1SXJD

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
328
structure length
328
Chain Sequence
PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASQCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator 1 95 kDa subunit
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 92
structure length 328
sequence length 328
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00004 AAA ATPase family associated with various cellular activities (AAA)
D PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjD02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjD03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjD01
5FBWB 1K6MA 5DHAA 2AKYA 1LF5A 2J3EA 4YXWD 3MMPA 5AJZA 3DDCA 4PC2A 4QM6A 2DBYA 3IHWA 1T0JB 4G1UC 4G5OA 1W4RA 1W36C 3OIVA 3FDIA 2FN4A 2ANBA 4IDHA 3TNFA 4OI4A 4FCVA 2QAGB 4GOXA 1GG2A 4B73A 5GJVC 2ODBA 2O0JA 1NJFA 4BPBA 2F7SA 3ASYA 1YR9A 2ZR0A 1P6XA 4S35A 3B13B 4B3XA 5L3SB 3KQHA 4Q7JB 4ESHA 3LQRA 3ADDA 3NHBA 2RHMA 3KKOA 3QXSA 2VP2A 3PUXA 3CLVA 3B78A 4JLBA 5JRZA 3MJHA 1I4TD 4WZ6A 5K8UA 3FMFA 4NYMR 1AS2A 2ORWA 4XH9B 4OQMA 1II0A 4PR0A 3CIOA 4QHYA 1KK1A 3ZS9A 2D7DA 1G4UR 5B2ZA 5FL3A 4FWHA 1D9XA 2ZSBA 4BFWA 4URVR 1OSNA 1FX0B 1TF2A 2FG5A 2HYIC 3CRRA 3VAAA 2EFCB 4FMDB 3FPAA 4FN5A 2JCSA 1BH2A 2VP4A 1V5WA 2YWEA 4IW3B 1QHHA 3QPVA 4MRSA 3SBDA 1W47A 1M7BA 3FMIA 2VF8A 1KK3A 4A8JC 2KE5A 3ZQ6A 2FNAA 1SHKA 4GP7A 4LBVA 4NP6A 1G3RA 3DM5A 1Q21A 1KDOA 1JALA 1L7VC 1RFLA 3IPYA 3QXCA 2IXEA 4P4TA 4P3YA 4TMXA 1YZNA 2FZLA 2H16A 4Q4JB 3EZ6A 1OH5A 4OJQA 1E9FA 1QDEA 2J0UA 1G7SA 4HATA 4RSGA 4XOIA 4BEJA 4PSAA 3U7HB 1FOEB 2GKSA 1XMJA 2O8CB 2JLUA 2JLZA 2Q3HA 2C98A 4DVGA 3ZVRA 1TU3A 2GJ9A 3LH5A 1S8FA 4D0NA 2Z6VA 5EZ5A 3G5UA 3DKPA 1ZUHA 2PLRA 2REXB 2ZUCA 1VKJA 3X1DA 1KO4A 1DAIA 5FR2A 1KY3A 2WWFA 4PSKA 1KDTA 1GVNB 1QHNA 3A1SA 3QPUA 3A1TA 3KKMA 2J87A 3GEIA 2QP3A 4I1OA 2JLXA 2FSIA 4BFUA 3T1OA 5SZHB 3FYHA 4QBHA 4F4JA 2JIZD 1M7HA 2QMHA 2E9SA 3WBKA 4FINA 4O0MA 3NIBA 4JJKA 3BGWA 4ERNA 2OLJA 2G9NA 4F91B 4B6FA 3BBPA 3ZD7A 1CJVC 4ZKEA 3THYA 2Z4SA 4IFEA 4R7ZA 4GMDA 1OF1A 1OXSC 1QVRA 3BXZA 2XTMA 5EUMA 1XF9A 1R0XA 5KU1A 3RS5A 1XNJA 3D7MA 4L5BA 4ON9A 1EWRA 