A;  2FLJ A;  5IRU A;  5BVQ A;  2QMI A;  4O4O A;  2FKJ A;  5FQ6 E;  3VG4 A;  4NV7 A;  2CBR A;  5F2B A;  2MHD A;  1D2U A;  3P6G A;  3TGC A;  4YCH A;  2P8G A;  5HZ5 A;  1JYD A;  1PBY A;  4IB7 A;  1E2T A;  4XMH A;  2IZH B;  2RTJ A;  2X46 A;  4Z6J A;  1EW3 A;  4HPB A;  2OY1 O;  2OVS A;  1LID A;  1EPA A;  1X8O A;  4DMO A;  3OBL A;  2X56 A;  3EYC A;  2XST A;  1SA8 A;  2N93 A;  2RTA A;  1BRQ A;  3WBG A;  1OEK A;  4MEE A;  2RQ0 A;  5K67 A;  2PFR A;  3FA8 A;  1S44 A;  1IJ8 A;  1SMP I;  1O8V A;  1DF3 A;  1JJX A;  1X8Q A;  1LIE A;  5H9K A;  4HPC A;  2Q39 A;  4OMX A;  4O4U A;  3VHH A;  3JQO A;  5FEN A;  4KH8 A;  1LIC A;  2KW1 A;  1OBP A;  1B0O A;  5KHP A;  3FIQ A;  1RXJ A;  1ICN A;  3SLO A;  3D96 A;  2CBS A;  3ZI8 A;  5LJC A;  2FRS A;  3P24 A;  5AEO A;  2FWV A;  4ZFX A;  5LJD A;  3RDO A;  2FR3 A;  3WZQ A;  1JYJ A;  1UYO X;  4OS0 A;  1SRH A;  4FBV A;  3RDQ A;  1OEE A;  3FW5 A;  3HOE A;  3PQU A;  1A2D A;  1RXH A;  1VWC B;  2I5Z O;  2MJI A;  4GZV A;  4CK4 A;  5L3Y A;  1GKA A;  1VYO A;  1KZW A;  3EW1 A;  3F6Z B;  1VWG B;  2GC9 A;  4CDC A;  2R74 A;  4MVL A;  4EEJ A;  5IRW A;  3BRN A;  3D95 A;  3LHN A;  1X71 A;  4NNT A;  3RY1 A;  1KXO A;  1NQN A;  5B5G A;  3WJC A;  5D4A A;  2LB6 A;  2IZG B;  3GAQ A;  4Y0Q A;  3S5X A;  4BX5 B;  1GT5 A;  4Z2O A;  4I95 A;  2RTI B;  4NNS A;  1CRB A;  4BX7 B;  1DZP A;  2AVI A;  5HCD C;  3C78 X;  4ZGU A;  2CZT A;  3FR5 A;  4YGH A;  3NQ3 A;  2WWP A;  3RE5 A;  5HBS A;  2JN3 A;  1I05 A;  1SRI A;  2RTN B;  2FS7 A;  1CBQ A;  1ZND A;  5F1E A;  3EMM A;  3K3L A;  2L9C A;  3HWE A;  3VE1 A;  3WYP A;  1DFV A;  4KC8 A;  2Y32 A;  3WJG A;  1DZJ A;  3F9D A;  3PED A;  4RUU A;  4ZCB A;  1SRG A;  3VG5 A;  4QZT A;  1GM6 A;  1HXL A;  3DTQ A;  2UZ2 A;  4ZHC A;  4U3Q A;  3B2J A;  2AMM X;  3WJD A;  3T2X A;  3CMP A;  2RD7 C;  2W2B A;  3WJF A;  1AEL A;  4OEL A;  4TKH A;  5C0N A;  1EXS A;  4NLJ A;  1MEP A;  1T68 X;  2Q9S A;  5IXG A;  4AZP A;  1SLG B;  4AZM A;  3I0A A;  4GJV A;  4BJ8 A;  3SOT A;  5CE4 A;  4AZN A;  2IZB A;  1I06 A;  2LKK A;  2RTQ B;  1ZNG A;  1KT6 A;  