2QW6A

Crystal structure of the c-terminal domain of an aaa atpase from enterococcus faecium do
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
85
Chain Sequence
YDVISAFQKSIRGSDVDAALHYLARLVEAGDLASICRRLMVIGYEDINPAAAARTVNAVLAAEKLGLPEARIPLADVVVDLCLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the C-terminal domain of an AAA ATPase from Enterococcus faecium DO.
rcsb
source organism Enterococcus faecium
molecule tags Hydrolase
molecule keywords AAA ATPase, central region
total genus 33
structure length 85
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 2qw6A00
3GLIA 1SXJA 3U61B 1A5TA 1JR3A 3GLHB 1IQPA 3GLGA 1SXJD 3GLFA 3ZH9B 3GLIE 2R9GA 1SXJE 1JQJC 3U60B 1XXHE 2CHQA 3GLFB 1XXHA 3PVSA 2CHVA 3GLHA 2QW6A 3GLGB 1SXJC 3U5ZB 3GLHE 3GLIB 1SXJB 1JR3D 3GLFE 3CTDA 1JR3E 2GNOA 3GLGE 3BGEA 1XXHB
chains in the Genus database with same CATH superfamily
3GLIA 1SXJA 3U61B 1A5TA 1JR3A 3GLHB 1IQPA 3GLGA 1SXJD 3GLFA 3ZH9B 3GLIE 2R9GA 1SXJE 3U60A 1JQJC 3U60B 3ES5A 1XXHE 2CHQA 3GLFB 3U61A 1XXHA 3PVSA 2CHVA 3GLHA 2QW6A 3GLGB 1SXJC 3U5ZB 3GLHE 3RC8A 3GLIB 1SXJB 1MW5A 1JR3D 3GLFE 3RC3A 3CTDA 1JR3E 2GNOA 4CHDA 3GLGE 3U5ZA 3BGEA 1XXHB
chains in the Genus database with same CATH topology
3GLIA 1SXJA 3U61B 1A5TA 1JR3A 3GLHB 1IQPA 3GLGA 1SXJD 3GLFA 3ZH9B 3GLIE 2R9GA 1SXJE 3U60A 1JQJC 3U60B 3ES5A 1XXHE 2CHQA 3GLFB 3U61A 1XXHA 3PVSA 2CHVA 3GLHA 2QW6A 3GLGB 1SXJC 3U5ZB 3GLHE 3RC8A 3GLIB 1SXJB 1MW5A 1JR3D 3GLFE 3RC3A 3CTDA 1JR3E 2GNOA 4CHDA 3GLGE 3U5ZA 3BGEA 1XXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLI A;  1SXJ A;  3U61 B;  1A5T A;  1JR3 A;  3GLH B;  1IQP A;  3GLG A;  1SXJ D;  3GLF A;  3ZH9 B;  3GLI E;  2R9G A;  1SXJ E;  1JQJ C;  3U60 B;  1XXH E;  2CHQ A;  3GLF B;  1XXH A;  3PVS A;  2CHV A;  3GLH A;  2QW6 A;  3GLG B;  1SXJ C;  3U5Z B;  3GLH E;  3GLI B;  1SXJ B;  1JR3 D;  3GLF E;  3CTD A;  1JR3 E;  2GNO A;  3GLG E;  3BGE A;  1XXH B; 
#chains in the Genus database with same CATH topology
 3GLI A;  1SXJ A;  3U61 B;  1A5T A;  1JR3 A;  3GLH B;  1IQP A;  3GLG A;  1SXJ D;  3GLF A;  3ZH9 B;  3GLI E;  2R9G A;  1SXJ E;  3U60 A;  1JQJ C;  3U60 B;  3ES5 A;  1XXH E;  2CHQ A;  3GLF B;  3U61 A;  1XXH A;  3PVS A;  2CHV A;  3GLH A;  2QW6 A;  3GLG B;  1SXJ C;  3U5Z B;  3GLH E;  3RC8 A;  3GLI B;  1SXJ B;  1MW5 A;  1JR3 D;  3GLF E;  3RC3 A;  3CTD A;  1JR3 E;  2GNO A;  4CHD A;  3GLG E;  3U5Z A;  3BGE A;  1XXH B; 
#chains in the Genus database with same CATH homology
 3GLI A;  1SXJ A;  3U61 B;  1A5T A;  1JR3 A;  3GLH B;  1IQP A;  3GLG A;  1SXJ D;  3GLF A;  3ZH9 B;  3GLI E;  2R9G A;  1SXJ E;  3U60 A;  1JQJ C;  3U60 B;  3ES5 A;  1XXH E;  2CHQ A;  3GLF B;  3U61 A;  1XXH A;  3PVS A;  2CHV A;  3GLH A;  2QW6 A;  3GLG B;  1SXJ C;  3U5Z B;  3GLH E;  3RC8 A;  3GLI B;  1SXJ B;  1MW5 A;  1JR3 D;  3GLF E;  3RC3 A;  3CTD A;  1JR3 E;  2GNO A;  4CHD A;  3GLG E;  3U5Z A;  3BGE A;  1XXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...