4C5PA

The structure of mycobacterium marinum arylamine n-acetyltransferase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
272
structure length
271
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
publication title Arylamine N-Acetyltransferases from Mycobacteria: Investigations of a Potential Target for Anti- Tubercular Therapy
rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 84
structure length 271
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4c5pA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4c5pA01
4BGFA 3LTWA 4NV8A 4B55A 1W4TA 4GUZA 1W6FA 4C5PA 1GX3A 2VFCA 1W5RA 1E2TA 3D9WA 2BSZA 4NV7A 2VFBA
chains in the Genus database with same CATH superfamily
3APVA 4UU3A 5JD2A 1ZRYA 4GK9A 2IJAA 1OEEA 2NP1A 2EU7X 4GETA 3T1DA 2OF8A 5EPQA 2FKGA 5D8JA 1GX3A 3D97A 3D4RA 3HWDA 4YBPA 1KL3A 4COTA 3QKGA 3K3LA 3SZHA 4ZJ0A 2KTSA 3BY0A 4CPFA 2HKDA 1SXUA 2I5ZO 5LKFA 2ASNX 1SXWA 4ON1A 5HZ5A 1VWFB 1BM5A 2A8GA 1LIFA 4O4XA 5H9LA 1EI5A 1KT3A 2BS6A 1SWCA 3VE2A 2FKJA 2Q9SA 4N7DA 2RTGB 1DV9A 1HMSA 3F8AA 1JQPA 2GTLM 2IZKA 3HTYA 4IB9A 5H9AA 5IRAA 4BX6A 2IZFB 2RTHB 2RTOB 3VHMA 3VGWA 1VWPB 2MF6A 2JW1A 2JU3A 2L68A 3NP1A 3P6HA 4LZUA 1KGLA 2AKQA 3OD9A 3PP6A 2VFBA 4GNYA 3VPJE 1JV4A 2UZ2A 1OPBA 1SY3A 1X89A 2WQAE 5B10O 3ZUIA 4INNA 3GE2A 3SOTA 1GT4A 3WZNA 1U18A 3NR3A 2OY5O 3VG6A 1RXHA 2WEWA 1VWOB 2OY1O 1KZWA 2AL0X 1VWGB 1PEEA 1EPBA 3O22A 4M7MA 4U8UN 1FELA 1VYGA 1NDJA 1SWOA 3RDMA 3SLJA 1CRBA 4IB7A 3STKA 2MM3A 1JYDA 4ZHDA 2WWPA 1BSQA 3BU1A 2DJFA 3PEDA 4ORUA 2Q4NA 4YDBA 1ICMA 1QABE 2MHDA 4MISA 4KCAA 5LJDA 1HBQA 2LFOA 3FDCA 2KD2A 4NNSA 1EPAA 1KZXA 2NNEA 3P6GA 1AVDA 4NV7A 4HPCA 4TJZA 4BOEA 3FEKA 3SLOA 4KC8A 1SXXA 1ERBA 1ZNDA 2GJ5A 4WFVA 1RXJA 1P6PA 1VWLB 3RDSA 3TGBA 2RTFB 4XMGA 2RQ0A 3Q6LA 2A0AA 4NP1A 1KL4A 1DF8A 2G7BA 4AW8A 1Y52X 3TF6A 2IZIA 2AT8X 2FTBA 1CBSA 1QFVA 3RY2A 1OPAA 1BSOA 2RD7C 3NADA 1IW2A 3MX7A 1LICA 1MOYA 1OBUA 1T0VA 1SWJA 1TOUA 3OE3A 1KT5A 4RUUA 3VG2A 4O9SA 1UYNX 1SRJA 1HXLA 4O49A 1KFFA 1IJ8A 4AZMA 5C0NA 2FHLA 4JHQA 3UEVA 4RUNA 1RSUB 1SWAA 2OYBO 3PH5A 2IZLB 1DFVA 4XMFA 3WXQA 2VFCA 4ARHA 4ZGUA 1ZNGA 1MK5A 3RE5A 1MEPA 3WJEA 4A1YA 2C4IA 5FAZA 5B29A 4Y0PA 4DQ3A 1PM1X 5CE4A 3PECA 1LELA 4O3ZA 4DQ4A 2AT5X 2PQTA 1SRIA 2PFRA 3S5XA 1JYJA 3P24A 4GD9A 4I3DA 5D47A 1SLEB 4U8UO 1NC9A 4ALBA 3AKNA 1VWHB 3VHHA 4Z2OA 5HCEC 2WSJA 5F2BA 2AMMX 1SLGB 2MWHA 5B5GA 4Z6JA 2K62A 3CQNA 5HCDC 2QO4A 2BT9A 3T6LA 1Y9TA 1QY0A 1JBHA 5B2AO 1SWRA 1WUBA 1Y0GA 4OS8A 1OBQA 2LBVA 5KHPA 1W4TA 1D3SA 2FS7A 1LCZA 2QMIA 2POAA 2RTCB 4GJSA 1YUPA 1JZUA 2OY7A 2A5BA 4JO6A 1ERXA 3UEUA 2BC3A 4ORWA 2G5LA 2Z4IA 1EQDA 5CSEA 3STNA 2QOMA 5D45A 1QY1A 4LKTA 1NGLA 4O4OA 2NNQA 2Z4HA 1LDOA 3ZW0A 1DZPA 3CQRA 3WZOA 1LDQA 2R74A 3WVMA 4GJVA 3BDRA 1N9MA 2X34A 1PBOA 5B11O 4YGZA 4QGWA 5IRUA 3F6ZB 4NLJA 2Q39A 1VWRB 1A57A 3JQOA 1JIWI 2A2UA 5HZ6A 3RKGA 2FS6A 2RA6A 3RE6A 2RTBB 4MVIA 1KXOA 3WJDA 2QCBA 5HAEA 2X56A 1NQNA 3PPTA 5DPQA 5FQ7E 5LJEA 2FR3A 2LA7A 2JMBA 1L6MA 2KTDA 4IMNA 2A13A 5H8TA 1I4UA 1LIBA 3RWXA 2IZJA 4XMDA 1X71A 4TKHA 3WJGA 2RTLA 5L8IA 1PTSA 2ACPX 1SWBA 3E3CA 3RZYA 1HY2A 5D4AA 5IRWA 3BU9A 3D96A 4QYNA 1FE3A 1I04A 1E06A 1ML7A 4LKPA 4Z28A 1EIOA 3NBXX 1X8QA 1XKIA 1SXYA 1LFOA 3WJFA 