1EAL A;  1AVE A;  1VWI B;  3Q6L A;  1RSU B;  2RTH B;  4A1Y A;  4ZHD A;  2HYS A;  3P6H A;  3FR4 A;  1LIF A;  5B10 O;  3PH5 A;  2R73 A;  4XMF A;  3RKG A;  2AT8 X;  2RTG B;  1SWQ A;  1JBH A;  2A8G A;  2WQ9 A;  1PMP A;  2RTK A;  3T2W A;  3FID A;  5D8J A;  2K62 A;  5LJK A;  3LTW A;  3SZJ A;  4ORU A;  5HCC C;  3P6F A;  1SLE B;  3IFB A;  3UEW A;  1PBO A;  1X8P A;  5D45 A;  1HMT A;  2MM3 A;  3MBT A;  4ZR2 A;  1BEB A;  5HZ9 A;  1BLR A;  2L67 A;  1ML7 A;  1QY2 A;  3U0D A;  2RTE B;  3ELZ A;  1QY1 A;  2ACP X;  1D3S A;  2QO6 A;  4WFU A;  2G7B A;  1RST B;  2RTB B;  3C77 X;  3FA9 A;  3KFF A;  4ARH A;  4HPD A;  5L8O A;  2WSJ A;  4D6B A;  4NYQ A;  4BCS A;  3HWD A;  4YMY A;  1SWB A;  2HNX A;  4QZU A;  2OFM X;  1DF8 A;  5LJH A;  3L4R A;  2X8T A;  3WYQ A;  1VWK B;  1X8N A;  1HBP A;  4CPH A;  2IZA A;  1NP4 A;  3BX8 A;  1LDO A;  2RTM A;  1BBP A;  4N7D A;  4ORY A;  1S7D A;  4GNW A;  1FTP A;  1Y55 X;  3RY2 A;  4EXZ A;  5DPQ A;  2PI3 O;  1NC9 A;  5EDC A;  4M6S A;  1VWO B;  1SWN A;  3N91 A;  1IFC A;  2PQT A;  1SXY A;  3P02 A;  3VG2 A;  4AZQ A;  1RBP A;  5IRA A;  1MUP A;  2JW1 A;  2RTC B;  5LJB A;  3BU1 A;  1SWG A;  3UEV A;  1BWY A;  3C76 X;  1EIO A;  4FGI B;  1VWF B;  3FW4 A;  1I78 A;  4I6S A;  1SXW A;  1TOW A;  3O19 A;  3WJB A;  1Z24 A;  3STN A;  1S2P A;  4FBO A;  1OBQ A;  5JD2 A;  2WQA E;  4TQ2 A;  4ES7 A;  4ZHG A;  3P6E A;  1U17 A;  4TNN A;  2OVA A;  3FYF A;  3EC5 A;  2OY7 A;  1Y52 X;  2Q4N A;  2WEW A;  1DZK A;  4GDA A;  4IAW A;  4BX6 B;  1VWD B;  3P6D A;  1HN2 A;  5FQ7 E;  3FMZ A;  4ON1 A;  2C1S A;  4O3X B;  1BSY A;  5HCE C;  2KD2 A;  4L3R A;  1MX8 A;  1P6P A;  3HOL A;  4XMG A;  4INN A;  1N7Y A;  3APV A;  1Y53 X;  2BLG A;  3MX7 A;  4L1N A;  4MVK A;  4U8U N;  4CDD A;  3APU A;  4GH7 A;  1VWN B;  4Y59 A;  1SWL A;  4BVM A;  1LKE A;  5HTD A;  1N0S A;  5H9L A;  3BS2 A;  4IMN A;  5BVT A;  1IKJ A;  3WJE A;  5IO5 A;  3SZH A;  5JR8 A;  1VWJ B;  3EW2 A;  3ZW1 B;  3STK A;  2WPU A;  1SWR A;  4WFV A;  1MVG A;  1SY0 A;  1KOI A;  4YGG A;  1HQQ A;  4NW4 A;  4GKC A;  3PQS A;  3E3C A;  5HTE