1S3GA 3O8RA 3GD7A 2BEKA 2OXCA 1G8HA 1P9NA 2G77B 2UZ3A 1QVAA 3QKRA 5DN6D 3KQUA 3EASA 1QHHB 5FUVA 4HLCA 4ZIRA 1EFUA 1OJLA 1DARA 4Q03A 4YMUA 1UBCA 4EKDA 4KXFB 3K8YA 3VHLB 1KNQA 1I2DA 2VYFA 3BC1A 2XB2A 1J7KA 1OXXK 1U98A 4NCJA 4B34A 4LHZA 3AKEA 4BLQA 2F9LA 1R6BX 2XX3A 1KSHA 1NVUQ 3KL4A 3UANA 2J0UB 1FUKA 721PA 1T5LA 4WXRA 1Z0FA 4Q9LA 4PAOA 2OSBA 3E2IA 1WB9A 1A2KC 4WVFA 2CLDX 4KI0A 3NHAA 4TTPA 4EJSC 1FP6A 1XD9A 3BWDD 4HSEA 3DMNA 1MO6A 1W5TA 4Z51A 1XPOA 5DN6A 2EVWX 2YKGA 1JB1A 1KI2A 4JLKA 2MSDB 1UKZA 4TQ9A 4AY2A 2V6ZM 3RWOA 3R9WA 1AK2A 2O8BA 4BZQA 4H9GA 1W0KD 2GETA 1ODFA 4Q1BA 5EUQB 4XWAA 1VMAA 5DO9A 3BGEA 3OFND 1W0JA 2PJZA 4TMTA 3ADBA 2R65A 5D3MA 5FOTA 5A0FA 3T34A 1NLFA 3CX7A 3SQXA 5CM9C 3VX3A 4ZI3A 3OZXA 1BOFA 4DBLC 5DNYB 1JAHA 5EP4A 3C8UA 3VKHA 5FPYA 1E79A 2FMXA 5HTKA 2RAPA 4C30A 5AUPB 4LSGA 4F7WA 3THYB 1JNYA 1KKLA 1X1RA 2JA1A 4LGMA 5FUXA 1XBTA 3CF0A 2GF9A 5EQTA 1CR0A 4M0LA 4IDPA 1U9IA 4C4PA 2AN9A 1GAJA 3UIEA 2O8DA 3ZVLA 3QKRB 4V02A 4N0EA 4BGDA 2X19A 3QEOA 4QGGA 2QAGC 4ZIRB 3GEEA 3GJXC 2Q9CA 3AF4A 3LW7A 3ZVMA 3HYTA 3MSXA 2J0SA 1FNNA 1QBKC 2R6FA 3LXRA 3TW4A 1JXOA 4DCSA 4OHZA 3TSOA 3I72A 4LBYA 2A5FA 5JEEA 1DS6A 4UXIA 1IONA 1E0AA 2ZS7A 2QPOA 4JLNA 1JPNA 5C4GB 2RMKA 4DCVA 2N42A 1JJ7A 1ZIOA 2BBSA 1U8ZA 2AWNA 3LA6A 4YMVA 5FTLA 3RHFA 3Q7QA 4LK2A 1JI0A 1KI1A 1M2OB 3AUYA 3CRVA 3AVXA 4I1SA 4JSYA 4XD7D 2QI9C 3WRYC 1LNZA 1DO2A 1S0UA 2CBZA 2ZI3A 3IIKA 3QVUA 2GAAA 4DLWA 3HU1A 1KTVA 2IS6A 4AG5A 4QFMA 3LDAA 4C0SA 2PZEA 4GT1A 4B2LA 3ADCA 2JDIA 3DO6A 5KYKA 2AR7A 3R8FA 2ONKA 421PA 2O8BB 5E7IA 2FDCA 3SI7A 1SVSA 4DLRA 3G0HA 1XJCA 2F1IA 3BB3A 2NO9A 4B44A 3X2SA 3GQBA 1E9RA 2FFBA 3SJZA 1M7GA 1F5NA 4V0NA 1GL6A 4RD3A 5D3MB 3GJ0A 1HT2E 5D3QA 2BDTA 2FF7A 2WV9A 3L0OA 1SKQA 3M6AA 2EFHB 4W5HA 1PLJA 1U8AA 2F9MA 4LHXA 5JEDA 4XWKA 3Q72A 2RGNA 3O8BA 2GK7A 1Z47A 3AUXA 3NEYA 5TB5A 1KOFA 1OYYA 2O5VA 1BKDR 4A6XA 2XZPA 4AYWA 1GRQA 1XPRA 4UXJA 1KKMA 3PITA 3GFTA 4QBFA 4I4LA 5TMPA 3VNVA 1NMZA 1ZM9A 5LD2B 3AEZA 1XJQA 5JJKA 3ZVNA 4KFUA 1QHIA 2FPLA 3CO5A 4YLGA 5FOXA 2O8DB 4QG7A 2AFHE 5K8TA 1Z29A 2K5UA 3KFVA 3GLFE 4JLMA 2WWGA 4TMKA 2G3YA 1XFAA 2YV5A 3SNHA 4XTRA 4DLZA 3EZ7A 1AQYA 