1IKEA 1EUOA 3F9DA 2AT3X 3HWEA 4Y0QA 5F1EA 2M4LA 3RDQA 5L8NA 5F58A 1FENA 3WZPA 3MG5A 1LKEA 4CK4A 3O19A 3S5VA 3EBWA 4NYQA 3ZZVA 1S44A 1YIVA 4MVEA 1TXLA 2E4JA 4R0BA 1PMPA 1SY1A 2L9CA 4CPHB 3FLLA 4MIRA 4WBKA 3CKFA 1LUQA 2HMBA 5L3YA 1AELA 3VE1A 1S7DA 1GGLA 4OMXA 2FLJA 5EEEA 2LKKA 3FW5A 1IFCA 1VYOA 4MEEA 4CDFA 3L4RA 4QQ1A 1W5RA 1QG5A 2YG2A 1O1VA 1STSB 3EC5A 3NX2A 2Y3EA 2FR2A 3EW1A 1UYOX 4CSBA 1SY0A 4A60A 1HQPA 4CDEA 5FENA 3Q34A 3FR5A 4KIIA 4BVMA 4QAEA 4BJ8A 2F73A 2RTJA 3B2KA 1E00A 4HFOA 1VWBB 2GTFX 5B3MO 3LTWA 2LBAA 3GAQA 2RTRB 4AZNA 2YMSA 4DCBA 2RTQB 4O3WA 4CPIA 1CBIA 4ZR2A 1E02A 5D48A 2ANSA 2C1QA 4GGZA 2JN3A 3AKMA 5FQ8E 3FR4A 4TLJA 2AT6X 4B55A 3C78X 5BVSA 3HOLA 2HYSA 3PQSA 3HWGA 3QQ2A 4C5PA 2BLGA 3APUA 1GT5A 1H91A 5EZ2A 1IKJA 3HOEA 3FA8A 4HPDA 4IBAA 2JGSA 4QNIA 3S26A 3ZI8A 1SRHA 3MBTA 3FA6A 3RSWA 1SLFB 3BS2A 3BLGA 4FBRA 4IAWA 1FDQA 2GH7A 3T2WA 2L5PA 2XKLA 4HPAA 4MVKA 5HBSA 5L8OA 2X32A 4QZUA 1A18A 2CBSA 2ALLX 2IZGB 3ZQ3A 4BX5A 4A8ZA 3KVNA 4BX6B 1LPJA 3IA8A 3S60A 4GH7A 3U0DA 1TW4A 5K68A 1MX8A 4LQZA 5FQ6E 2IZCB 2HLVA 1QQSA 4OS0A 2QOSC 2NNDA 1RSTB 2OVDA 3KFFA 3PQUA 2JU8A 4WFUA 4CV7A 3FMZA 2OFMX 3KQ0A 4AYHA 3U03A 1G5WA 2P8GA 2X55A 3KFIA 4EFGA 2BSZA 4I60A 2WPUA 3OBLA 3CR6A 5KIDA 4KT5A 3KFGA 4JNJA 3SLTA 3NQKA 2GC9A 2FGSA 1HBPA 1GX9A 2Q2MA 3C77X 4YGHA 3ZW1A 2XSTA 5HTEA 1BWYA 1B56A 4I9RA 3U9PC 1KL5A 3RDXA 1JJUA 3NPOA 1BSYA 4AZRA 2WUTA 1I05A 3RBYA 1SWKA 2FRSA 1OSPO 3FIQA 5HZQA 3WYPA 4BCSA 5K06A 3HWFA 4QYPA 1R0UA 4OKAA 4A1HA 3EMMA 4KC7A 4ZGFA 1G74A 3ELXA 2CM4A 1KOIA 1MM9A 1SWTA 3NX1A 5BYPA 2QO5A 4LZVA 5LJCA 2RCTA 4YH0A 1NQMA 1KT4A 4GKCA 3APXA 1RBPA 3FA9A 2RTAA 3P02A 2BHVA 2R56A 1TVQA 4U3QA 5H9NA 3BSZE 1MDCA 5AJBA 1AVGI 2OFRX 1SWNA 4U9CA 1U17A 4IB6A 1RLBE 2JOZA 2OZQA 1VWEB 2IFBA 1N4JA 1FTPA 2PY1A 4GU8A 5H9KA 4PSQA 2G78A 4O4UA 4GNWA 3LHNA 1A3YA 4YFQA 5HZ9A 1FJ1E 2ZAIA 4Y0RA 4NLIA 1GT1A 2A2GA 1BRPA 3MVFA 3TGCA 3VG4A 2CZUA 1CBQA 2UYWA 2CZTA 1VWNB 1LIDA 2OVAA 4HPBA 4AZQA 2WR6A 2WQ9A 1YWAA 3APWA 2OL6O 3HK1A 1ZNLA 4FBVA 3PH6A 5LJKA 2RTDB 4TKBA 3P6FA 1RXKA 2DJGA 3B2LA 4L3RA 4OMWA 4BQUA 1YWBA 1ZNKA 4Z2PA 2RTEB 2DM5A 5CYBA 4EKVA 1UREA 1A2DA 3NQ9A 2FHNX 4KH8A 1ICNA 1AQBA 1MVGA 2CAMA 1EXSA 5DG4A 4ZCBA 3WZQA 1SLDB 2IZAA 5F6BA 4I3CA 4CPEA 3JSQA 1VWIB 1IIUA 3B2IA 3X00A 4ES7A 4BGFA 4TNNA 2OL7A 3RDOA 3T6FA 4DNEA 3ZW1B 1NP4A 4ID2A 3UEWA 1N43A 1KT7A 1EW3A 1SWLA 1SWFA 2L67A 3T2XA 1JMZA 1RAVA 3VU1A 1LF7A 3DTQA 1I9HA 3WYQA 1JJXA 3WOVA 1VWDB 1VWKB 1N0SA 4O3YA 4TQ2A 1VYFA 2O62A 1T8VA 2AF5A 4I3BA 1BRQA 1GT3A 1CBRA 4I6SA 1GXAA 3DSZA 4NV8A 4YCHA 2VDFA 4GDAA 2HZRA 5HA1A 2AVIA 1YWCA 1JJJA 3LV4A 1X8PA 1Y9LA 2RTKA 4YGGA 4D6AA 5HTDA 1VWAB 2OL8O 2IZDB 2OVSA 3V8UA 2AH7X 3VG3A 2F09A 2RTMA 5F7GA 4FQBB 2AT0X 4I95A 3P6EA 3PK2A 3P6DA 1EIIA 1GKAA 3OJYC 4NW4A 4U8UM 2RCQA 4YBUA 1YP6A 5IO7A 3EBKA 4JGLA 3ZW0B 4O4SA 2OVEA 4IABA 2OFBA 1SMPI 1DZKA 3KFHA 4IMOA 4M6SA 4ODDA 2GTLN 3P6CA 2X46A 4K19A 1STPA 4QZTA 3NQ3A 5BVQA 1LNMA 3WJCA 3SZIA 3ZWEA 1PBYA 2X4MA 3UEXA 2ACOA 1ALBA 3SAOA 3H3IA 1LIEA 3CMPA 4OS3A 1WBIA 4AZPA 1AB0A 1ZNEA 5B5FA 1OEJA 4YKMA 3EYCA 3TGAA 2OFAA 1S2PA 4ZHHA 1VWJB 2FWVA 4QGXA 3ELZA 2IZEB 1O8VA 1KQWA 4ZH6A 1MUPA 5AQ6A 1NBXA 2I5VO 4MVLA 3CWKA 4QRLA 1VWQB 4WHIA 1KT6A 