A;  3ZW0 A;  2GH7 A;  1I9H A;  4UU2 A;  5D48 A;  4Y0P A;  1SRE A;  3BSZ E;  4ZGF A;  2X32 A;  3PEC A;  1HY2 A;  1SWC A;  3RDS A;  5IO7 A;  1SWK A;  2BS6 A;  2IZL B;  2PY1 A;  3B2K A;  1JJU A;  1KT3 A;  4GD9 A;  1YWB A;  2AKQ A;  1PEE A;  2X8F A;  4IBA A;  4MVE A;  4O3W A;  4DQ4 A;  2HKD A;  4GJS A;  4I3B A;  4I9S A;  1JMX A;  1JZU A;  4IRW A;  2NNQ A;  2O62 A;  5EDB A;  1DV9 A;  1SWH A;  1Y9T A;  5L8N A;  3KFI A;  1KQW A;  4EKV A;  2WEX A;  1JJJ A;  5AJC A;  2LFO A;  1EII A;  4PJ2 A;  1MOY A;  3ELX A;  3FLL A;  1KZX A;  3WZP A;  1NDJ A;  2F09 A;  4CDF A;  5B5F A;  3SLJ A;  4ORR A;  2L5P A;  2L68 A;  3FDC A;  3H3I A;  2MWH A;  3HK1 A;  3VG6 A;  2G5L A;  1RLB E;  3JS1 A;  1O1V A;  1B4M A;  2X55 A;  1MK5 A;  1VWL B;  2CM9 A;  2X8S A;  2YMS A;  3D97 A;  3FA6 A;  4BX6 A;  2IZF B;  2RTR B;  1MDC A;  2BC3 A;  1WBI A;  3I17 A;  4IAB A;  1FDQ A;  1VPR A;  3APW A;  4CPI A;  2A2G A;  1SWE A;  5HWZ A;  1QY0 A;  2KTS A;  4IB9 A;  4YKM A;  3RE6 A;  2OVE A;  2CAM A;  4QYP A;  2VFC A;  1URE A;  4YH0 A;  2R56 A;  3PK2 A;  3ZUO A;  4YBP A;  3F8A A;  4KT5 A;  4I3D A;  2Q2M A;  4A1H A;  1SWF A;  1HMS A;  1B56 A;  4CSB A;  2ZAG A;  4JO6 A;  1FEN A;  1STS B;  1LEL A;  2JU3 A;  2WR6 A;  4HFO A;  4A60 A;  2QOS C;  2FT9 A;  2LBA A;  3ZW1 A;  3O2Y A;  3PPT A;  1YWC A;  5F6Z A;  4KII A;  4Z27 A;  1OEJ A;  4NLI A;  2QM9 A;  4WHI A;  3P6C A;  5F6B A;  4U8U M;  3T1D A;  3UEX A;  2JU8 A;  2C4I A;  1QFT A;  1JMZ A;  5L8I A;  1SWU A;  4IAX A;  3RDU A;  3PH6 A;  2AT6 X;  4Z2V A;  3VGW A;  2VDF A;  1TXL A;  2E4J A;  1E5P A;  4QYN A;  3X00 A;  4JHQ A;  4ZH9 A;  1FJ1 E;  2OFB A;  1SXX A;  4YVB A;  4U46 A;  3TF6 A;  1NBX A;  2DJF A;  3CWK A;  4NYR A;  1YWA A;  1N9Y A;  4U8U O;  3GE2 A;  1ZNL A;  4GRJ A;  1JIW I;  2RCT A;  3LV4 A;  2LBV A;  4BX5 A;  2ZSC A;  3CKF A;  4BX7 A;  2BHV A;  1IFB A;  2Z4I A;  3CKG A;  2AH7 X;  2K23 A;  1NQM A;  3KFG A;  2RTO B;  1SWO A;  2JGS A;  1SWJ A;  2Z4H A;  2OF8 A;  5B3M O;  2LA7 A;  4K19 A;  1GT3 A;  2OL7 A;  5LJG A;  3RWX A;  4GDZ A;  4BGF A;  3U9P C;  