1KAOA 4Q47A 4DLSA 1G3MA 1G5PA 1UADA 3EC2A 4RKFA 1SVLA 1AS3A 1BMFD 3UMRA 4BZXA 1OYWA 2FFHA 3OAAA 3WMFA 1JR3E 1SXJD 4CVNA 2BWJA 1MABA 2FSHA 5AK0A 3DL0A 4BECA 1ZD9A 2O52A 4ACBA 4TYNA 2H92A 2CEAA 3U3JA 1DE0A 3HYRA 4RFSA 2YZ2A 4TQAA 3HWSA 4D0LB 3CNLA 5LBIA 4TLBA 4Q4HA 4OK6A 1ZRHA 4KITB 1KNXA 3T35A 5SZJA 4Q9KA 4QM7A 1E6CA 1ZNZA 2A9KA 1G4AE 1W36D 4IOJA 2JLSA 4OKSA 4POAA 2WSSA 4RD0A 1SXJA 3RAPR 5KDOA 3QG5A 2YC4C 2PCLA 2P0EA 2YOGA 4LC0A 4D81A 3QY0A 2WWIA 4BFYA 4TTQA 4CEIA 4TL7A 4BASA 4S2EA 4MKHA 5B58C 1Q12A 3BS4A 5JRJA 3VNUA 1OXVA 3C4JA 4Q9JA 4ZV4A 2PMDA 1NBMD 4TLCA 1YZLA 1NVVR 2ZE8A 1G7TA 1H8HD 2C2HA 2WHXA 3LFUA 5AUOB 3AP2A 1G8YA 4RZ3A 2GCOA 1NVWQ 5E7MA 4IDOA 3FMOB 2O0HA 2X8AA 3PFIA 1NN5A 1Q1EA 2DYKA 3B8HA 4W7SA 4QGHA 4OHXA 1ZW6A 1NSTA 4ZCIA 5JS8A 2DZNB 1KSGA 1DAHA 1E1QD 3SC3A 2LKCA 1D2EA 3LW8A 2VSFA 2NZ8A 1D2NA 1QG4A 1DAGA 2IC5A 5FTMA 4FMCF 5FH9A 4G3XA 3B2EA 5FTKA 3AF2A 2JATA 3WHLA 3QF7A 3FOZA 3K9HA 2XB4A 2ZJ5A 1NBMA 3GJ4A 1H8HA 5CLLA 3I92A 1MABB 3SHWA 3Q9LA 5DYGA 3MD0A 4JVMA 1DELA 3KJGA 3U2QA 4B2PA 1TMKA 4A9AA 3FFBA 3WMGA 2YYZA 2JLWA 2CJWA 2BIFA 2H8KA 3BFKA 3AP1A 1LB1B 1ZNXA 3L0SA 1KDRA 4JBYA 4RCYA 3IO3A 1X8KA 4A4DA 3AM1A 1IXSB 4QNMA 4RFSB 2IHBA 1AA9A 3U3OA 1K5GA 4EPVA 4Q4HB 3NC1C 5EJEA 2R44A 2F43A 1E1QA 2D2FA 3CNNA 1IXZA 4LJ9A 3QBTA 2H17A 2WIAA 2WOJA 1F2TA 2VH5R 5H1YA 1DAFA 4KBFA 4LHVA 1TTTA 1NN3A 4LJ6A 1EFRD 5FBRB 1G19A 2R9VA 4A8JA 5JJLA 3PVSA 4QGAA 1SXJB 1UFQA 3AVVA 1A82A 3VR1A 1RRPA 2CE2X 5F2EA 4AYXA 2G0TA 3I3SR 4CEIB 2BMFA 2V1XA 4TYWA 1Q1BA 4GPTA 2JJ2A 4PZYA 2DR3A 3W8NA 4CDGA 4QL3A 4RZXA 2F1JA 3A1WA 1WCV1 4AKIA 3E5HA 4YMWA 3X1XA 2HF8A 3QXHA 4QGFA 1AQUA 1N0WA 4P31A 1KJYA 4OL0A 4PAMA 3EPKA 1QG2A 2OFOA 4F38A 3RC3A 3SDZA 3O47A 4PHGA 1QF9A 1KSFX 3GJ3A 1OKKA 5E4FA 2W6IA 4PO9A 2HJVA 1WRBA 4LCBA 4ZO4A 4US2R 1EFRA 2VA8A 4KHZA 1JJVA 1UKYA 4MKIA 1W7AA 4MDFA 3ZH9B 2WJJA 1GFIA 2B21A 1GRRA 1HURA 2JEOA 5FPKA 3EZFA 1JR3A 3M0EA 5KHOC 1IJEA 1XZQA 2KBEA 4M1WA 1R0ZA 2R62A 3V00A 1Z06A 2AFIE 2XITA 3QF4A 1HYQA 2PLFA 4HB4A 1I4DD 4Q7MB 3RRMA 5E3HA 4TYYA 1GUAA 4LDJA 1ZBDA 5EXTA 3WP0A 2CJWB 4OHWA 1CJKC 1NVMA 3BH6A 3M4YA 4LRWA 1YU9A 3BIFA 2MSCB 1U9IC 4ZDWA 