4C5PA

The structure of mycobacterium marinum arylamine n-acetyltransferase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
272
structure length
271
Chain Sequence
b'DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
publication title Arylamine N-Acetyltransferases from Mycobacteria: Investigations of a Potential Target for Anti- Tubercular Therapy
rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 84
structure length 271
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4c5pA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4c5pA01
2BSZA 4NV7A 1W6FA 1GX3A 3D9WA 4NV8A 2VFBA 2VFCA 4GUZA 4C5PA 1E2TA 1W4TA 4B55A 3LTWA 4BGFA 1W5RA
chains in the Genus database with same CATH superfamily
3IA8A 4IMNA 4Y0RA 3WZOA 1KQXA 1VWJB 1OBPA 3RDUA 3D96A 4C5PA 3FDCA 2XKLA 3OBLA 4L3RA 4TKHA 4UU3A 3X00A 4PSQA 5EPQA 1O1VA 1E06A 4AZOA 4MVLA 1BWYA 1EW3A 3L4RA 5LJKA 1PMPA 2F01A 1HBQA 2FKGA 1SA8A 2WQAE 3GAQA 4GK9A 4NNSA 4NYRA 4Y0PA 3SLOA 4KC8A 1ZRYA 1MEPA 1A3YA 3QKGA 4HWMA 2BSZA 2GTLO 2HZQA 1JIWI 3F8AA 4I9SA 1ZNHA 4O9SA 4TJZA 3WZPA 2OVAA 5JR8A 4RUNA 2F09A 3FA6A 1LIBA 3ZWEA 1L6MA 1Y9LA 4GE1A 2RTNB 1KT7A 3RWXA 1LIEA 4GH7A 3WJFA 1SREA 1SWHA 1JYJA 1U17A 2BS5A 3CKFA 3RDXA 5BVSA 3VG5A 1OEKA 1BLRA 4GGRA 2PFRA 1DZPA 1K3BA 1JV4A 1OBUA 2GC9A 1PTSA 4O3WA 3LNBA 2OL7A 3VE2A 4CDFA 2OFAA 1QWDA 1VWCB 4XMDA 1IFBA 1AVGI 4OKAA 4OMWA 1ERBA 3U9PC 3BSZE 3NP1A 1SWDA 2OF8A 4ON1A 3FELA 5FFHA 4WFVA 1OBQA 2W2BA 1YWAA 2MWHA 3WVMA 4JGLA 4IB9A 2LA7A 2FR2A 1VPRA 1TXLA 3HWFA 2LKKA 5IRAA 4WFUA 3HWDA 3UEVA 2FHNX 3T6LA 2IZCB 5F58A 4ODDA 4MVIA 4HPCA 1LCZA 3ZW0A 3HK1A 4Z2PA 1FJ1E 2L68A 2X4MA 1XKIA 2RD7C 3FEKA 3PQSA 5FQ6E 2OVDA 4YGZA 4QNIA 1XCAA 1EUOA 3PP6A 3FLLA 1TOUA 3BX8A 1IIUA 3MX7A 1SMPI 2DJFA 3KVNA 1GKAB 1MDCA 1VWDB 1SY3A 2NNDA 1SLGB 4OS0A 4QYPA 1BM5A 2KTDA 1DZJA 2QO4A 2A2GA 2RTLA 1HXZA 1MX8A 2QMIA 4FBVA 2RTAA 5K68A 3RSWA 4TQ2A 2G7BA 4ZHCA 2LB6A 2G5LA 4ZH9A 4BX7B 3VU1A 2X55A 4Z28A 3STNA 4GGTA 1SWRA 1SWSA 1Y52X 1QFTA 1N7YA 1SWGA 4GKCA 4AZNA 4DNEA 1KT5A 1QY2A 2FS7A 3BS2A 2AT6X 3CMPA 1SRGA 1SWJA 2X8TA 4ZHGA 4TKBA 5HA1A 3VG4A 1SWQA 3O2YA 1JJJA 4KCAA 1VYOA 4YFRA 1TVQA 2CZTA 2AT3X 2W2FA 2FT9A 2QCBA 1KXOA 4YGGA 3EBWA 3GE2A 1QQSA 4QQ1A 1JJUA 1G5WA 3APXA 3NADA 5HCEC 2JU7A 4Z27A 4GJVA 2RTKA 4N7DA 2PQTA 1MM9A 2AL0X 3FA9A 1EIOA 1HMSA 1KT4A 2WPUA 2EU7X 2OY8A 1RAVA 4U8UM 4LKPA 1E5PA 5IRWA 3WYPA 1B4MA 4NLIA 3WJBA 2A5BA 2WEXA 1STPA 2Q4NA 2KD2A 5D4AA 2QO6A 1YP6A 1VWHB 3KFFA 1KT3A 1NC9A 3ELXA 3WJGA 3ZUIA 2RQ0A 2HZRA 2RA6A 1UYOX 3FYFA 4FGIB 3CBSA 5LJGA 1X8UA 2IZFB 4GDAA 1QFVA 2R73A 4ALOA 1VWQB 4NP1A 1LUQA 5KHPA 1BEBA 4YMYA 3TGBA 1T68X 2X8FA 1SWNA 2WWPA 4YVBA 2MJIA 1GT3A 3FIDA 1SWUA 2O62A 4WBKA 5EDBA 2AVIA 1VWMB 3NBXX 3RE5A 4WHIA 3C78X 4GUZA 4IB6A 3C76X 2RCTA 5IXGA 5D48A 1ML7A 1CBSA 1O8VA 1SWLA 2UYWA 1SY2A 2ACPX 2FRSA 3JS1A 4ORSA 3ZZVA 2GTFX 2VDFA 3CBCA 2LBVA 2JGSA 1YWDA 2FLJA 1SWFA 1KL4A 1QABE 1LICA 1TOWA 1YIVA 1ZNKA 1GT5A 2IFBA 2JW1A 2R56A 1GT1A 4JO6A 3NPOA 5FQ8E 2OY7A 1LCVA 3SZJA 1JYDA 1X89A 4IRWA 1RSUB 4ORRA 4CDDA 2IZHB 3WJDA 1MOYA 4I3CA 4CPEA 1LKEA 1CBRA 2DJGA 2RTHB 2RTDB 3STMX 3ZW1A 4DQ4A 3TGCA 1HQPA 3EBKA 1IJ8A 4U3QA 4QGVA 1SY0A 1G7NA 1AB0A 2OVSA 3RBYA 1ICMA 1VWKB 1TW4A 