2CZU A;  2F01 A;  3SLT A;  4KCA A;  1A57 A;  4GUZ A;  1LCW A;  4YFP A;  1LCV A;  3UEU A;  1CJ5 A;  3HWF A;  2FHL A;  1QG5 A;  4M7M A;  1HBQ A;  3HWG A;  4OEM A;  5CYB A;  1OPA A;  1IKE A;  2EU7 X;  2JU7 A;  1IIU A;  2BS5 A;  3O22 A;  1KGL A;  1JV4 A;  2KT4 B;  1N9M A;  1SLF B;  5BVS A;  2RTF B;  4A8Z A;  2FR2 A;  1STR B;  3FA7 A;  3ZUI A;  1IW2 A;  4YFQ A;  3S5V A;  4GE1 A;  3T6L A;  2YG2 A;  1STP A;  1ACD A;  4JGL A;  2OFA A;  3VU1 A;  1KL3 A;  4O3Y A;  3ZQ3 A;  2DJG A;  2UYW A;  1GT1 A;  3WZN A;  5HA0 A;  1KT4 A;  1SLD B;  1JQP A;  2JOZ A;  3VPJ E;  1N43 A;  5LKF A;  4BOE A;  3FEK A;  2QCB A;  3CQN A;  5K06 A;  4DQ3 A;  4YFR A;  2OVD A;  4ZH6 A;  1SWS A;  2A0A A;  1E00 A;  1FEL A;  4O4X A;  3RDX A;  1GKA B;  4TLJ A;  1VWB B;  4N7C A;  3LNB A;  2HZR A;  2W2F A;  3RSW A;  4ALB A;  1ZNH A;  4Y5D A;  3WXQ A;  4BBO A;  3U03 A;  4XME A;  4ZHF A;  2OL6 O;  1EPB A;  1AB0 A;  5H9A A;  4YGZ A;  2AT0 X;  4HWM A;  4B55 A;  1T8V A;  3KVN A;  3QQ2 A;  2IJA A;  3FEL A;  1GXA A;  1Y9L A;  2OL8 O;  1QQS A;  4NV8 A;  4ODD A;  4GK9 A;  3VG7 A;  3FEN A;  1K24 A;  3MG5 A;  2Y3F A;  3SZI A;  1ADL A;  2RCQ A;  1PM1 X;  1VWA B;  2AF5 A;  3AKM A;  4IMO A;  5B2A O;  4AW8 A;  4TKJ A;  4DNE A;  2IZK A;  1O1U A;  1HXZ A;  1UZ2 X;  1VWE B;  4OS8 A;  4YBU A;  4YKO A;  4MIR A;  1G5W A;  2POA A;  2OY5 O;  2F73 A;  1VYG A;  1KL4 A;  2ANS A;  3S60 A;  1AQB A;  2X34 A;  2A5B A;  2RTP B;  4GGT A;  4GNY A;  3TZS A;  4QGV A;  1A3Y A;  2JMB A;  1LNM A;  2NNE A;  3CBS A;  4OS3 A;  5LKE A;  2W2A A;  4GET A;  2GTL N;  2OFR X;  3B2H A;  2OYB O;  1TW4 A;  1RAV A;  4UU3 A;  1LF7 A;  1DZM A;  3JSQ A;  2AT3 X;  1PTS A;  2GTF X;  3BY0 A;  4DCB A;  1AVD A;  2OY8 A;  2XKL A;  3RBY A;  1ERX A;  1DC9 A;  4YDA A;  1BSO A;  5KIC A;  2AL0 X;  5CHK A;  2X4M A;  5IO6 A;  4LQZ A;  4LKP A;  2VFB A;  1GX8 A;  2ALL X;  2QO4 A;  1ICM A;  1SY2 A;  1W4T A;  3D9W A;  2BT9 A;  3D4R A;  2C1Q A;  5LJE A;  3AKN A;  4HPA A;  1G74 A;  1I04 A;  1R0U A;  1U0X A;  3AUM O;  3TGB A;  3CR6 A;  4ALO A;  4LKT A;  1XCA A;  