2IYTA 1ZM4A 1N6RA 2GA8A 4TL8A 4TSFD 3WYAA 4LJ7A 2F43B 4LYHA 1DG1G 2PBRA 1QHXA 4AKEA 2OESA 2V54A 1CTQA 2DWPA 1YRBA 3JVVA 3RNLA 5AWFC 2I4IA 4R98A 2CHGA 5JHHB 1ZINA 4HAUA 1OT3A 4WZBE 1Y3AA 3I5XA 1IN5A 5B57C 4OHVA 3L43A 3SHFA 2ZE7A 5B30A 2HT1A 3EWAA 4ZDKA 4EDHA 2OCYC 3N2EA 2FH5B 4B43A 1EFCA 1VG8A 2VP5A 2ATXA 2AWOA 2DVWB 4MRPA 1IAQA 4X8LA 2FX3A 3TKLA 2SHKA 4TSFA 3FE2A 1P2VA 4JT4A 3GLFB 2FPMA 2KI5A 3E70C 2GBLA 3X1YA 2YWFA 4HAZA 4LV8B 4D4LA 4KFTA 3N5CA 2W0SA 2X77A 2RCNA 1U90A 4B76A 3T5DA 4IDNA 4URUR 1J99A 1T0HB 2P2LA 2C9CA 2GHIA 3VKGA 5F9FA 4CZ2A 1U2RA 3N70A 5HR5A 2D3WA 1VCOA 2B6HA 3TE6A 1ZNWA 3BK7A 3WYGA 4US1R 3H0KA 1T8TA 4QNRA 2QORA 3MRSA 5KSOA 3C7KA 5C18A 1TADA 4IOLA 1D9ZA 1OHHD 2HV8A 1NMYA 2PL3A 2RGNC 3FMPB 4MRNA 1RE0A 2QG6A 2PT5A 3IGFA 3GLIE 4XVRA 1DEKA 1CRPA 2WJGA 2QUZA 4Q7KA 4ILEA 3UKDA 1D6JA 1ZCAA 1NKSA 2C96A 2IYVA 3P4XA 2VHJA 5BW8A 1DAMA 3GCGA 3TSWA 2WMNB 4BLRA 3CB4A 3M1IA 1G20E 4C7OA 2QBYA 4D4KA 4E07A 2OFXA 3REGA 1JQJC 3REFA 4MDEA 1G7CA 1R8SA 2QAGA 4RKEA 1KI3A 1S1MA 3EXAA 1A1VA 4US0R 2GXAA 1NP6A 1OHHA 3A1UA 4DUGA 2NMVA 1H8EA 3MJRA 3VR6A 1I2MA 2IYXA 5G41A 1MOZA 2ODNA 2V9PA 1G1MA 2GXQA 2ZUDA 2ORIA 5BN5A 2GCNA 1J70A 1F60A 2A5DA 2DWQA 3C14C 2XJ9A 1JEDA 3FKSA 3GLHE 1PUIA 4QJ4A 4WOPA 2XNDA 2ZUBA 3WRXC 4RZ2A 4P32A 4E03A 5BYKA 4LYAA 1WBBA 3PENA 4GFDA 5BN3A 5JHGB 4E5UA 3ETLA 1U8YA 2IW3A 4DB4A 2QROA 3R9XA 1XXHA 1ZM7A 3OESA 4A2WA 3SYKA 3QKSA 4C0HA 1XB2A 1E2DA 1E2FA 1IHUA 3AVUA 1IY2A 5DHFA 4DCNA 4R2HA 2C9YA 1P2UA 2CL7X 4XTCS 2HDNB 1GTVA 2ZVPX 2YJTD 4NCNA 4Q4JA 4XIGS 3H4MA 5HZKA 2C77A 2OBMA 4LPSA 3RANA 2WPDD 3NC0C 3QIAA 4JKIA 3W3ZB 2C95A 1DPFA 2IS4A 4AD8A 2FJUA 2ZJAA 1N6LA 3PV0A 3ONWA 4UJ3A 4DIEA 4PPFA 5IHPA 2CE7A 1NLZA 3CPJB 3SS8A 3W34A 3RSOA 2OFWA 5DI3A 1NRJB 1G64A 3F0TA 4JYCA 1BYUA 4EQ6A 4C7OB 2QBYB 1Z6AA 4MKFA 3B9PA 4Z1MD 3CWQA 3PEWA 3KKPA 1PLLA 1IQPA 3CH5A 4ABYA 1NF3A 3IUYA 1NKTA 1E2HA 4I81A 3TVTA 4AYTA 1TU4A 5CYPA 1NY6A 1FQKA 1PVOA 1UKEA 4JJZA 1ZUIA 5ANRB 1E9CA 2WPDA 2VRWA 4A0GA 1NG9A 3FHTA 1MR3F 1MV5A 3UPUA 2P67A 2R9GA 3UWKA 5J4HA 5DH9A 1C1YA 1RC8A 1GZSA 1U99A 2ZRFA 1L8QA 2ZS8A 2ZTSA 3R20A 1ZC4A 2B92A 3RS7A 3WXMA 2IYQA 2DFKB 4TL9A 