4AYHA 3WXQA 3UEXA 3TF6A 2GTLN 1VWFB 2W2AA 2UZ2A 1SWTA 3U0DA 4GETA 4FBOA 3D95A 1RXHA 3P6HA 1Y9TA 3KFHA 3P02A 2LBAA 5FAZA 2HKDA 4HFOA 1SLEB 3NX1A 2NNQA 2OVEA 2X46A 4YGHA 3H3IA 1AELA 2GH7A 3FEPA 1SWPA 3FIQA 2L67A 3ZI8A 2N93A 1SRFA 4Z2OA 2AF5A 2RTRB 3C77X 4AZRA 3AKMA 4TKJA 1I05A 4IAXA 2X56A 2K62A 3CQNA 2A3FX 3UEUA 5CYBA 4IB8A 1W4TA 3D4RA 3JQOA 4A60A 3FMZA 3PDFA 3VG6A 3WOVA 1R0UA 3PH6A 1SLFB 2FTBA 1QY1A 4CPHA 1GXAA 1MVGA 4YCEA 1KOIA 4TLJA 1N0SA 2FHLA 4ZCBA 1JMXA 4KT5A 5LKFA 1T0VA 4COTA 3JSQA 3FW5A 2NNEA 4B55A 5JD2A 1ADLA 3FA8A 5B27A 4IB7A 5IRUA 4GZVA 4NV7A 4KC7A 1S7DA 2CAMA 3B2LA 4U8UO 3SZHA 2IZAA 2Q2MA 1B0OA 1DFVA 3WYQA 4ZJ0A 4OS3A 3HOEA 3EMMA 1SWKA 1H91A 2K23A 4KH8A 2Y32A 4MEEA 5IO6A 4O49A 1SY1A 1RXJA 1JJXA 4BCSA 1VWEB 1MUPA 1LPJA 3P6GA 1EALA 2OFRX 2AKQA 2JU3A 3S60A 5LJHA 1YWBA 2Z4IA 5IO7A 1KQWA 1LFOA 3MBTA 1E02A 1YP7A 2I5ZO 4K19A 3D9WA 5CE4A 1QY0A 1SXUA 3HPEA 1VWRB 2IZKA 3APVA 1E2TA 4DCBA 1BSOA 2OFMX 3RDQA 4Y0SA 4YFPA 3ZW2A 2NP1A 3APWA 4QYNA 4BX5B 4GJSA 4LZUA 3FA7A 3AUMO 4HPDA 4YFQA 3BDRA 3F9DA 5H9AA 3DTQA 5LJCA 1GT4A 1JMZA 3HTYA 3T6FA 1FELA 3VE1A 4U46A 4FQBB 4NW4A 2IZIA 2AT5X 3S5VA 4ZHFA 2WEWA 4D6BA 1RLBE 3VHMA 1LIFA 5HA0A 3VHIA 1LF7A 3WJCA 3WZNA 4BJ8A 1S44A 2KT4B 3WJEA 1GGLA 1MX7A 2VFBA 1UREA 4ALBA 1IW2A 1B56A 1X8QA 1SRIA 2BC3A 3E3CA 4ZGFA 4LZVA 4Y0QA 5KIDA 3RKGA 4BX6A 1AVEA 3EW1A 2ZAIA 3N91A 1EPBA 3P6DA 5D8JA 1Y53X 1NQMA 2QO5A 3I0AA 4GD9A 2RTQB 2X45A 1E00A 4FBRA 1BRQA 1A2DA 1PBOA 2VFCA 4M7MA 4A1HA 4AZPA 4CDEA 4PJ2A 2OL8O 1HMTA 5H9KA 4TNNA 2Y3EA 4ZFXA 1VWOB 3NQ3A 5B5GA 3TZSA 3SAOA 4QZTA 2RTMA 4IAWA 3D97A 3AEHA 5AQ6A 5HZ5A 2HMBA 5HZ8A 4MVEA 4MVKA 1P6PA 1KZXA 4NNTA 2RTFB 4EQAC 2RTCB 4CDCA 1KFFA 5F1EA 4AW8A 4BVMA 1ZNGA 1ACDA 1GX3A 3HWGA 3NX2A 4YCHA 3LTWA 2AT0X 3SZIA 4DMOA 4MIRA 2IZBA 3NQKA 3P24A 1B8EA 3WBGA 1KGLA 3ZQ3A 1X8NA 1NQNA 1SWOA 2JMBA 5HBSA 5DPQA 2FGSA 1FENA 4ZGUA 3KZAA 3PEDA 4YDAA 1VWLB 1K24A 1Z24A 1NP4A 4BQUA 2RTBB 1NBXA 5L8IA 1BBPA 4ORYA 4QAEA 1YWCA 4Y59A 4LQZA 1HMRA 1KT6A 2L9CA 2WSJA 2CM9A 4O4SA 1DZKA 1LNMA 4AZQA 3EYCA 4YH0A 5FQ7E 1N9YA 5H9LA 4CSBA 1SRHA 2RCQA 4I95A 2CBSA 3CQRA 1SRJA 3ZW0B 4GDZA 3LHNA 1DF8A 4A1YA 1W6FA 1CRBA 3MVFA 2R74A 2IJAA 3CR6A 2E4JA 1N9MA 5HCCC 4BGFA 5B10O 1VWPB 2ALLX 3FR5A 3KQ0A 2RTGB 3ELZA 4OEMA 3AKNA 3T1DA 4XMCA 1DC9A 4GGZA 2OY1O 4A8ZA 2YMSA 1STRB 1WUBA 3UAQA 1BRPA 1EQDA 2DM5A 1NDJA 4GU8A 5K67A 1U18A 2IZLB 1JZUA 1DV9A 2FS6A 3MM0A 2CBRA 4YKMA 5HZ9A 1VWAB 3BU1A 3I17A 4IMOA 2QM9A 4NYQA 4LKTA 1AVDA 1OEEA 1W5RA 2C1SA 5K06A 1ZNEA 1D3SA 5AJCA 3STKA 1X8PA 1Y55X 1OPAA 2QOSC 3VPJE 4GRJA 4U8UN 2ANSA 3Q6LA 2ZSCA 5B3MO 5BVTA 1EIIA 4INNA 1EXSA 1CBIA 1FE3A 4HPAA 2HLVA 4JNJA 1OSPO 4Z2VA 2OF9A 5F7GA 1KL3A 1FTPA 1UZ2X 2Q2PA 1HY2A 2MM3A 3T2WA 4M6SA 1STSB 4BX6B 1HXLA 1T8VA 5H9NA 2X34A 4NLJA 1IKJA 3S5XA 4UU2A 3ZUOA 5B2AO 3SOTA 4I6SA 5F6BA 3OD9A 2POAA 4EKVA 1DF3A 3HOLA 1LDOA 4RUUA 3RY1A 5CSEA 3IFBA 1I4UA 2OZQA 4EEJA 2BS6A 1UYNX 2FR3A 1IFCA 5EEEA 2BHVA 2KW1A 4I3BA 1JBHA 4GNWA 2GJ5A 3B2IA 4XMEA 3PECA 4BOEA 5DG4A 3P6EA 3SLTA 2IZJA 1NP1A 2MHDA 2PY1A 5HAEA 4I9RA 2HYSA 1GX9A 4QGWA 2L5PA 1SWEA 2ZAGA 3MG5A 4XMGA 2A13A 1FDQA 3HWEA 1GX8A 5BYPA 2A5CA 2OL6O 4ML7B 1OPBA 4QGXA 5B11O 1PEEA 1PBYA 1CJ5A 2FWVA 2PI3O 1VWBB 1RSTB 