1KQXA 1YP7A 1OEKA 1SWDA 3HPEA 1BJ7A 3VG7A 4D6BA 5HA0A 3BX7A 1E5PA 4ZH9A 5HWZA 4YVBA 4ZHGA 3FW4A 1Z24A 2W2AA 2ZAGA 4Z27A 4OEMA 3D95A 1SY2A 1N9YA 4GZVA 5IO5A 3N91A 4NYRA 1TOWA 5LJHA 1I06A 2W2FA 4ZFXA 1ZNHA 4EDEA 3EM0A 4GRJA 1DZJA 1VPRA 1HMTA 1Y55X 3BRNA 2WEXA 5CHKA 4YDAA 1ACDA 1BEBA 1FEMA 2C1SA 3MM0A 5K67A 3D9WA 4GDZA 4TKJA 4ORXA 5JR8A 1N7YA 2QO6A 1LCWA 3I0AA 4FBOA 2KW1A 3ZUOA 2Y3FA 1BLRA 2LB6A 4XMCA 1GM6A 2K23A 5F6ZA 1MX7A 3O2YA 5B27A 4ZHCA 4Z2VA 4N7CA 1OBPA 5EEDA 1U0XA 1DZMA 1QFTA 1VWCB 2ZSCA 4UU2A 4ORRA 2RTPB 2GTLO 4BX7A 2RTIB 4CDDA 1HXZA 1GKAB 3B2HA 1G85A 2HNXA 3FEPA 2IZBA 1K3BA 1STRB 1D2UA 1CJ5A 1YWDA 3JS1A 1LCVA 4NNTA 1ADLA 1NP1A 1SWSA 4OELA 5EDBA 3RY1A 5BVTA 3LNBA 4AZOA 1VWMB 1B4MA 1O1UA 4IAXA 2G79A 5HCCC 1X8NA 1X8UA 1HN2A 1T68X 4O3XB 1AVEA 3PDFA 4IB8A 4ORSA 1JMXA 1SREA 1QWDA 2MJIA 2CBRA 1BBPA 2QM9A 4GE1A 4HWMA 2CM9A 1G7NA 4IRWA 3TZSA 1SRFA 5LJGA 3FELA 2Q2PA 5HZ8A 3IFBA 2A3FX 1SWGA 4DMOA 5LKEA 2OF9A 1HMRA 3CKGA 3STMX 5AEOA 2RTNB 1DF3A 2IZHB 1QY2A 3FA7A 3KZAA 1IFBA 1SWHA 4YCEA 1SWPA 2PI3O 4Y5DA 3SZJA 1Y53X 5LJBA 3CBSA 1K24A 4CDCA 2MO5A 5IO6A 2N93A 1SRGA 4YKOA 2RN4A 4CPHA 1E2TA 1GX8A 3FIDA 3RDUA 3AEHA 3C76X 2A5CA 4GGTA 2X8FA 1X8OA 3G7XA 3WJBA 2W2BA 4Y0SA 2HZQA 3EW2A 4BX5B 3CBCA 2FT9A 5FFHA 1UZ2X 4EXZA 1B0OA 4XMEA 1SWQA 4PJ2A 4U46A 4EQAC 4EEJA 2F01A 3UAQA 3VG5A 2X45A 3I17A 3FENA 4BBOA 1DC9A 2X8TA 4YFPA 1SA8A 2G8CO 4GGRA 3ZW2A 4ALOA 3FYFA 3AUMO 2OY8A 1SWEA 2KT4B 5EDCA 2Y32A 4YFRA 4XMHA 1EALA 2R73A 1I78A 3BX8A 4ML7B 4ORYA 1XCAA 4I9SA 3VHIA 4ZHFA 4GUZA 2X8SA 1HQQA 3WBGA 4QGVA 5IXGA 4BX7B 3FR2A 2JU7A 1SWUA 3B2JA 5KICA 2BS5A 4FGIB 4YMYA 1W6FA 5AJCA 4Y59A 4L1NA 1B8EA
chains in the Genus database with same CATH topology
1AYWA 4ZUXU 3WXFA 1GX3A 3BWKA 2JQFR 1ZCMA 3RVWA 4Q8HA 1QMYA 5EF4A 1JQPA 2NQIA 3H89A 1NB5A 3OF8A 1YVBA 3KFQA 3MHHA 2C0YA 2E00A 1O0EA 2VFBA 2PNSA 5PADA 5CHVA 4PI3A 2FTDA 1ZIVA 2O6XA 1BP4A 1F2CA 4XUIA 2ATOA 3WXEA 2DC9A 5A24A 1KHQA 3GCBA 1F2AA 2FYEA 3H8CA 3PNRA 1IWDA 4YYRA 3WXGA 4NV7A 1MHWA 5FPWA 3H7DA 3BC3A 2XU4A 1PBHA 2JQGR 4I07A 4Q8GA 2BDZA 1Y4HA 3OF9A 1YK7A 1YT7A 3BPMA 2FRAA 2YJ8A 1SP4B 1TLOA 3BPFA 1U9VA 2YJCA 1POPA 2VFCA 4BQVA 1MDWA 3PBHA 4QRVA 1KFUL 3QJ3A 3V6CA 4QRGA 3D6SA 4QRXA 3HHAA 3CBKA 3HHIA 2DZZA 2PREA 2AYNA 4PP2E 3P5WA 2DJFB 1W4TA 1BGOA 1PPNA 3P5UA 4MZOA 8PCHA 2R6NA 4AXLA 1U9WA 2ARYA 1AU0A 4X6IA 6PADA 4YYVA 3RVXA 2FRQA 1AECA 1U9QX 1VSNA 2YJBA 1PCIA 1MEGA 1K3BB 2NQGA 2DC6A 4YYQA 1U9XA 3BCNA 3F75A 1F29A 1FH0A 2DZYA 3KW9A 2BDLA 1VJVA 5EGWA 4P6GA 2E01A 3S3RA 1EWPA 2H7JA 1XKGA 4CDCB 3BOWA 1ICFA 1THEA 2PBHA 2IBIA 3IUTA 3OVZA 4BS6A 3P5XA 5J94A 1Y08A 2FUDA 5CHTA 1W5RA 4CZWA 2XU3A 3ERVA 1ITOA 3HWNA 1CV8A 1CVZA 1PPOA 3LXSA 2R9CA 3M99A 4P6EA 7PCKA 3MHSA 4FIPA 1HUCB 3I3TA 3LTWA 2G8JA 4BPVA 4YYSA 4B55A 3K9MA 3RVVA 3E1ZB 3CBJA 4C5PA 4WA6A 4YYUA 1KFXL 2P86A 1TU6A 2IPPB 2DCDA 3K8UA 3U8EA 1YALA 1CTEA 4HWYA 3PW3A 3IV2A 4N4ZA 2R9FA 4CDFB 1NLJA 1DEUA 2BSZA 1AIMA 2DC8A 2Y5BA 4BSQA 3V6EA 1EF7A 3NHEA 2F1GA 2F7DA 3P5VA 5K16A 2VHFA 5F02A 4CDEB 2G7YA 2XU5A 3O0UA 2HD5A 4RY2A 3IOQA 4DMYA 2E03A 1KHPA 4G54A 1MIRA 2VHSA 1PADA 2Y6EA 1ME4A 2NQDB 1MEMA 1GCBA 3KSEA 2AS8A 3S3QA 2AUXA 2FO5A 3C9EA 4YYWA 3IMAA 2HXZA 2AIMA 3N3KA 3N3GA 