2ZJBA 1XD2B 4W5WA 3W6PA 2JGNA 1IN4A 3SBEA 4B2IA 3EPLA 1AN0A 2J0VA 2REBA 4Z1MA 4BLOA 4KODA 2NO1A 1XEWX 2O8FB 2A7QA 2WKRA 2A3RA 1XXHB 4P0TA 2RB4A 2XZOA 2DFTA 2VSOA 4RD2A 1TF5A 1X3SA 3QKSB 4X8HA 4A82A 1Q3HA 4M21A 4AI6A 1GL9B 4A2PA 2WKPA 1T4GA 4DWJA 4EFLA 5CIWA 1Z63A 1VCNA 3NH6A 3CZPA 3T1TA 1YZTA 4MUAA 3RDPA 2CVHA 2FGKA 3GLIA 2ERXA 1XTQA 2CHQA 3ND8A 4M4SA 4IOKA 4CEHA 2WICA 3RRYA 2E1RA 2BJVA 1LS1A 5B64A 2XTNA 3QJYA 4DLYA 1FUUA 4GZMA 1E1RA 2IT1A 3ZZTA 3CH4B 1KJWA 1G6OA 1R4AA 3LXXA 4DDUA 4OI1A 3B1YA 2B7CA 5KSPA 3WMEA 5H8WA 2YWHA 3MWLA 1OH8A 2XAUA 5DI3B 4EQ6B 1CR2A 2R6CA 2GEDA 1E0JA 1ETUA 2ZRLA 2Q9BA 4RFVA 4RVCA 4U02A 5EE5B 2PZGA 2RKOA 3A6PC 2CVFA 3IEVA 4Z8XA 1E2JA 2IWHA 3BJIC 4NCHA 3VKWA 2LKDA 4Q21A 3QPWA 3GLHA 2IYLD 2OM2A 2CK3D 2QT0A 3V4RA 3RLFA 5KO2A 2QMUA 4C0JA 1CJUC 221PA 3IBGA 4XSGA 2FE4A 3CM0A 4U5XA 1YRAA 4HLUA 3ZZUA 3ND9A 1OXUA 2CCJA 3H84A 3PUYA 4XVUA 2WTUA 1FW6A 2VLIA 2PZFA 2IS2A 5CB8A 3T15A 4Q1FA 1JEEA 1L2TA 3AF3A 4QRHA 3LX5A 2WM9B 1T91A 2VF7A 2ZRMA 4OYHA 4AG6A 3NVAA 2YVUA 4Q18A 2C9OA 4MGYR 1P9WA 2BV3A 2CK3A 2QRZA 4I99A 1R10A 2AD5A 1OIVA 1A5TA 3GLIB 1XTIA 3LVQE 1CF4A 1W0JD 4JYBA 2EFEB 4MYCA 3QEJA 2A2ZA 2OV2A 4CEHB 3O8CA 3OE7A 4N3NA 4ZDJA 2ZYWX 1NLYA 1T3LA 4HAVA 1NMXA 2GJ8A 1N3BA 1E0SA 4DLUA 4HUQA 1UPTA 2VPPA 3THOA 2GJKA 4HAWA 1Z6YA 1E79D 2Q3MA 3L82B 4L15A 2GBLC 3U6KA 4GL2A 2Q6TA 3D8BA 3I62A 2G1KA 1N5IA 1E2KA 1KY2A 2ZETA 5A4JA 2ZRJA 4PZZA 2CNWA 1JBKA 3BB1A 2R8RA 4BLTA 4A15A 1OFHA 1VG0B 1KSJA 4TN1A 1CR4A 4JT2A 2OO7A 3RVBA 4IJMA 3CONA 3RSLA 4PZLA 1F48A 1M6NA 3UMSA 1IJFA 5FR1A 2VL7A 2WAYA 2G0NA 1KZGB 3IDQA 4NZYA 4KV9A 2ZJOA 5CYOA 3S1AA 3UWOA 1W48A 4C0QC 2Q9AA 3GLHB 2MMCA 4BQSA 3JZAA 5H68A 1XDBA 3EWSA 3THWB 2PH1A 3CRQA 1YKSA 1XMVA 4LJ4A 4OQXA 2QGZA 1DADA 4A1FA 4Q9HA 2GILA 5C46F 3BH0A 5CB6A 4CGZA 3GJ7A 3K9NA 1G5TA 2LWIA 5KNDA 4A92A 3CX6A 1T3SA 1ZYUA 4GITA 2ZSFA 1L4UA 5JWHA 2Y8EA 2PT7A 2RHDA 4G5QA 1P3JA 3DM9B 3LO5A 1EFHA 2QEQA 4BLPA 4LJAA 1T3HA 2UKDA 1FTNA 2I1QA 2ODWA 4WA7A 2JDID 2W2XA 2ZSEA 3KZ1E 3R7WA 2W00A 1G8GA 3LY5A 3DZDA 2J41A 2ZREA 5F9HA 1JPJA 2MMGA 3MHVC 4LRSA 1HA3A 5HPYB 1E2EA 1ZD1A 4MGKR 3RS4A 4KBGA 4B32A 5BN4A 2ZI9A 