1HQQA 3U03A 2M4LA 1ALBA 2F73A 1GM6A 4O4XA 3BLGA 4YKOA 2BLGA 3P6FA 1I06A 4U9CA 3CWKA 1I9HA 1WBIA 5CHKA 2Q39A 4Z6JA 3BY0A 5HZ6A 5LJEA 1SXWA 5AJBA 5D45A 4IABA 4CPFA 1KL5A 3RDMA 3FR4A 2OFBA 1HN2A 4ZH6A 1ZNDA 2ASNX 2AT8X 2OYBO 3B2JA 5L8NA 4CPIA 5LKEA 4ORUA 4ES7A 4O4UA 4YBPA 5HCDC 3V8UA 2RTOB 5B5FA 2X8SA 4O3YA 4YBUA 3ZW1B 4QZUA 3FENA 2A2UA 2BT9A 2JN3A 1IKEA 4N7CA 5EDCA 4CK4A 4EDEA 1Y0GA 3BU9A 3BRNA 3KFIA 3RE6A 5L8OA 3NR3A 5EEDA 3UEWA 5FENA 3FW4A 2GTLM 4R0BA 1RXKA 2LFOA 1A57A 1X71A 3KFGA 2A0AA 2MO5A 5EZ2A 1I04A 3T2XA 1I78A 3RDSA 4OMXA 1X8OA 4ORXA 5D47A 1LCWA 1BSQA 2OY5O 4DQ3A 4L1NA 5LJBA 1SLDB 3Q34A 2C1QA 3PPTA 4O3ZA 1EI5A 2WR6A 5IO5A 4I60A 4XMFA 3VHHA 3OE3A 4EFGA 2XSTA 2CM4A 1VWIB 1NGLA 4ZHDA 2ACOA 1YUPA 4IBAA 4CPHB 5HWZA 5F2BA 3CKGA 2IZEB 1SWCA 3VGWA 4AZMA 2JOZA 1LDQA 1DZMA 1G85A 1AQBA 2QOMA 3G7XA 4ID2A 4JHQA 1KZWA 2HNXA 1VWGB 1ERXA 1VYGA 3O19A 3O22A 4MISA 2A8GA 4ZR2A 3F6ZB 2RN4A 5HZQA 5HTDA 2WUTA 5C0NA 2JU8A 3VG7A 1LIDA 1FEMA 4GNYA 1RBPA 2C4IA 3FR2A 2RTEB 4O3XB 1BJ7A 1LELA 2I5VO 4O4OA 4I3DA 2RTIB 1EPAA 5BVQA 2RTPB 3PH5A 2RTJA 1G74A 1ICNA 2Z4HA 4KIIA 1U0XA 4ARHA 1ZNLA 3BX7A 3APUA 1OEJA 1GKAA 3PQUA 2AH7X 4D6AA 4XMHA 4BX5A 3P6CA 2IZGB 1PM1X 1BSYA 3OJYC 4BBOA 1SWAA 3PK2A 4QRLA 5B29A 4Y5DA 1A18A 2CZUA 4OELA 3VG2A 1MK5A 2AMMX 2MF6A 4OS8A 4BX7A 5AEOA 3K3LA 1N4JA 3NQ9A 3VG3A 1QG5A 3B2KA 4NV8A 3QQ2A 1O1UA 2Y3FA 3RY2A 5KICA 3B2HA 3RZYA 5LJDA 3TGAA 2X32A 2FKJA 5F6ZA 3EW2A 2G78A 1SXXA 1VYFA 3DSZA 4YDBA 5H8TA 4CV7A 3LV4A 4ZHHA 1SWBA 3EC5A 3EM0A 2P8GA 4HPBA 2WQ9A 5L3YA 1JQPA 3RDOA 1S2PA 1D2UA 1VWNB 1HBPA 3SLJA 1N43A 4EXZA 1CBQA 2IZDB 2Q9SA 2YG2A 3S26A 1SXYA 4ORWA 3WZQA 2G8CO 2KTSA 2G79A 5HTEA
chains in the Genus database with same CATH topology
1CPJA 2OULA 3HD3A 1ITOA 4C5PA 3KWBX 1YALA 4HWYA 2FQ9A 3BOWA 2BSZA 1U9QX 1ATKA 1TL9A 4PI3A 4CDEB 2ARYA 4W5BA 5PADA 3BCNA 1PCIA 4YYSA 1U9XA 4CDCB 1BQIA 1YK8A 3NHEA 2R9CA 4P6GA 1KFUL 2Y5BA 1EWLA 3D6SA 1VJVA 7PCKA 5JA7A 4YVAA 4QBBA 1Y4HA 1QDQA 2FYEA 4MZSA 4QH6A 3MHSA 3M99A 3CH3X 4I05A 3K8UA 1EF7A 4Q8HA 1POPA 3P5VA 1CTEA 1ME3A 1BY8A 1Q6KA 2FRQA 1DF0A 2HD5A 3TNXA 2DZYA 2NQDB 1BGOA 2B1MA 3F5VA 3WXGA 2YJBA 1GECE 1TLOA 3LXSA 4PADA 3KSEA 2VHSA 5K16A 5JH3A 4DMXA 2IPPB 3N3KA 1PIPA 3CBJA 4I04A 4BPVA 1MIRA 3H8BA 2YJ9A 2F7DA 2BDLA 1EWOA 2AS8A 2AYOA 1THEA 1KXRA 3WXFA 1NB5A 4X6HA 1GCBA 2XU5A 3IMAA 1NLJA 1HUCB 1STFE 2DCDA 2VHFA 4BS5A 4Q8GA 3HHIA 2R9MA 3P5UA 1DEUA 4AXMA 4GUZA 3OISA 2JQGR 2PBHA 1K3BB 5CVMA 4CDFB 3IOQA 1O0EA 3S3QA 1SP4B 1KFXL 1AU3A 3N3GA 1Y08A 2OZ2A 3KKUA 3ZUAA 1TU6A 4W5CA 1XKGA 2YJ2A 2G7YA 4FIPA 1CJLA 3AI8A 2DJFB 3IV2A 2FO5A 3BWKA 1A6RA 4I07A 2DCCA 5EF4A 3OF9A 3V6CA 1W4TA 2AUZA 2YJCA 4YYQA 3PDFA 1MDWA 2AIMA 3PBHA 3MHHA 3WXEA 3IUTA 1CB5A 1BP4A 4P6EA 4PP2E 1CQDA 4B55A 1AU0A 1YK7A 4NV7A 3H6SA 1PADA 2R9NA 5EGWA 3P5WA 2PREA 1M6DA 2OP3A 1S4VA 5CVOB 1GMYA 4YYWA 3V6EA 4QRVA 3D9WA 1NL6A 1PPOA 1E2TA 1QMYA 1MHWA 4FJCA 2R9OA 1F29A 1EWMA 2BDZA 2IBIA 2DC7A 2E03A 4CDDB 2VFBA 4QRGA 2DJGB 2HH5A 1U5IA 4XUIA 4KLBA 1AECA 5J94A 4N79A 2YJ8A 1AYVA 2P0RA 4BSQA 3BPFA 4MSXA 2VFCA 2E00A 1CV8A 3LFYA 2XU3A 1AYUA 2P7UA 1U9WA 3PNRA 3K24A 2G6DA 3BC3A 3K9MA 3C9EA 1YVBA 1FH0A 3E1ZB 1GX3A 1GLOA 5CHVA 3LTWA 3H89A 3DF0A 3IEJA 3S3RA 4G54A 4QRXA 4MZOA 1VSNA 4RY2A 4CZWA 1PBHA 2CB5A 4FK5A 4N4ZA 2AYNA 1W6FA 1ICFA 2G8JA 2XU1A 3QSDA 3RVWA 4BGFA 3RVVA 2ACTA 1F2AA 3OVZA 1QXPA 4OEMA 4DMYA 1MS6A 2F1GA 1PPDA 2AU1A 2DC6A 1W5RA 2AVWA 2HHNA 2G8EA 2NQGA 2H7JA 1KHPA 2DC8A 1ME4A 1X9YA 3QJ3A 3H7DA 5CVNB 4YV8A 2Y6EA 2DCBA 3U8EA 3HWNA 3RVXA 2XU4A 3BPMA 3MTNA 2JQFR 3H8CA 4YYUA 3CH2X 3OVXA 2P86A 3KW9A 8PCHA 1PXVA 1CVZA 4W4UA 4XR7A 3CBKA 2NQAA 3HHAA 2FRAA 4X6IA 2C0YA 2E01A 4ZUXU 4YYRA 1AU2A 5A24A 3MORA 1F2CA 4AXLA 4PP1A 2R9FA 2DC9A 4BQVA 1YT7A 3N4CA 3B79A 3ERVA 4WA6A 1PE6A 1SNKA 4N8WA 3KWZA 2FT2A 1EWPA 1CS8A 1PPNA 4K7CA 2GFOA 3KFQA 5FPWA 3USVA 4YYVA 4X6JA 3OF8A 6PADA 1ZIVA 3I3TA 2AUXA 2E02A 3QT4A 2ATOA 3I06A 1PPPA 3KX1A 1QOLA 2CIOA 2R6NA 2PNSA 3F75A 1MEMA 1NQCA 3PW3A 1AIMA 2O6XA 2FUDA 1CSBB 1NB3A 1AYWA 3O0UA 2HXZA 2B1NA 2DCAA 4BS6A 3IHPA 1ZCMA 4OELA 3O1GA 2FTDA 1IWDA 4NV8A 5CHTA 2GHUA 1AU4A 1U9VA 1KHQA 5F02A 2PADA 1NPZA 1F2BA 1JQPA 3GCBA 1MEGA 2DZZA 2NQIA 9PAPA 3P5XA 2WBFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSZ A;  4NV7 A;  1W6F A;  1GX3 A;  3D9W A;  4NV8 A;  2VFB A;  2VFC A;  4GUZ A;  4C5P A;  1E2T A;  1W4T A;  4B55 A;  3LTW A;  4BGF A;  1W5R A; 
#chains in the Genus database with same CATH topology
 3IA8 A;  4IMN A;  4Y0R A;  3WZO A;  1KQX A;  1VWJ B;  1OBP A;  3RDU A;  3D96 A;  4C5P A;  3FDC A;  2XKL A;  3OBL A;  4L3R A;  4TKH A;  4UU3 A;  3X00 A;  4PSQ A;  5EPQ A;  1O1V A;  1E06 A;  4AZO A;  4MVL A;  1BWY A;  1EW3 A;  3L4R A;  5LJK A;  1PMP A;  2F01 A;  1HBQ A;  2FKG A;  1SA8 A;  2WQA E;  3GAQ A;  4GK9 A;  4NNS A;  4NYR A;  4Y0P A;  3SLO A;  4KC8 A;  1ZRY A;  1MEP A;  1A3Y A;  3QKG A;  4HWM A;  2BSZ A;  2GTL O;  2HZQ A;  1JIW I;  3F8A A;  4I9S A;  1ZNH A;  4O9S A;  4TJZ A;  3WZP A;  2OVA A;  5JR8 A;  4RUN A;  2F09 A;  3FA6 A;  1LIB A;  3ZWE A;  1L6M A;  1Y9L A;  4GE1 A;  2RTN B;  1KT7 A;  3RWX A;  1LIE A;  4GH7 A;  3WJF A;  1SRE A;  1SWH A;  1JYJ A;  1U17 A;  2BS5 A;  3CKF A;  3RDX A;  5BVS A;  3VG5 A;  1OEK A;  1BLR A;  4GGR A;  2PFR A;  1DZP A;  1K3B A;  1JV4 A;  1OBU A;  2GC9 A;  1PTS A;  4O3W A;  3LNB A;  2OL7 A;  3VE2 A;  4CDF A;  2OFA A;  1QWD A;  1VWC B;  4XMD A;  1IFB A;  1AVG I;  4OKA A;  4OMW A;  1ERB A;  3U9P C;  3BSZ E;  3NP1 A;  1SWD A;  2OF8 A;  4ON1 A;  3FEL A;  5FFH A;  4WFV A;  1OBQ A;  2W2B A;  1YWA A;  2MWH A;  3WVM A;  4JGL A;  4IB9 A;  2LA7 A;  2FR2 A;  1VPR A;  1TXL A;  3HWF A;  2LKK A;  5IRA A;  4WFU A;  3HWD A;  3UEV A;  2FHN X;  3T6L A;  2IZC B;  5F58 A;  4ODD A;  4MVI A;  4HPC A;  1LCZ A;  3ZW0 A;  3HK1 A;  4Z2P A;  1FJ1 E;  2L68 A;  2X4M A;  1XKI A;  2RD7 C;  3FEK A;  3PQS A;  5FQ6 E;  2OVD A;  4YGZ A;  4QNI A;  1XCA A;  1EUO A;  3PP6 A;  3FLL A;  1TOU A;  3BX8 A;  1IIU A;  3MX7 A;  1SMP I;  2DJF A;  3KVN A;  1GKA B;  1MDC A;  1VWD B;  1SY3 A;  2NND A;  1SLG B;  4OS0 A;  4QYP A;  1BM5 A;  2KTD A;  1DZJ A;  2QO4 A;  2A2G A;  2RTL A;  1HXZ A;  1MX8 A;  2QMI A;  4FBV A;  2RTA A;  5K68 A;  3RSW A;  4TQ2 A;  2G7B A;  4ZHC A;  2LB6 A;  2G5L A;  4ZH9 A;  4BX7 B;  3VU1 A;  2X55 A;  4Z28 A;  3STN A;  4GGT A;  1SWR A;  1SWS A;  1Y52 X;  1QFT A;  1N7Y A;  1SWG A;  4GKC A;  4AZN A;  4DNE A;  1KT5 A;  1QY2 A;  2FS7 A;  3BS2 A;  2AT6 X;  3CMP