3ZUAA 1SNKA 4X6JA 2OULA 3USVA 5JA7A 1ATKA 3IHPA 1U5IA 1PPPA 2DCCA 3LFYA 4XR7A 3KKUA 4BGFA 2GHUA 1NPZA 4X6HA 1PPDA 1CPJA 1F2BA 4QH6A 4MZSA 1AU2A 4W5BA 4NV8A 1AU3A 1YK8A 1M6DA 2AVWA 3MORA 4QBBA 3F5VA 1EWMA 4MSXA 2YJ2A 1ME3A 4AXMA 4I05A 1QDQA 1MS6A 3KWBX 3HD3A 2OZ2A 2AU1A 2DCAA 3MTNA 3B79A 1CB5A 2ACTA 1BY8A 2HHNA 1NB3A 2DC7A 5JH3A 1CQDA 1A6RA 3DF0A 2CIOA 2DJGB 2P7UA 4PADA 1CJLA 2CB5A 1CSBB 1GLOA 2XU1A 1TL9A 2R9NA 4KLBA 4OEMA 2B1MA 3K24A 2P0RA 3CH2X 1PIPA 1BQIA 2G8EA 3OVXA 3D9WA 2R9OA 2WBFX 4YVAA 4N8WA 2AUZA 1CS8A 2FQ9A 3H6SA 1S4VA 2YJ9A 2NQAA 2B1NA 1Q6KA 1NQCA 3KX1A 1AYUA 4OELA 3IEJA 1PXVA 4W5CA 3PDFA 3KWZA 1GECE 2G6DA 3O1GA 3N4CA 1QOLA 1X9YA 3AI8A 2FT2A 1AYVA 3I06A 2DCBA 4DMXA 4K7CA 1E2TA 1EWLA 3CH3X 1STFE 1KXRA 2GFOA 1EWOA 4FK5A 1GMYA 4W4UA 4I04A 1PE6A 4BS5A 4PP1A 2OP3A 4N79A 5CVOB 3QSDA 2HH5A 1NL6A 1DF0A 4YV8A 1QXPA 3OISA 4FJCA 5CVMA 4GUZA 3TNXA 2AYOA 4CDDB 3QT4A 1AU4A 5CVNB 2PADA 2E02A 1W6FA 3H8BA 9PAPA 2R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGF A;  3LTW A;  4NV8 A;  4B55 A;  1W4T A;  4GUZ A;  1W6F A;  4C5P A;  1GX3 A;  2VFC A;  1W5R A;  1E2T A;  3D9W A;  2BSZ A;  4NV7 A;  2VFB A; 
#chains in the Genus database with same CATH topology
 3APV A;  4UU3 A;  5JD2 A;  1ZRY A;  4GK9 A;  2IJA A;  1OEE A;  2NP1 A;  2EU7 X;  4GET A;  3T1D A;  2OF8 A;  5EPQ A;  2FKG A;  5D8J A;  1GX3 A;  3D97 A;  3D4R A;  3HWD A;  4YBP A;  1KL3 A;  4COT A;  3QKG A;  3K3L A;  3SZH A;  4ZJ0 A;  2KTS A;  3BY0 A;  4CPF A;  2HKD A;  1SXU A;  2I5Z O;  5LKF A;  2ASN X;  1SXW A;  4ON1 A;  5HZ5 A;  1VWF B;  1BM5 A;  2A8G A;  1LIF A;  4O4X A;  5H9L A;  1EI5 A;  1KT3 A;  2BS6 A;  1SWC A;  3VE2 A;  2FKJ A;  2Q9S A;  4N7D A;  2RTG B;  1DV9 A;  1HMS A;  3F8A A;  1JQP A;  2GTL M;  2IZK A;  3HTY A;  4IB9 A;  5H9A A;  5IRA A;  4BX6 A;  2IZF B;  2RTH B;  2RTO B;  3VHM A;  3VGW A;  1VWP B;  2MF6 A;  2JW1 A;  2JU3 A;  2L68 A;  3NP1 A;  3P6H A;  4LZU A;  1KGL A;  2AKQ A;  3OD9 A;  3PP6 A;  2VFB A;  4GNY A;  3VPJ E;  1JV4 A;  2UZ2 A;  1OPB A;  1SY3 A;  1X89 A;  2WQA E;  5B10 O;  3ZUI A;  4INN A;  3GE2 A;  3SOT A;  1GT4 A;  3WZN A;  1U18 A;  3NR3 A;  2OY5 O;  3VG6 A;  1RXH A;  2WEW A;  1VWO B;  2OY1 O;  1KZW A;  2AL0 X;  1VWG B;  1PEE A;  1EPB A;  3O22 A;  4M7M A;  4U8U N;  1FEL A;  1VYG A;  1NDJ A;  1SWO A;  3RDM A;  3SLJ A;  1CRB A;  4IB7 A;  3STK A;  2MM3 A;  1JYD A;  4ZHD A;  2WWP A;  1BSQ A;  3BU1 A;  2DJF A;  3PED A;  4ORU A;  2Q4N A;  4YDB A;  1ICM A;  1QAB E;  2MHD A;  4MIS A;  4KCA A;  5LJD A;  1HBQ A;  2LFO A;  3FDC A;  2KD2 A;  4NNS A;  1EPA A;  1KZX A;  2NNE A;  3P6G A;  1AVD A;  4NV7 A;  4HPC A;  4TJZ A;  4BOE A;  3FEK A;  3SLO A;  4KC8 A;  1SXX A;  1ERB A;  1ZND A;  2GJ5 A;  4WFV A;  1RXJ A;  1P6P A;  1VWL B;  3RDS A;  3TGB A;  2RTF B;  4XMG A;  2RQ0 A;  3Q6L A;  2A0A A;  4NP1 A;  1KL4 A;  1DF8 A;  2G7B A;  4AW8 A;  1Y52 X;  3TF6 A;  2IZI A;  2AT8 X;  2FTB A;  1CBS A;  1QFV A;  3RY2 A;  1OPA A;  1BSO A;  2RD7 C;  3NAD A;  1IW2 A;  3MX7 A;  1LIC A;  1MOY A;  1OBU A;  1T0V A;  1SWJ A;  1TOU A;  3OE3 A;  1KT5 A;  4RUU A;  3VG2 A;  4O9S A;  1UYN X;  1SRJ A;  1HXL A;  4O49 A;  1KFF A;  1IJ8 A;  4AZM A;  5C0N A;  2FHL A;  4JHQ A;  3UEV A;  4RUN