4KYIB 3I8SA 2HLDD 4D4MA 2JLRA 5KPDA 3CW2A 3ZYCA 1Z3IX 2GF0A 3TAHA 2JLYA 2J7PA 2QQ0A 3B1VA 3U4QA 2VQSA 4DT1B 4HUQB 1Z0AA 4Q02A 5EP2A 4Q48A 4NDZA 4AKGA 1G3UA 3K0CC 5G3ZA 1G9XA 1E9SA 4F4IA 2GAOA 5FI0B 5FOVA 4TQUS 2A30A 2G6BA 3DZ8A 4IXNA 3LRPA 5HCIA 5JWOA 1Z6TA 1X6VA 2P6RA 1G5RA 3B5JA 3SFVA 2ZIAA 2ZU0C 4U00A 1S1CA 5FFMA 2H1LA 2HLDA 2YHSA 3S1AB 4DJTA 2HCJB 3AF0A 3B7GA 3V4FA 2O0KA 1X86B 3AJIB 3K1JA 4H1VA 2OUKA 5J4LA 4BWYA 1S2MA 2HUPA 621PA 1CKEA 3TMKA 4MYHA 2ZI6A 2EYQA 4CW7A 1W44A 5A5GA 3OAAD 2ORVA 1GKUB 2FGJA 4AIIA 1WDTA 1B0UA 1X1SA 2A78A 1EG7A 4NONA 2ZRBA 3BRWD 1EWQA 1VECA 1Z6GA 2ZITA 1NVVQ 5JMTA 4D82A 2KRKA 1N6OA 4LBZA 3OIYA 4PC3A 2IA5A 5J4VA 3KDSE 4DCTA 3EW9A 4QJ3A 3R7WB 1UEJA 1P61B 3B6EA 2KB0A 2DY1A 2CLSA 4C2TA 4HZIA 4Q19A 4HEJA 1TUIA 3VLFB 4URZR 2WSSD 2IYRA 1GKIA 5HE9A 4MUBA 2NO6A 3I61A 5HKKA 4TYQA 2DZOB 1TEXA 2WJVA 4Q66C 2OCPA 4UXHA 4QHTA 3KTAA 2N46A 3AGQA 1R0WA 3SOPA 4LZZA 4KVGA 3VX4A 3BB4A 5TXGA 3TSZA 4HAXA 3EPHA 3ICEA 5KPJA 4LY6A 2J59A 4OJKA 3D6TB 3QG1A 1KAGA 4B3BA 2FSGA 4IHQA 2WJYA 2LCFA 1YZKA 1YQTA 5F3WB 3PEYA 4CT4B 2ZAOA 2YWGA 3TQCA 2QGNA 1CU1A 1XCMA 3FTQA 4PANA 5K8IA 1LV7A 5FUYA 2IYYA 3IKJA 4TYPA 2FPKA 1M74A 1HH4A 3ZQJA 1IN6A 2VTKA 3NH9A 2IBMA 1AGPA 5CM8B 5DE3A 5KDLA 1YE8A 1Z83A 4Q1EA 1RJ9A 3MUFA 3AF1A 3DMDA 4JBWA 1NJGA 1XWIA 1QRAA 2ZQ5A 4A36A 3A1VA 4NCIA 4FWGA 4KSBA 4B3DA 1ZC3A 2DFNA 3FHCB 2J5XA 3AVWA 4RY2A 4O2RA 2XOKA 4PO1A 1P2TA 5F98A 1Q3TA 1Z07A 1RW4A 2IK8A 2QL6A 2ZRGA 2OHFA 2DFLA 1DO0A 1AIPA 1UBFA 2VP0A 1VHLA 3TIFA 4BZPA 3RS0A 4NYJR 2A5GA 1B23P 4B3FX 3EIEA 3DVLA 1N5JA 4IEIA 1JAIA 3L8YA 5E95A 3QUSA 4HLQB 3KQKA 2AX4A 5KSYA 4D26A 5HE8A 2IEYA 4V0ME 1NN0A 1JECA 4HUTA 2PX3A 1NN1A 4RZUA 1D2MA 2WWHA 3HR7A 1TQDA 2IF2A 4FWTA 2EYUA 4LJYA 1U0JA 3A4MA 3KTAB 4HLUC 4BRUA 2GVDC 2JJ2D 5M04A 5C1BA 2D74A 821PA 1RIFA 3FWYA 1U0HC 1E2PA 1SKYE 2FU5C 2WSMA 1XP8A 2HT6A 3K70B 1RYFA 4NE2A 1QHSA 5EP3A 4QC2A 3PR1A 3GEHA 2Q0HA 3IBYA 3SFZA 4BEBA 1OKKD 2BBOA 2UZIR 1XD8A 1Z08A 2AXPA 3UK6A 2W6ID 1Q44A 1UF9A 4QKQA 1KO8A 1R5OA 1IBRA 3LVRE 3NG1A 4OI0A 4C2UA 4B33A 1ZD8A 5CLQA 3AV0B 4PHHA 1VPLA 1CJMA 1XTRA 2XEXA 4LV5B 4BFTA 1GITA 2F1HA 2BC9A 1JR3D 1J2JA 