A;  1SRG A;  1SWJ A;  2X8T A;  4ZHG A;  4TKB A;  5HA1 A;  3VG4 A;  1SWQ A;  3O2Y A;  1JJJ A;  4KCA A;  1VYO A;  4YFR A;  1TVQ A;  2CZT A;  2AT3 X;  2W2F A;  2FT9 A;  2QCB A;  1KXO A;  4YGG A;  3EBW A;  3GE2 A;  1QQS A;  4QQ1 A;  1JJU A;  1G5W A;  3APX A;  3NAD A;  5HCE C;  2JU7 A;  4Z27 A;  4GJV A;  2RTK A;  4N7D A;  2PQT A;  1MM9 A;  2AL0 X;  3FA9 A;  1EIO A;  1HMS A;  1KT4 A;  2WPU A;  2EU7 X;  2OY8 A;  1RAV A;  4U8U M;  4LKP A;  1E5P A;  5IRW A;  3WYP A;  1B4M A;  4NLI A;  3WJB A;  2A5B A;  2WEX A;  1STP A;  2Q4N A;  2KD2 A;  5D4A A;  2QO6 A;  1YP6 A;  1VWH B;  3KFF A;  1KT3 A;  1NC9 A;  3ELX A;  3WJG A;  3ZUI A;  2RQ0 A;  2HZR A;  2RA6 A;  1UYO X;  3FYF A;  4FGI B;  3CBS A;  5LJG A;  1X8U A;  2IZF B;  4GDA A;  1QFV A;  2R73 A;  4ALO A;  1VWQ B;  4NP1 A;  1LUQ A;  5KHP A;  1BEB A;  4YMY A;  3TGB A;  1T68 X;  2X8F A;  1SWN A;  2WWP A;  4YVB A;  2MJI A;  1GT3 A;  3FID A;  1SWU A;  2O62 A;  4WBK A;  5EDB A;  2AVI A;  1VWM B;  3NBX X;  3RE5 A;  4WHI A;  3C78 X;  4GUZ A;  4IB6 A;  3C76 X;  2RCT A;  5IXG A;  5D48 A;  1ML7 A;  1CBS A;  1O8V A;  1SWL A;  2UYW A;  1SY2 A;  2ACP X;  2FRS A;  3JS1 A;  4ORS A;  3ZZV A;  2GTF X;  2VDF A;  3CBC A;  2LBV A;  2JGS A;  1YWD A;  2FLJ A;  1SWF A;  1KL4 A;  1QAB E;  1LIC A;  1TOW A;  1YIV A;  1ZNK A;  1GT5 A;  2IFB A;  2JW1 A;  2R56 A;  1GT1 A;  4JO6 A;  3NPO A;  5FQ8 E;  2OY7 A;  1LCV A;  3SZJ A;  1JYD A;  1X89 A;  4IRW A;  1RSU B;  4ORR A;  4CDD A;  2IZH B;  3WJD A;  1MOY A;  4I3C A;  4CPE A;  1LKE A;  1CBR A;  2DJG A;  2RTH B;  2RTD B;  3STM X;  3ZW1 A;  4DQ4 A;  3TGC A;  1HQP A;  3EBK A;  1IJ8 A;  4U3Q A;  4QGV A;  1SY0 A;  1G7N A;  1AB0 A;  2OVS A;  3RBY A;  1ICM A;  1VWK B;  1TW4 A;  4AYH A;  3WXQ A;  3UEX A;  3TF6 A;  2GTL N;  1VWF B;  2W2A A;  2UZ2 A;  1SWT A;  3U0D A;  4GET A;  4FBO A;  3D95 A;  1RXH A;  3P6H A;  1Y9T A;  3KFH A;  3P02 A;  2LBA A;  5FAZ A;  2HKD A;  4HFO A;  1SLE B;  3NX1 A;  2NNQ A;  2OVE A;  2X46 A;  4YGH A;  3H3I A;  1AEL A;  2GH7 A;  3FEP A;  1SWP A;  3FIQ A;  2L67 A;  3ZI8 A;  2N93 A;  1SRF A;  4Z2O A;  2AF5 A;  2RTR B;  3C77 X;  4AZR A;  3AKM A;  4TKJ A;  1I05 A;  4IAX A;  2X56 A;  2K62 A;  3CQN A;  2A3F X;  3UEU A;  5CYB A;  4IB8 A;  1W4T A;  3D4R A;  3JQO A;  4A60 A;  3FMZ A;  3PDF A;  3VG6 A;  3WOV A;  1R0U A;  3PH6 A;  1SLF B;  2FTB A;  1QY1 A;  4CPH A;  1GXA A;  1MVG A;  4YCE A;  1KOI A;  4TLJ A;  1N0S A;  2FHL A;  4ZCB A;  1JMX A;  4KT5 A;  5LKF A;  1T0V A;  4COT A;  3JSQ A;  3FW5 A;  2NNE A;  4B55 A;  5JD2 A;  1ADL A;  3FA8 A;  5B27 A;  4IB7 A;  5IRU A;  4GZV A;  4NV7 A;  4KC7 A;  1S7D A;  2CAM A;  3B2L A;  4U8U O;  3SZH A;  2IZA A;  2Q2M A;  1B0O A;  1DFV A;  3WYQ A;  4ZJ0 A;  4OS3 A;  3HOE A;  3EMM A;  1SWK A;  1H91 A;  2K23 A;  4KH8 A;  2Y32 A;  4MEE A;  5IO6 A;  4O49 A;  1SY1 A;  1RXJ A;  1JJX A;  4BCS A;  1VWE B;  1MUP A;  1LPJ A;  3P6G A;  1EAL A;  2OFR X;  2AKQ A;  2JU3 A;  3S60 A;  5LJH A;  1YWB A;  2Z4I A;  5IO7 A;  1KQW A;  1LFO A;  3MBT A;  1E02 A;  1YP7 A;  2I5Z O;  4K19 A;  3D9W A;  5CE4 A;  1QY0 A;  1SXU A;  3HPE A;  1VWR B;  2IZK A;  3APV A;  1E2T A;  4DCB A;  1BSO A;  2OFM X;  3RDQ A;  4Y0S A;  4YFP A;  3ZW2 A;  2NP1 A;  3APW A;  4QYN