4MIS A;  4COT A;  1H91 A;  1BM5 A;  1SY3 A;  1GT4 A;  1ZNK A;  3KQ0 A;  1SWA A;  3NR3 A;  4Z28 A;  4XMD A;  5HZ6 A;  3CQR A;  3NX2 A;  3UAQ A;  4ML7 B;  4O49 A;  5FQ8 E;  4C5P A;  1SY1 A;  4QGW A;  3TGA A;  4CV7 A;  4U9C A;  2I5V O;  4Z2P A;  4O9S A;  1KQX A;  4OMW A;  3VG3 A;  1NP1 A;  1SWD A;  5F58 A;  1QFV A;  5FAZ A;  3VHI A;  4ORX A;  5B11 O;  2Q2P A;  1HMR A;  1WUB A;  3NAD A;  1I4U A;  1TOU A;  1KT7 A;  2X45 A;  3G7X A;  2RN4 A;  1VWQ B;  2IZJ A;  3EBW A;  3NBX X;  3WVM A;  3KZA A;  4PSQ A;  3NX1 A;  4GU8 A;  1Y0G A;  3FR2 A;  5EEE A;  1YWD A;  1BSQ A;  1SRJ A;  3STM X;  3ZW2 A;  2FS6 A;  1VWP B;  2MO5 A;  1VWR B;  5HZQ A;  4I3C A;  1BJ7 A;  2FGS A;  2ZAI A;  4EDE A;  2G8C O;  4CPH B;  1E02 A;  4IB6 A;  4MVI A;  1G85 A;  2IFB A;  5CSE A;  5FFH A;  3QKG A;  5AJB A;  3EBK A;  2MF6 A;  1LDQ A;  3ZZV A;  4QQ1 A;  4ZJ0 A;  4LZV A;  4O3Z A;  1EI5 A;  5EZ2 A;  1GX9 A;  2Y3E A;  3MVF A;  5HZ8 A;  1FEM A;  2IZI A;  1RXK A;  1TVQ A;  1UYN X;  1OBU A;  1ZNE A;  2FKG A;  3ZWE A;  1BRP A;  1EUO A;  5EED A;  1YP7 A;  2DM5 A;  2OZQ A;  3HTY A;  2A3F X;  5B29 A;  3V8U A;  3VE2 A;  3WZO A;  2IZD B;  4QAE A;  5AQ6 A;  1GGL A;  4AZO A;  4ZHH A;  2HLV A;  3NPO A;  5H9N A;  3WOV A;  1MM9 A;  4YDB A;  5F7G A;  1EQD A;  1LIB A;  3BU9 A;  5K68 A;  3PP6 A;  4CPF A;  3OD9 A;  4EQA C;  3APX A;  3RDM A;  2ASN X;  3IA8 A;  5BYP A;  4GGR A;  1VWH B;  5HA1 A;  4TKB A;  5KID A;  3BLG A;  1T0V A;  2A2U A;  2GTL M;  3S26 A;  4O4S A;  3Q34 A;  4QRL A;  3BX7 A;  4CPE A;  4QNI A;  4YCE A;  1E06 A;  2A5C A;  3OJY C;  3RZY A;  1XKI A;  2QO5 A;  1QWD A;  2WUT A;  3EM0 A;  5DG4 A;  1K3B A;  2FTB A;  1N4J A;  1G7N A;  1OSP O;  4Y0R A;  3OE3 A;  2GTL O;  2IZC B;  4D6A A;  1LPJ A;  3NP1 A;  4I60 A;  3SAO A;  4BQU A;  1GX3 A;  4FBR A;  1U18 A;  3VHM A;  4TJZ A;  3HPE A;  1W5R A;  3BDR A;  1CBR A;  3KFH A;  4Y0S A;  3PDF A;  4ID2 A;  4XMC A;  4ORW A;  1YP6 A;  1FE3 A;  1X89 A;  2HZQ A;  5EPQ A;  1YUP A;  5HAE A;  2RA6 A;  2NP1 A;  3CBC A;  1LCZ A;  2ACO A;  1SRF A;  1SXU A;  1KT5 A;  1B8E