4WXPA 3Q7PA 1HUQA 1P73A 2CMKA 3U3MA 1TX4B 2VP9A 4A3VB 3HU3A 1ZP6A 2J0QA 1SVWA 3ZIAA 2EWWA 2P65A 2OAQ1 1G7RA 3AKCA 1RJ9B 3C41J 2ZSDA 3CRMA 3ZDQA 5CITA 1GNQA 4RD1A 3G82C 2QY9A 3GLFA 2ZJZA 1HE1C 1HQYE 4M9SA 4ZDIA 1E9EA 3AH8A 1MKYA 2Z4RA 4YC7A 2WVJA 2N1BA 2Q3FA 1W2HA 1G3QA 3ECCA 4FMCB 3ZLJA 1CJTC 1YR8A 3KXIA 4PO8A 1OFTA 2QT1A 1ESMA 1IM2A 4FD2A 3CX8A 2ZRPA 1ZVQA 4IVQA 2BMJA 4UNSA 2QW6A 1DBSA 1ZJ6A 4DSTA 1OFIA 4BFXA 4EFNA 3KX2A 5FBVB 2VBCA 4A2QA 4V03A 1A7JA 4YMSA 3U61B 1KO1A 4QOSA 3UXMA 4Q4AB 3NBFA 4NMMA 1AJEA 1C9KA 2GXSA 2RGCA 1Z0JA 2BCGY 3KUDA 3RRNA 3VR3A 4JVSB 3P1JA 3SN6A 2EFGA 2IYWA 3X1WA 5JLJA 4XSHA 3NWJA 2YNMA 3B60A 3U7FB 4DSNA 3A58B 2RGEA 3NBZC 4DHEA 3W6NA 5EXXA 1Y63A 3N2IA 2DPXA 2HXSA 3I5YA 1G21E 4LHWA 4BUJA 2QP9X 1LS6A 1EGAA 5CDFE 1YVDA 3KJIA 3QBVA 4CT5A 2QSYA 4MITA 1Q57A 2FA9A 3OF5A 3NBXX 1TPZA 1YHNA 3CKLA 5G53C 2W58A 4M9ZA 3K09A 1ZIPA 3V9PA 4RCZA 2ZYUX 4IFBA 1RZ3A 2WZQA 2I1VB 5EE0A 2HF9A 2F55A 1E69A 5C4MA 3I1FA 3NDBB 3LV8A 1IXRC 4JLJA 4LV6A 3GMTA 1KI6B 1T8UA 2DWOA 1NSFA 3VQTA 1P62B 2QE7D 2IEZA 2VSXA 2BBTA 1S3SA 1ESNA 2QPAA 2OXRA 1CR1A 2Z5FA 1DAKA 2NZJA 2CL6X 3GJ8A 4U7DA 4LX0A 4TMVA 4MYUA 3LQQA 2CL0X 1MRSA 1N6KA 4BFVA 3O8DA 3LAWA 1LFDB 3PG5A 1CBUA 2C78A 4X8OA 4ZKDA 2CXXA 4G5SA 3AQ4A 3IQXA 3DKVA 4L4UA 3T1QA 3EIQA 4DUGD 4PPQA 1H8ED 1KI8A 5UKDA 4W9MC 1KO5A 2AL7A 4UNPA 1XEFA 1ZM3A 4KJZA 2V4ZA 3KFXA 3NXSA 5FBQB 5TV2A 2QE7A 4ZCMA 4CYMA 4PQFA 1E94E 4IKEA 4M22A 3HU2A 3FKSD 5E7JA 1WP9A 3IHLA 1AM4D 1TQ4A 2XNDD 2AK2A 4B3GA 2NIPA 3R8CA 2ATVA 3AP3A 3B1XA 4BFZA 3Q8XB 1XMIA 3C5HA 3F3YA 1KGDA 2VP6A 5GVSA 2BM1A 4MRRA 3UATA 2EFDB 2JJ1D 2WJIA 1QZMA 1KO7A 2F1RA 3DPUA 2FWRA 4W5JA 4FW9A 1GILA 2IYSA 1CP2A 3PEVA 4KFRA 4LHYA 1S96A 4ITRC 2BOVA 2QTHA 1UDXA 1MH1A 2ZJ8A 4DDWA 4C9BA 1J8YF 4ESVA 1YZGA 1YZUA 5FPHA 3VR2A 1TL7C 4IXMA 1FFHA 1XD2A 2FFAA 1XPUA 1G18A 1E4YA 3BOSA 2EWVA 2D06A 4YDHB 3K0CA 1M8PA 1VG1A 4DDTA 3TRFA 2YOHA 1P2SA 1WA5A 1OB2A 3K70C 1NI3A 2JJ1A 4MH0R 3OEED 3QKTA 4HLDA 1RRFA 1N2CE 4ZCLA 1KK2A 3Q5EA 3WNBA 1PLKA 2IF0A 2UVQA 3LBNA 4OQLA 1LY1A 4LOAA 2XNSA 1FL9A 1SVKA 3LBHA 5L3QA 1W2GA 1XJ0A 3K0AA 4D6PA 1ONBA 4LBWA 1N5LA 1RKBA 5KSZA 4DCUA 2FV8A 