A;  4BX5 B;  4GJS A;  4LZU A;  3FA7 A;  3AUM O;  4HPD A;  4YFQ A;  3BDR A;  3F9D A;  5H9A A;  3DTQ A;  5LJC A;  1GT4 A;  1JMZ A;  3HTY A;  3T6F A;  1FEL A;  3VE1 A;  4U46 A;  4FQB B;  4NW4 A;  2IZI A;  2AT5 X;  3S5V A;  4ZHF A;  2WEW A;  4D6B A;  1RLB E;  3VHM A;  1LIF A;  5HA0 A;  3VHI A;  1LF7 A;  3WJC A;  3WZN A;  4BJ8 A;  1S44 A;  2KT4 B;  3WJE A;  1GGL A;  1MX7 A;  2VFB A;  1URE A;  4ALB A;  1IW2 A;  1B56 A;  1X8Q A;  1SRI A;  2BC3 A;  3E3C A;  4ZGF A;  4LZV A;  4Y0Q A;  5KID A;  3RKG A;  4BX6 A;  1AVE A;  3EW1 A;  2ZAI A;  3N91 A;  1EPB A;  3P6D A;  5D8J A;  1Y53 X;  1NQM A;  2QO5 A;  3I0A A;  4GD9 A;  2RTQ B;  2X45 A;  1E00 A;  4FBR A;  1BRQ A;  1A2D A;  1PBO A;  2VFC A;  4M7M A;  4A1H A;  4AZP A;  4CDE A;  4PJ2 A;  2OL8 O;  1HMT A;  5H9K A;  4TNN A;  2Y3E A;  4ZFX A;  1VWO B;  3NQ3 A;  5B5G A;  3TZS A;  3SAO A;  4QZT A;  2RTM A;  4IAW A;  3D97 A;  3AEH A;  5AQ6 A;  5HZ5 A;  2HMB A;  5HZ8 A;  4MVE A;  4MVK A;  1P6P A;  1KZX A;  4NNT A;  2RTF B;  4EQA C;  2RTC B;  4CDC A;  1KFF A;  5F1E A;  4AW8 A;  4BVM A;  1ZNG A;  1ACD A;  1GX3 A;  3HWG A;  3NX2 A;  4YCH A;  3LTW A;  2AT0 X;  3SZI A;  4DMO A;  4MIR A;  2IZB A;  3NQK A;  3P24 A;  1B8E A;  3WBG A;  1KGL A;  3ZQ3 A;  1X8N A;  1NQN A;  1SWO A;  2JMB A;  5HBS A;  5DPQ A;  2FGS A;  1FEN A;  4ZGU A;  3KZA A;  3PED A;  4YDA A;  1VWL B;  1K24 A;  1Z24 A;  1NP4 A;  4BQU A;  2RTB B;  1NBX A;  5L8I A;  1BBP A;  4ORY A;  4QAE A;  1YWC A;  4Y59 A;  4LQZ A;  1HMR A;  1KT6 A;  2L9C A;  2WSJ A;  2CM9 A;  4O4S A;  1DZK A;  1LNM A;  4AZQ A;  3EYC A;  4YH0 A;  5FQ7 E;  1N9Y A;  5H9L A;  4CSB A;  1SRH A;  2RCQ A;  4I95 A;  2CBS A;  3CQR A;  1SRJ A;  3ZW0 B;  4GDZ A;  3LHN A;  1DF8 A;  4A1Y A;  1W6F A;  1CRB A;  3MVF A;  2R74 A;  2IJA A;  3CR6 A;  2E4J A;  1N9M A;  5HCC C;  4BGF A;  5B10 O;  1VWP B;  2ALL X;  3FR5 A;  3KQ0 A;  2RTG B;  3ELZ A;  4OEM A;  3AKN A;  3T1D A;  4XMC A;  1DC9 A;  4GGZ A;  2OY1 O;  4A8Z A;  2YMS A;  1STR B;  1WUB A;  3UAQ A;  1BRP A;  1EQD A;  2DM5 A;  1NDJ A;  4GU8 A;  5K67 A;  1U18 A;  2IZL B;  1JZU A;  1DV9 A;  2FS6 A;  3MM0 A;  2CBR A;  4YKM A;  5HZ9 A;  1VWA B;  3BU1 A;  3I17 A;  4IMO A;  2QM9 A;  4NYQ A;  4LKT A;  1AVD A;  1OEE A;  1W5R A;  2C1S A;  5K06 A;  1ZNE A;  1D3S A;  5AJC A;  3STK A;  1X8P A;  1Y55 X;  1OPA A;  2QOS C;  3VPJ E;  4GRJ A;  4U8U N;  2ANS A;  3Q6L A;  2ZSC A;  5B3M O;  5BVT A;  1EII A;  4INN A;  1EXS A;  1CBI A;  1FE3 A;  4HPA A;  2HLV A;  4JNJ A;  1OSP O;  4Z2V A;  2OF9 A;  5F7G A;  1KL3 A;  1FTP A;  1UZ2 X;  2Q2P A;  1HY2 A;  2MM3 A;  3T2W A;  4M6S A;  1STS B;  4BX6 B;  1HXL A;  1T8V A;  5H9N A;  2X34 A;  4NLJ A;  1IKJ A;  3S5X A;  4UU2 A;  3ZUO A;  5B2A O;  3SOT A;  4I6S A;  5F6B A;  3OD9 A;  2POA A;  4EKV A;  1DF3 A;  3HOL A;  1LDO A;  4RUU A;  3RY1 A;  5CSE A;  3IFB A;  1I4U A;  2OZQ A;  4EEJ A;  2BS6 A;  1UYN X;  2FR3 A;  1IFC A;  5EEE A;  2BHV A;  2KW1 A;  4I3B A;  1JBH A;  4GNW A;  2GJ5 A;  3B2I A;  4XME A;  3PEC A;  4BOE A;  5DG4 A;  3P6E A;  3SLT A;  2IZJ A;  1NP1 A;  2MHD A;  2PY1 A;  5HAE A;  4I9R A;  2HYS A;  1GX9 A;  4QGW A;  2L5P A;  1SWE A;  2ZAG A;  3MG5 A;  4XMG A;  2A13 A;  1FDQ A;  3HWE A;  1GX8 A;  5BYP A;  