A;  1NGL A;  1X8U A;  2AT5 X;  1QAB E;  1VWM B;  2G79 A;  2RTL A;  1W6F A;  4I9R A;  1SWP A;  4JNJ A;  1VYF A;  2G78 A;  2KTD A;  1MX7 A;  3MM0 A;  2CM4 A;  4OKA A;  1LFO A;  2FHN X;  5B27 A;  3ZW0 B;  2HMB A;  1CBS A;  1KL5 A;  2GJ5 A;  2RTD B;  4IB8 A;  4LZU A;  4AYH A;  3T6F A;  4WBK A;  1YIV A;  1L6M A;  1CBI A;  3NQK A;  2NND A; 
#chains in the Genus database with same CATH homology
 4CDC B;  4PP2 E;  3BC3 A;  1X9Y A;  2DC8 A;  2BSZ A;  2FRQ A;  4W5C A;  4NV7 A;  1TL9 A;  1THE A;  2DCD A;  2PRE A;  5CHT A;  3ERV A;  2YJ2 A;  1E2T A;  2OZ2 A;  3RVV A;  2R6N A;  3BPM A;  4CDF B;  4QBB A;  4YYW A;  3GCB A;  1Q6K A;  3HHA A;  2VHS A;  3OIS A;  1F2C A;  4X6J A;  2FRA A;  3N4C A;  4BS6 A;  3P5U A;  1CTE A;  1IWD A;  4QH6 A;  7PCK A;  1ATK A;  3S3Q A;  3N3K A;  2F1G A;  2AVW A;  3M99 A;  2XU5 A;  4MZS A;  2YJB A;  4BPV A;  1MIR A;  1S4V A;  3CBK A;  2B1M A;  3I3T A;  4BSQ A;  1GCB A;  2WBF X;  1MHW A;  3KWB X;  4P6G A;  2DJF B;  3ZUA A;  2JQF R;  4YV8 A;  2XU4 A;  2ATO A;  1ZIV A;  2AYN A;  2YJ9 A;  2NQI A;  2YJC A;  4P6E A;  3KKU A;  3IHP A;  2FQ9 A;  4CZW A;  3IMA A;  1NQC A;  3WXE A;  3I06 A;  1U9V A;  5CHV A;  3KW9 A;  4K7C A;  1YVB A;  1GMY A;  5K16 A;  2P86 A;  2AUX A;  4OEL A;  5CVO B;  4FJC A;  3USV A;  3MTN A;  1AYW A;  2IPP B;  2NQG A;  2NQA A;  2CIO A;  3AI8 A;  2BDZ A;  2HXZ A;  2ARY A;  1CS8 A;  1PPN A;  3LTW A;  1O0E A;  2C0Y A;  2HHN A;  2P7U A;  1YT7 A;  5FPW A;  3BCN A;  8PCH A;  1NL6 A;  1PE6 A;  4YYV A;  4FK5 A;  1MS6 A;  1DF0 A;  2XU1 A;  4I05 A;  6PAD A;  1ICF A;  1AU2 A;  4HWY A;  3QT4 A;  1ITO A;  3S3R A;  3BPF A;  3OVZ A;  1CSB B;  1QXP A;  4MSX A;  1Y08 A;  3F75 A;  3KSE A;  1CPJ A;  3PBH A;  9PAP A;  1BY8 A;  1U5I A;  2R9C A;  1PPD A;  3WXG A;  4YVA A;  4PP1 A;  1F2B A;  1YK8 A;  4YYQ A;  1Y4H A;  2VHF A;  2AUZ A;  1PAD A;  2H7J A;  1SP4 B;  4YYU A;  1AU4 A;  3CBJ A;  2AS8 A;  3H89 A;  1KXR A;  1BP4 A;  2PBH A;  2O6X A;  1YK7 A;  1ZCM A;  4N4Z A;  3HD3 A;  2R9N A;  3OF9 A;  1U9Q X;  2DCA A;  2DC6 A;  1PXV A;  2JQG R;  3K9M A;  