A;  1RSU B;  1SWA A;  2OYB O;  3PH5 A;  2IZL B;  1DFV A;  4XMF A;  3WXQ A;  2VFC A;  4ARH A;  4ZGU A;  1ZNG A;  1MK5 A;  3RE5 A;  1MEP A;  3WJE A;  4A1Y A;  2C4I A;  5FAZ A;  5B29 A;  4Y0P A;  4DQ3 A;  1PM1 X;  5CE4 A;  3PEC A;  1LEL A;  4O3Z A;  4DQ4 A;  2AT5 X;  2PQT A;  1SRI A;  2PFR A;  3S5X A;  1JYJ A;  3P24 A;  4GD9 A;  4I3D A;  5D47 A;  1SLE B;  4U8U O;  1NC9 A;  4ALB A;  3AKN A;  1VWH B;  3VHH A;  4Z2O A;  5HCE C;  2WSJ A;  5F2B A;  2AMM X;  1SLG B;  2MWH A;  5B5G A;  4Z6J A;  2K62 A;  3CQN A;  5HCD C;  2QO4 A;  2BT9 A;  3T6L A;  1Y9T A;  1QY0 A;  1JBH A;  5B2A O;  1SWR A;  1WUB A;  1Y0G A;  4OS8 A;  1OBQ A;  2LBV A;  5KHP A;  1W4T A;  1D3S A;  2FS7 A;  1LCZ A;  2QMI A;  2POA A;  2RTC B;  4GJS A;  1YUP A;  1JZU A;  2OY7 A;  2A5B A;  4JO6 A;  1ERX A;  3UEU A;  2BC3 A;  4ORW A;  2G5L A;  2Z4I A;  1EQD A;  5CSE A;  3STN A;  2QOM A;  5D45 A;  1QY1 A;  4LKT A;  1NGL A;  4O4O A;  2NNQ A;  2Z4H A;  1LDO A;  3ZW0 A;  1DZP A;  3CQR A;  3WZO A;  1LDQ A;  2R74 A;  3WVM A;  4GJV A;  3BDR A;  1N9M A;  2X34 A;  1PBO A;  5B11 O;  4YGZ A;  4QGW A;  5IRU A;  3F6Z B;  4NLJ A;  2Q39 A;  1VWR B;  1A57 A;  3JQO A;  1JIW I;  2A2U A;  5HZ6 A;  3RKG A;  2FS6 A;  2RA6 A;  3RE6 A;  2RTB B;  4MVI A;  1KXO A;  3WJD A;  2QCB A;  5HAE A;  2X56 A;  1NQN A;  3PPT A;  5DPQ A;  5FQ7 E;  5LJE A;  2FR3 A;  2LA7 A;  2JMB A;  1L6M A;  2KTD A;  4IMN A;  2A13 A;  5H8T A;  1I4U A;  1LIB A;  3RWX A;  2IZJ A;  4XMD A;  1X71 A;  4TKH A;  3WJG A;  2RTL A;  5L8I A;  1PTS A;  2ACP X;  1SWB A;  3E3C A;  3RZY A;  1HY2 A;  5D4A A;  5IRW A;  3BU9 A;  3D96 A;  4QYN A;  1FE3 A;  1I04 A;  1E06 A;  1ML7 A;  4LKP A;  4Z28 A;  1EIO A;  3NBX X;  1X8Q A;  1XKI A;  1SXY A;  1LFO A;  3WJF A;  1IKE A;  1EUO A;  3F9D A;  2AT3 X;  3HWE A;  4Y0Q A;  5F1E A;  2M4L A;  3RDQ A;  5L8N A;  5F58 A;  1FEN A;  3WZP A;  3MG5 A;  1LKE A;  4CK4 A;  3O19 A;  3S5V A;  3EBW A;  4NYQ A;  3ZZV A;  1S44 A;  1YIV A;  4MVE A;  1TXL A;  2E4J A;  4R0B A;  1PMP A;  1SY1 A;  2L9C A;  4CPH B;  3FLL A;  4MIR A;  4WBK A;  3CKF A;  1LUQ A;  2HMB A;  5L3Y A;  1AEL A;  3VE1 A;  1S7D A;  1GGL A;  4OMX A;  2FLJ A;  5EEE A;  2LKK A;  3FW5 A;  1IFC A;  1VYO A;  4MEE A;  4CDF A;  3L4R A;  4QQ1 A;  1W5R A;  1QG5 A;  2YG2 A;  1O1V A;  1STS B;  3EC5 A;  3NX2 A;  2Y3E A;  2FR2 A;  3EW1 A;  1UYO X;  4CSB A;  1SY0 A;  4A60 A;  1HQP A;  4CDE A;  5FEN A;  3Q34 A;  3FR5 A;  4KII A;  4BVM A;  4QAE A;  4BJ8 A;  2F73 A;  2RTJ A;  3B2K A;  1E00 A;  4HFO A;  1VWB B;  2GTF X;  5B3M O;  3LTW A;  2LBA A;  3GAQ A;  2RTR B;  4AZN A;  2YMS A;  4DCB A;  2RTQ B;  4O3W A;  4CPI A;  1CBI A;  4ZR2 A;  1E02 A;  5D48 A;  2ANS A;  2C1Q A;  4GGZ A;  2JN3 A;  3AKM A;  5FQ8 E;  3FR4 A;  4TLJ A;  2AT6 X;  4B55 A;  3C78 X;  5BVS A;  3HOL A;  2HYS A;  3PQS A;  3HWG A;  3QQ2 A;  4C5P A;  2BLG A;  3APU A;  1GT5 A;  1H91 A;  5EZ2 A;  1IKJ A;  3HOE A;  3FA8 A;  4HPD A;  4IBA A;  2JGS A;  4QNI A;  3S26 A;  3ZI8 A;  1SRH A;  3MBT A;  3FA6 A;  3RSW A;  1SLF B;  3BS2 A;  3BLG A;  4FBR A;  4IAW A;  1FDQ A;  2GH7 A;  3T2W A;  2L5P A;  2XKL A;  4HPA A;  4MVK A;  5HBS A;  5L8O A;  2X32 A;  4QZU A;  1A18 A;  2CBS A;  2ALL X;  2IZG B;  3ZQ3 A;  4BX5 A;  