2A5C A;  2OL6 O;  4ML7 B;  1OPB A;  4QGX A;  5B11 O;  1PEE A;  1PBY A;  1CJ5 A;  2FWV A;  2PI3 O;  1VWB B;  1RST B;  1HQQ A;  3U03 A;  2M4L A;  1ALB A;  2F73 A;  1GM6 A;  4O4X A;  3BLG A;  4YKO A;  2BLG A;  3P6F A;  1I06 A;  4U9C A;  3CWK A;  1I9H A;  1WBI A;  5CHK A;  2Q39 A;  4Z6J A;  3BY0 A;  5HZ6 A;  5LJE A;  1SXW A;  5AJB A;  5D45 A;  4IAB A;  4CPF A;  1KL5 A;  3RDM A;  3FR4 A;  2OFB A;  1HN2 A;  4ZH6 A;  1ZND A;  2ASN X;  2AT8 X;  2OYB O;  3B2J A;  5L8N A;  4CPI A;  5LKE A;  4ORU A;  4ES7 A;  4O4U A;  4YBP A;  5HCD C;  3V8U A;  2RTO B;  5B5F A;  2X8S A;  4O3Y A;  4YBU A;  3ZW1 B;  4QZU A;  3FEN A;  2A2U A;  2BT9 A;  2JN3 A;  1IKE A;  4N7C A;  5EDC A;  4CK4 A;  4EDE A;  1Y0G A;  3BU9 A;  3BRN A;  3KFI A;  3RE6 A;  5L8O A;  3NR3 A;  5EED A;  3UEW A;  5FEN A;  3FW4 A;  2GTL M;  4R0B A;  1RXK A;  2LFO A;  1A57 A;  1X71 A;  3KFG A;  2A0A A;  2MO5 A;  5EZ2 A;  1I04 A;  3T2X A;  1I78 A;  3RDS A;  4OMX A;  1X8O A;  4ORX A;  5D47 A;  1LCW A;  1BSQ A;  2OY5 O;  4DQ3 A;  4L1N A;  5LJB A;  1SLD B;  3Q34 A;  2C1Q A;  3PPT A;  4O3Z A;  1EI5 A;  2WR6 A;  5IO5 A;  4I60 A;  4XMF A;  3VHH A;  3OE3 A;  4EFG A;  2XST A;  2CM4 A;  1VWI B;  1NGL A;  4ZHD A;  2ACO A;  1YUP A;  4IBA A;  4CPH B;  5HWZ A;  5F2B A;  3CKG A;  2IZE B;  1SWC A;  3VGW A;  4AZM A;  2JOZ A;  1LDQ A;  1DZM A;  1G85 A;  1AQB A;  2QOM A;  3G7X A;  4ID2 A;  4JHQ A;  1KZW A;  2HNX A;  1VWG B;  1ERX A;  1VYG A;  3O19 A;  3O22 A;  4MIS A;  2A8G A;  4ZR2 A;  3F6Z B;  2RN4 A;  5HZQ A;  5HTD A;  2WUT A;  5C0N A;  2JU8 A;  3VG7 A;  1LID A;  1FEM A;  4GNY A;  1RBP A;  2C4I A;  3FR2 A;  2RTE B;  4O3X B;  1BJ7 A;  1LEL A;  2I5V O;  4O4O A;  4I3D A;  2RTI B;  1EPA A;  5BVQ A;  2RTP B;  3PH5 A;  2RTJ A;  1G74 A;  1ICN A;  2Z4H A;  4KII A;  1U0X A;  4ARH A;  1ZNL A;  3BX7 A;  3APU A;  1OEJ A;  1GKA A;  3PQU A;  2AH7 X;  4D6A A;  4XMH A;  4BX5 A;  3P6C A;  2IZG B;  1PM1 X;  1BSY A;  3OJY C;  4BBO A;  1SWA A;  3PK2 A;  4QRL A;  5B29 A;  4Y5D A;  1A18 A;  2CZU A;  4OEL A;  3VG2 A;  1MK5 A;  2AMM X;  2MF6 A;  4OS8 A;  4BX7 A;  5AEO A;  3K3L A;  1N4J A;  3NQ9 A;  3VG3 A;  1QG5 A;  3B2K A;  4NV8 A;  3QQ2 A;  1O1U A;  2Y3F A;  3RY2 A;  5KIC A;  3B2H A;  3RZY A;  5LJD A;  3TGA A;  2X32 A;  2FKJ A;  5F6Z A;  3EW2 A;  2G78 A;  1SXX A;  1VYF A;  3DSZ A;  4YDB A;  5H8T A;  4CV7 A;  3LV4 A;  4ZHH A;  1SWB A;  3EC5 A;  3EM0 A;  2P8G A;  4HPB A;  2WQ9 A;  5L3Y A;  1JQP A;  3RDO A;  1S2P A;  1D2U A;  1VWN B;  1HBP A;  3SLJ A;  1N43 A;  4EXZ A;  1CBQ A;  2IZD B;  2Q9S A;  2YG2 A;  3S26 A;  1SXY A;  4ORW A;  3WZQ A;  2G8C O;  2KTS A;  2G79 A;  5HTE A; 
#chains in the Genus database with same CATH homology
 1CPJ A;  2OUL A;  3HD3 A;  1ITO A;  4C5P A;  3KWB X;  1YAL A;  4HWY A;  2FQ9 A;  3BOW A;  2BSZ A;  1U9Q X;  1ATK A;  1TL9 A;  4PI3 A;  4CDE B;  2ARY A;  4W5B A;  5PAD A;  3BCN A;  1PCI A;  4YYS A;  1U9X A;  4CDC B;  1BQI A;  1YK8 A;  3NHE A;  2R9C A;  4P6G A;  1KFU L;  2Y5B A;  1EWL A;  3D6S A;  1VJV A;  7PCK A;  5JA7 A;  4YVA A;  4QBB A;  1Y4H A;  1QDQ A;  2FYE A;  4MZS A;  4QH6 A;  3MHS A;  3M99 A;  3CH3 X;  4I05 A;  3K8U A;  1EF7 A;  4Q8H A;  1POP A;  3P5V A;  1CTE A;  1ME3 A;  1BY8 A;  1Q6K A;  