3P5W A;  2G8J A;  2Y5B A;  1FH0 A;  4BS5 A;  4DMY A;  1GEC E;  1EWM A;  1QOL A;  2HD5 A;  2CB5 A;  3H7D A;  1NLJ A;  2PNS A;  3KX1 A;  3H6S A;  3PNR A;  1K3B B;  1BGO A;  5CVM A;  5F02 A;  3PW3 A;  1SNK A;  1VSN A;  4AXL A;  3WXF A;  1CV8 A;  2VFC A;  1VJV A;  1DEU A;  2DC7 A;  3V6E A;  2DJG B;  3MHH A;  3OVX A;  3K24 A;  1ME4 A;  1CVZ A;  2AIM A;  2E03 A;  1NPZ A;  1NB5 A;  1EF7 A;  1PCI A;  1F2A A;  2F7D A;  3MHS A;  5EGW A;  3H8B A;  3IV2 A;  2G8E A;  4MZO A;  3LXS A;  1ME3 A;  1GLO A;  3QSD A;  4G54 A;  1NB3 A;  4XR7 A;  2R9M A;  2G7Y A;  1KHP A;  2FYE A;  3U8E A;  3B79 A;  1KHQ A;  4BGF A;  3IUT A;  5JA7 A;  4GUZ A;  1AEC A;  1MEG A;  4OEM A;  1STF E;  3BOW A;  1MEM A;  2B1N A;  1EWP A;  4FIP A;  4X6H A;  4DMX A;  2OP3 A;  2NQD B;  1JQP A;  1PIP A;  4XUI A;  3HHI A;  3DF0 A;  3IOQ A;  5JH3 A;  1PPP A;  4PAD A;  1QMY A;  3O0U A;  1U9X A;  1TLO A;  2FTD A;  1CQD A;  3H8C A;  4B55 A;  1PBH A;  4W5B A;  1POP A;  4NV8 A;  3OF8 A;  1EWL A;  5J94 A;  4N79 A;  2FT2 A;  3F5V A;  3CH3 X;  2FO5 A;  4N8W A;  1HUC B;  1KFX L;  1TU6 A;  2AU1 A;  2GHU A;  2R9F A;  4QRX A;  3KFQ A;  4ZUX U;  2OUL A;  1AIM A;  2G6D A;  4W4U A;  2VFB A;  1W4T A;  3D9W A;  3HWN A;  3LFY A;  1XKG A;  1KFU L;  4PI3 A;  4KLB A;  3BWK A;  3D6S A;  1AU0 A;  4X6I A;  4C5P A;  1CB5 A;  3RVX A;  4Q8H A;  4I07 A;  1YAL A;  2R9O A;  3KWZ A;  2E00 A;  3O1G A;  5A24 A;  2HH5 A;  3IEJ A;  3TNX A;  4AXM A;  3P5X A;  1QDQ A;  2DZY A;  2AYO A;  5CVN B;  5EF4 A;  1AU3 A;  2E01 A;  2Y6E A;  4CDE B;  4WA6 A;  3RVW A;  2YJ8 A;  2ACT A;  2IBI A;  2E02 A;  1EWO A;  3N3G A;  1AYV A;  2DZZ A;  1CJL A;  2GFO A;  4BQV A;  3NHE A;  1M6D A;  2PAD A;  2FUD A;  3QJ3 A;  2P0R A;  2DCC A;  4QRG A;  2DC9 A;  4CDD B;  3K8U A;  1GX3 A;  2XU3 A;  1W5R A;  4I04 A;  3PDF A;  4QRV A;  3C9E A;  1AYU A;  3CH2 X;  3E1Z B;  4YYR A;  1U9W A;  3V6C A;  4YYS A;  5PAD A;  1PPO A;  1W6F A;  4Q8G A;  2BDL A;  1A6R A;  2DCB A;  3P5V A;  4RY2 A;  3MOR A;  1BQI A;  1MDW A;  1F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...