4A8Z A;  3KVN A;  4BX6 B;  1LPJ A;  3IA8 A;  3S60 A;  4GH7 A;  3U0D A;  1TW4 A;  5K68 A;  1MX8 A;  4LQZ A;  5FQ6 E;  2IZC B;  2HLV A;  1QQS A;  4OS0 A;  2QOS C;  2NND A;  1RST B;  2OVD A;  3KFF A;  3PQU A;  2JU8 A;  4WFU A;  4CV7 A;  3FMZ A;  2OFM X;  3KQ0 A;  4AYH A;  3U03 A;  1G5W A;  2P8G A;  2X55 A;  3KFI A;  4EFG A;  2BSZ A;  4I60 A;  2WPU A;  3OBL A;  3CR6 A;  5KID A;  4KT5 A;  3KFG A;  4JNJ A;  3SLT A;  3NQK A;  2GC9 A;  2FGS A;  1HBP A;  1GX9 A;  2Q2M A;  3C77 X;  4YGH A;  3ZW1 A;  2XST A;  5HTE A;  1BWY A;  1B56 A;  4I9R A;  3U9P C;  1KL5 A;  3RDX A;  1JJU A;  3NPO A;  1BSY A;  4AZR A;  2WUT A;  1I05 A;  3RBY A;  1SWK A;  2FRS A;  1OSP O;  3FIQ A;  5HZQ A;  3WYP A;  4BCS A;  5K06 A;  3HWF A;  4QYP A;  1R0U A;  4OKA A;  4A1H A;  3EMM A;  4KC7 A;  4ZGF A;  1G74 A;  3ELX A;  2CM4 A;  1KOI A;  1MM9 A;  1SWT A;  3NX1 A;  5BYP A;  2QO5 A;  4LZV A;  5LJC A;  2RCT A;  4YH0 A;  1NQM A;  1KT4 A;  4GKC A;  3APX A;  1RBP A;  3FA9 A;  2RTA A;  3P02 A;  2BHV A;  2R56 A;  1TVQ A;  4U3Q A;  5H9N A;  3BSZ E;  1MDC A;  5AJB A;  1AVG I;  2OFR X;  1SWN A;  4U9C A;  1U17 A;  4IB6 A;  1RLB E;  2JOZ A;  2OZQ A;  1VWE B;  2IFB A;  1N4J A;  1FTP A;  2PY1 A;  4GU8 A;  5H9K A;  4PSQ A;  2G78 A;  4O4U A;  4GNW A;  3LHN A;  1A3Y A;  4YFQ A;  5HZ9 A;  1FJ1 E;  2ZAI A;  4Y0R A;  4NLI A;  1GT1 A;  2A2G A;  1BRP A;  3MVF A;  3TGC A;  3VG4 A;  2CZU A;  1CBQ A;  2UYW A;  2CZT A;  1VWN B;  1LID A;  2OVA A;  4HPB A;  4AZQ A;  2WR6 A;  2WQ9 A;  1YWA A;  3APW A;  2OL6 O;  3HK1 A;  1ZNL A;  4FBV A;  3PH6 A;  5LJK A;  2RTD B;  4TKB A;  3P6F A;  1RXK A;  2DJG A;  3B2L A;  4L3R A;  4OMW A;  4BQU A;  1YWB A;  1ZNK A;  4Z2P A;  2RTE B;  2DM5 A;  5CYB A;  4EKV A;  1URE A;  1A2D A;  3NQ9 A;  2FHN X;  4KH8 A;  1ICN A;  1AQB A;  1MVG A;  2CAM A;  1EXS A;  5DG4 A;  4ZCB A;  3WZQ A;  1SLD B;  2IZA A;  5F6B A;  4I3C A;  4CPE A;  3JSQ A;  1VWI B;  1IIU A;  3B2I A;  3X00 A;  4ES7 A;  4BGF A;  4TNN A;  2OL7 A;  3RDO A;  3T6F A;  4DNE A;  3ZW1 B;  1NP4 A;  4ID2 A;  3UEW A;  1N43 A;  1KT7 A;  1EW3 A;  1SWL A;  1SWF A;  2L67 A;  3T2X A;  1JMZ A;  1RAV A;  3VU1 A;  1LF7 A;  3DTQ A;  1I9H A;  3WYQ A;  1JJX A;  3WOV A;  1VWD B;  1VWK B;  1N0S A;  4O3Y A;  4TQ2 A;  1VYF A;  2O62 A;  1T8V A;  2AF5 A;  4I3B A;  1BRQ A;  1GT3 A;  1CBR A;  4I6S A;  1GXA A;  3DSZ A;  4NV8 A;  4YCH A;  2VDF A;  4GDA A;  2HZR A;  5HA1 A;  2AVI A;  1YWC A;  1JJJ A;  3LV4 A;  1X8P A;  1Y9L A;  2RTK A;  4YGG A;  4D6A A;  5HTD A;  1VWA B;  2OL8 O;  2IZD B;  2OVS A;  3V8U A;  2AH7 X;  3VG3 A;  2F09 A;  2RTM A;  5F7G A;  4FQB B;  2AT0 X;  4I95 A;  3P6E A;  3PK2 A;  3P6D A;  1EII A;  1GKA A;  3OJY C;  4NW4 A;  4U8U M;  2RCQ A;  4YBU A;  1YP6 A;  5IO7 A;  3EBK A;  4JGL A;  3ZW0 B;  4O4S A;  2OVE A;  4IAB A;  2OFB A;  1SMP I;  1DZK A;  3KFH A;  4IMO A;  4M6S A;  4ODD A;  2GTL N;  3P6C A;  2X46 A;  4K19 A;  1STP A;  4QZT A;  3NQ3 A;  5BVQ A;  1LNM A;  3WJC A;  3SZI A;  3ZWE A;  1PBY A;  2X4M A;  3UEX A;  2ACO A;  1ALB A;  3SAO A;  3H3I A;  1LIE A;  3CMP A;  4OS3 A;  1WBI A;  4AZP A;  1AB0 A;  1ZNE A;  5B5F A;  1OEJ A;  4YKM A;  3EYC A;  3TGA A;  2OFA A;  1S2P A;  4ZHH A;  1VWJ B;  2FWV A;  4QGX A;  3ELZ A;  2IZE B;  1O8V A;  1KQW A;  4ZH6 A;  1MUP A;  5AQ6 A;  1NBX A;  2I5V O;  4MVL A;  3CWK A;  4QRL A;  1VWQ B;  4WHI A;  1KT6 A;  1KQX A;  1YP7 A;  1OEK A;  1SWD A;  3HPE A;  1BJ7 A;  3VG7 A;  4D6B A;  5HA0 A;  3BX7 A;  1E5P A;  4ZH9 A;  5HWZ A;  4YVB A;  4ZHG A;  3FW4 A;  1Z24 A;  2W2A A;  2ZAG A;  4Z27 A;  4OEM A;  3D95 A;  1SY2 A;  1N9Y A;  4GZV A;  5IO5 A;  3N91 A;  4NYR A;  1TOW A;  5LJH A;  1I06 A;  2W2F A;  4ZFX A;  1ZNH A;  4EDE A;  3EM0 A;  4GRJ A;  1DZJ A;  1VPR A;  1HMT A;  1Y55 X;  3BRN A;  2WEX A;  5CHK A;  4YDA A;  1ACD A;  1BEB A;  1FEM A;  2C1S A;  3MM0 A;  5K67 A;  3D9W A;  4GDZ A;  4TKJ A;  4ORX A;  5JR8 A;  1N7Y A;  2QO6 A;  1LCW A;  3I0A A;  4FBO A;  2KW1 A;  3ZUO A;  2Y3F A;  1BLR A;  2LB6 A;  4XMC A;  1GM6 A;  2K23 A;  5F6Z A;  1MX7 A;  3O2Y A;  5B27 A;  4ZHC A;  4Z2V A;  4N7C A;  1OBP A;  5EED A;  1U0X A;  1DZM A;  1QFT A;  1VWC B;  2ZSC A;  4UU2 A;  4ORR A;  2RTP B;  2GTL O;  4BX7 A;  2RTI B;  4CDD A;  1HXZ A;  1GKA B;  3B2H A;  1G85 A;  2HNX A;  3FEP A;  2IZB A;  1K3B A;  1STR B;  1D2U A;  1CJ5 A;  1YWD A;  3JS1 A;  1LCV A;  4NNT A;  1ADL A;  1NP1 A;  1SWS A;  4OEL A;  5EDB A;  3RY1 A;  5BVT A;  3LNB A;  4AZO A;  1VWM B;  1B4M A;  1O1U A;  4IAX A;  2G79 A;  5HCC C;  1X8N A;  1X8U A;  1HN2 A;  1T68 X;  4O3X B;  1AVE A;  3PDF A;  4IB8 A;  4ORS A;  1JMX A;  1SRE A;  1QWD A;  2MJI A;  2CBR A;  1BBP A;  2QM9 A;  4GE1 A;  4HWM A;  2CM9 A;  1G7N A;  4IRW A;  3TZS A;  1SRF A;  5LJG A;  3FEL A;  2Q2P A;  5HZ8 A;  3IFB A;  2A3F X;  1SWG A;  4DMO A;  5LKE A;  2OF9 A;  1HMR A;  3CKG A;  3STM X;  5AEO A;  2RTN B;  1DF3 A;  2IZH B;  1QY2 A;  3FA7 A;  3KZA A;  1IFB A;  1SWH A;  4YCE A;  1SWP A;  2PI3 O;  4Y5D A;  3SZJ A;  1Y53 X;  5LJB A;  3CBS A;  1K24 A;  4CDC A;  2MO5 A;  5IO6 A;  2N93 A;  1SRG A;  4YKO A;  2RN4 A;  4CPH A;  1E2T A;  1GX8 A;  3FID A;  3RDU A;  3AEH A;  3C76 X;  2A5C A;  4GGT A;  2X8F A;  1X8O A;  3G7X A;  3WJB A;  2W2B A;  4Y0S A;  2HZQ A;  3EW2 A;  4BX5 B;  3CBC A;  2FT9 A;  5FFH A;  1UZ2 X;  4EXZ A;  1B0O A;  4XME A;  1SWQ A;  4PJ2 A;  4U46 A;  4EQA C;  4EEJ A;  2F01 A;  3UAQ A;  3VG5 A;  2X45 A;  3I17 A;  3FEN A;  4BBO A;  1DC9 A;  2X8T A;  4YFP A;  1SA8 A;  2G8C O;  4GGR A;  3ZW2 A;  4ALO A;  3FYF A;  3AUM O;  2OY8 A;  1SWE A;  2KT4 B;  5EDC A;  2Y32 A;  4YFR A;  4XMH A;  1EAL A;  2R73 A;  1I78 A;  3BX8 A;  4ML7 B;  4ORY A;  1XCA A;  4I9S A;  3VHI A;  4ZHF A;  4GUZ A;  2X8S A;  1HQQ A;  3WBG A;  4QGV A;  5IXG A;  4BX7 B;  3FR2 A;  2JU7 A;  1SWU A;  3B2J A;  5KIC A;  2BS5 A;  4FGI B;  4YMY A;  1W6F A;  5AJC A;  4Y59 A;  4L1N A;  1B8E A; 
#chains in the Genus database with same CATH homology
 1AYW A;  4ZUX U;  3WXF A;  1GX3 A;  3BWK A;  2JQF R;  1ZCM A;  3RVW A;  4Q8H A;  1QMY A;  5EF4 A;  1JQP A;  2NQI A;  3H89 A;  1NB5 A;  3OF8 A;  1YVB A;  3KFQ A;  3MHH A;  2C0Y A;  2E00 A;  1O0E A;  2VFB A;  2PNS A;  5PAD A;  5CHV A;  4PI3 A;  2FTD A;  1ZIV A;  2O6X A;  1BP4 A;  1F2C A;  4XUI A;  2ATO A;  3WXE A;  2DC9 A;  5A24 A;  1KHQ A;  3GCB A;  1F2A A;  2FYE A;  3H8C A;  3PNR A;  1IWD A;  4YYR A;  3WXG A;  4NV7 A;  1MHW A;  5FPW A;  3H7D A;  3BC3 A;  2XU4 A;  1PBH A;  2JQG R;  4I07 A;  4Q8G A;  