2FRQ A;  1DF0 A;  2HD5 A;  3TNX A;  2DZY A;  2NQD B;  1BGO A;  2B1M A;  3F5V A;  3WXG A;  2YJB A;  1GEC E;  1TLO A;  3LXS A;  4PAD A;  3KSE A;  2VHS A;  5K16 A;  5JH3 A;  4DMX A;  2IPP B;  3N3K A;  1PIP A;  3CBJ A;  4I04 A;  4BPV A;  1MIR A;  3H8B A;  2YJ9 A;  2F7D A;  2BDL A;  1EWO A;  2AS8 A;  2AYO A;  1THE A;  1KXR A;  3WXF A;  1NB5 A;  4X6H A;  1GCB A;  2XU5 A;  3IMA A;  1NLJ A;  1HUC B;  1STF E;  2DCD A;  2VHF A;  4BS5 A;  4Q8G A;  3HHI A;  2R9M A;  3P5U A;  1DEU A;  4AXM A;  4GUZ A;  3OIS A;  2JQG R;  2PBH A;  1K3B B;  5CVM A;  4CDF B;  3IOQ A;  1O0E A;  3S3Q A;  1SP4 B;  1KFX L;  1AU3 A;  3N3G A;  1Y08 A;  2OZ2 A;  3KKU A;  3ZUA A;  1TU6 A;  4W5C A;  1XKG A;  2YJ2 A;  2G7Y A;  4FIP A;  1CJL A;  3AI8 A;  2DJF B;  3IV2 A;  2FO5 A;  3BWK A;  1A6R A;  4I07 A;  2DCC A;  5EF4 A;  3OF9 A;  3V6C A;  1W4T A;  2AUZ A;  2YJC A;  4YYQ A;  3PDF A;  1MDW A;  2AIM A;  3PBH A;  3MHH A;  3WXE A;  3IUT A;  1CB5 A;  1BP4 A;  4P6E A;  4PP2 E;  1CQD A;  4B55 A;  1AU0 A;  1YK7 A;  4NV7 A;  3H6S A;  1PAD A;  2R9N A;  5EGW A;  3P5W A;  2PRE A;  1M6D A;  2OP3 A;  1S4V A;  5CVO B;  1GMY A;  4YYW A;  3V6E A;  4QRV A;  3D9W A;  1NL6 A;  1PPO A;  1E2T A;  1QMY A;  1MHW A;  4FJC A;  2R9O A;  1F29 A;  1EWM A;  2BDZ A;  2IBI A;  2DC7 A;  2E03 A;  4CDD B;  2VFB A;  4QRG A;  2DJG B;  2HH5 A;  1U5I A;  4XUI A;  4KLB A;  1AEC A;  5J94 A;  4N79 A;  2YJ8 A;  1AYV A;  2P0R A;  4BSQ A;  3BPF A;  4MSX A;  2VFC A;  2E00 A;  1CV8 A;  3LFY A;  2XU3 A;  1AYU A;  2P7U A;  1U9W A;  3PNR A;  3K24 A;  2G6D A;  3BC3 A;  3K9M A;  3C9E A;  1YVB A;  1FH0 A;  3E1Z B;  1GX3 A;  1GLO A;  5CHV A;  3LTW A;  3H89 A;  3DF0 A;  3IEJ A;  3S3R A;  4G54 A;  4QRX A;  4MZO A;  1VSN A;  4RY2 A;  4CZW A;  1PBH A;  2CB5 A;  4FK5 A;  4N4Z A;  2AYN A;  1W6F A;  1ICF A;  2G8J A;  2XU1 A;  3QSD A;  3RVW A;  4BGF A;  3RVV A;  2ACT A;  1F2A A;  3OVZ A;  1QXP A;  4OEM A;  4DMY A;  1MS6 A;  2F1G A;  1PPD A;  2AU1 A;  2DC6 A;  1W5R A;  2AVW A;  2HHN A;  2G8E A;  2NQG A;  2H7J A;  1KHP A;  2DC8 A;  1ME4 A;  1X9Y A;  3QJ3 A;  3H7D A;  5CVN B;  4YV8 A;  2Y6E A;  2DCB A;  3U8E A;  3HWN A;  3RVX A;  2XU4 A;  3BPM A;  3MTN A;  2JQF R;  3H8C A;  4YYU A;  3CH2 X;  3OVX A;  2P86 A;  3KW9 A;  8PCH A;  1PXV A;  1CVZ A;  4W4U A;  4XR7 A;  3CBK A;  2NQA A;  3HHA A;  2FRA A;  4X6I A;  2C0Y A;  2E01 A;  4ZUX U;  4YYR A;  1AU2 A;  5A24 A;  3MOR A;  1F2C A;  4AXL A;  4PP1 A;  2R9F A;  2DC9 A;  4BQV A;  1YT7 A;  3N4C A;  3B79 A;  3ERV A;  4WA6 A;  1PE6 A;  1SNK A;  4N8W A;  3KWZ A;  2FT2 A;  1EWP A;  1CS8 A;  1PPN A;  4K7C A;  2GFO A;  3KFQ A;  5FPW A;  3USV A;  4YYV A;  4X6J A;  3OF8 A;  6PAD A;  1ZIV A;  3I3T A;  2AUX A;  2E02 A;  3QT4 A;  2ATO A;  3I06 A;  1PPP A;  3KX1 A;  1QOL A;  2CIO A;  2R6N A;  2PNS A;  3F75 A;  1MEM A;  1NQC A;  3PW3 A;  1AIM A;  2O6X A;  2FUD A;  1CSB B;  1NB3 A;  1AYW A;  3O0U A;  2HXZ A;  2B1N A;  2DCA A;  4BS6 A;  3IHP A;  1ZCM A;  4OEL A;  3O1G A;  2FTD A;  1IWD A;  4NV8 A;  5CHT A;  2GHU A;  1AU4 A;  1U9V A;  1KHQ A;  5F02 A;  2PAD A;  1NPZ A;  1F2B A;  1JQP A;  3GCB A;  1MEG A;  2DZZ A;  2NQI A;  9PAP A;  3P5X A;  2WBF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...