2BDZ A;  1Y4H A;  3OF9 A;  1YK7 A;  1YT7 A;  3BPM A;  2FRA A;  2YJ8 A;  1SP4 B;  1TLO A;  3BPF A;  1U9V A;  2YJC A;  1POP A;  2VFC A;  4BQV A;  1MDW A;  3PBH A;  4QRV A;  1KFU L;  3QJ3 A;  3V6C A;  4QRG A;  3D6S A;  4QRX A;  3HHA A;  3CBK A;  3HHI A;  2DZZ A;  2PRE A;  2AYN A;  4PP2 E;  3P5W A;  2DJF B;  1W4T A;  1BGO A;  1PPN A;  3P5U A;  4MZO A;  8PCH A;  2R6N A;  4AXL A;  1U9W A;  2ARY A;  1AU0 A;  4X6I A;  6PAD A;  4YYV A;  3RVX A;  2FRQ A;  1AEC A;  1U9Q X;  1VSN A;  2YJB A;  1PCI A;  1MEG A;  1K3B B;  2NQG A;  2DC6 A;  4YYQ A;  1U9X A;  3BCN A;  3F75 A;  1F29 A;  1FH0 A;  2DZY A;  3KW9 A;  2BDL A;  1VJV A;  5EGW A;  4P6G A;  2E01 A;  3S3R A;  1EWP A;  2H7J A;  1XKG A;  4CDC B;  3BOW A;  1ICF A;  1THE A;  2PBH A;  2IBI A;  3IUT A;  3OVZ A;  4BS6 A;  3P5X A;  5J94 A;  1Y08 A;  2FUD A;  5CHT A;  1W5R A;  4CZW A;  2XU3 A;  3ERV A;  1ITO A;  3HWN A;  1CV8 A;  1CVZ A;  1PPO A;  3LXS A;  2R9C A;  3M99 A;  4P6E A;  7PCK A;  3MHS A;  4FIP A;  1HUC B;  3I3T A;  3LTW A;  2G8J A;  4BPV A;  4YYS A;  4B55 A;  3K9M A;  3RVV A;  3E1Z B;  3CBJ A;  4C5P A;  4WA6 A;  4YYU A;  1KFX L;  2P86 A;  1TU6 A;  2IPP B;  2DCD A;  3K8U A;  3U8E A;  1YAL A;  1CTE A;  4HWY A;  3PW3 A;  3IV2 A;  4N4Z A;  2R9F A;  4CDF B;  1NLJ A;  1DEU A;  2BSZ A;  1AIM A;  2DC8 A;  2Y5B A;  4BSQ A;  3V6E A;  1EF7 A;  3NHE A;  2F1G A;  2F7D A;  3P5V A;  5K16 A;  2VHF A;  5F02 A;  4CDE B;  2G7Y A;  2XU5 A;  3O0U A;  2HD5 A;  4RY2 A;  3IOQ A;  4DMY A;  2E03 A;  1KHP A;  4G54 A;  1MIR A;  2VHS A;  1PAD A;  2Y6E A;  1ME4 A;  2NQD B;  1MEM A;  1GCB A;  3KSE A;  2AS8 A;  3S3Q A;  2AUX A;  2FO5 A;  3C9E A;  4YYW A;  3IMA A;  2HXZ A;  2AIM A;  3N3K A;  3N3G A;  3ZUA A;  1SNK A;  4X6J A;  2OUL A;  3USV A;  5JA7 A;  1ATK A;  3IHP A;  1U5I A;  1PPP A;  2DCC A;  3LFY A;  4XR7 A;  3KKU A;  4BGF A;  2GHU A;  1NPZ A;  4X6H A;  1PPD A;  1CPJ A;  1F2B A;  4QH6 A;  4MZS A;  1AU2 A;  4W5B A;  4NV8 A;  1AU3 A;  1YK8 A;  1M6D A;  2AVW A;  3MOR A;  4QBB A;  3F5V A;  1EWM A;  4MSX A;  2YJ2 A;  1ME3 A;  4AXM A;  4I05 A;  1QDQ A;  1MS6 A;  3KWB X;  3HD3 A;  2OZ2 A;  2AU1 A;  2DCA A;  3MTN A;  3B79 A;  1CB5 A;  2ACT A;  1BY8 A;  2HHN A;  1NB3 A;  2DC7 A;  5JH3 A;  1CQD A;  1A6R A;  3DF0 A;  2CIO A;  2DJG B;  2P7U A;  4PAD A;  1CJL A;  2CB5 A;  1CSB B;  1GLO A;  2XU1 A;  1TL9 A;  2R9N A;  4KLB A;  4OEM A;  2B1M A;  3K24 A;  2P0R A;  3CH2 X;  1PIP A;  1BQI A;  2G8E A;  3OVX A;  3D9W A;  2R9O A;  2WBF X;  4YVA A;  4N8W A;  2AUZ A;  1CS8 A;  2FQ9 A;  3H6S A;  1S4V A;  2YJ9 A;  2NQA A;  2B1N A;  1Q6K A;  1NQC A;  3KX1 A;  1AYU A;  4OEL A;  3IEJ A;  1PXV A;  4W5C A;  3PDF A;  3KWZ A;  1GEC E;  2G6D A;  3O1G A;  3N4C A;  1QOL A;  1X9Y A;  3AI8 A;  2FT2 A;  1AYV A;  3I06 A;  2DCB A;  4DMX A;  4K7C A;  1E2T A;  1EWL A;  3CH3 X;  1STF E;  1KXR A;  2GFO A;  1EWO A;  4FK5 A;  1GMY A;  4W4U A;  4I04 A;  1PE6 A;  4BS5 A;  4PP1 A;  2OP3 A;  4N79 A;  5CVO B;  3QSD A;  2HH5 A;  1NL6 A;  1DF0 A;  4YV8 A;  1QXP A;  3OIS A;  4FJC A;  5CVM A;  4GUZ A;  3TNX A;  2AYO A;  4CDD B;  3QT4 A;  1AU4 A;  5CVN B;  2PAD A;  2E02 A;  1W6F A;  3H8B A;  9PAP A;  2R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...