3BAFA 3VR5A 2GXUA 3U3RA 4HDCA 1WXQA 2QP4A 3CF6R 1X8JA 1KHTA 4Q9IA 2WIBA 4JL6A 1Q1QA 3AVQA 4PXAA 3TK1A 2X1VA 4DB2A 2C04A 3OEEA 1QZXA 4V0OA 1II9A 2D2EA 4FMDF 3RRZA 3PXGA 5EE1A 2X2EA 6Q21A 3U3KA 2ECKA 2B8TA 3EARA 4F4CA 2WMOB 3QE0A 3BE4A 4G5RA 3BD9A 4B47A 1SZPA 4UKDA 1XTKA 4XVQA 4LRTA 2JLQA 4EUNA 1W5SA 1TQ6A 4Q5IA 4LJ8A 3SJAA 4TLDA 1T6NA 3T12A 4B74A 2NPFA 4DLVA 1PV4A 1KMQA 1AKYA 1GDDA 1P7CA 4XJXA 2REOA 1COWD 1ZU4A 2PEYA 2ZRHA 4G0NA 2R2AA 5TDHA 1XMSA 3QI2A 2ZI7A 1F2UA 1OFUX 1R5BA 1ZM2A 2FOLA 1Q20A 2L0XA 5AR1A 4RD6A 5AJYA 3SZRA 5J47A 3VTKA 3FFAA 5C2JB 4PQYA 1HE8B 1QHYA 4KFSA 1D5CA 2H5EA 4OQFA 2HYDA 5FPSA 4FWDA 4CRWB 1E1RD 2PCJA 4DSUA 2PEZA 4F93B 1G17A 1ZNYA 4KSCA 1RYHA 4M9XA 3GJ5A 1K5DA 1E2MA 2P5TB 2V8OA 2XXAA 2VEDA 2QTVB 4YXWA 3AVYA 2AK3A 1IOZA 1KDPA 1COWA 4NTZA 4O25A 1Z5ZA 5HCNA 5L3QB 1II8A 3BH7A 3SYLA 4UQOA 2W83A 3AVOA 2XJ4A 4A6PA 2Q21A 1EX6A 3K0AB 2V6JA 5JS7A 1Z0KA 3KUCA 1WQ1R 1R8QA 1VCIA 1N6IA 4P4UA 3CWZA 5LB2A 3W8RA 3FGNA 1NY5A 3RC8A 2EQBA 1XRJA 1Z0IA 2GDJA 1VTKA 4TLEA 3RWMB 4MKGA 4TZ6A 2ZYVX 2J1LA 4NPHA 4GZLA 2IYUA 2YOFA 2AHOA 1IY1A 2FEMA 4DZZA 3NTUA 4R2IA 1NVXQ 3W5IA 4ACAA 5FOWA 2ZR9A 4EAQA 1X8LA 1BYIA 3KB2A 4A0RA 2C8VA 3A8TA 4KU4A 5EE9A 4B35A 1R5NA 4PHTA 3HR8A 3MG9A 4ARZA 1MRNA 1OIWA 4MQBA 3C5CA 3CR8A 4PC6A 4URYR 3WNDA 2FEOA 4JVNA 5DLQC 2ANCA 2BCJQ 1HV8A 1T9HA 2QM8A 2QMOA 2QQEA 4E09A 2QENA 3SR0A 4KLZA 1ANKA 1P75A 3GP8A 4DC9A 4ZI2A 4LJ5A 4PAQA 3JZMA 2WKQA 3IEUA 5JI3E 3THWA 1SVOA 2R6DA 1CRQA 3D31A 1VHTA 4L8GA 4PSVA 2F3TA 1F2UB 2OCBA 3HP1A 2JJ8A 3KB1A 4IVRA 3HJNA 3Q5DA 4MGZR 3OE7D 1GL7A 5JJIA 2DCUA 4NKRA 4FXPA 3KJHA 3QXJA 1N0VC 4Q1AA 4C0BA 2FZ4A 4HAYA 3QVVA 1N0UA 3DEFA 1A2BA 1CLUA 1G6HA 1G41A 2X2FA 1Z8FA 2Z43A 4D2IA 2H57A 4GDFA 2BHRA 2A5YB 3LD9A 3PQCA 2CNWD 4B3CA 2XXAB 2ZM5A 5KDDA 3W6OA 4X8MA 2GRJA 1II8B 2ZE6A 3C15C 3WNCA 5GADl 3U4QB 3U7GA 3K09C 4JLPA 3LLMA 2F3RA 4QBIA 3A4LA 1U0LA 5JI2E 4OK5A 2BKUA 1E9DA 3KW6A 2QM7A 2D4HA 4R71A 1XTSA 5IDVA 1C1KA 3SYNA 2JIZA 4DT1A 1FZQA 4PQRA 1E32A 3DOFA 2OAP1 1W46A 4IRUB 2VHCA 2R6GA 2WOOA 4K81B 4GRAA 2RGXA 2CHVA 1FQJA 4QXAA 8OHMA 1RPZA 1Q1ZA 4IEEA 4LPKA 3U44A 5K8LA 1E4VA 3CTDA 1TNDA 4ARZB 5AUQA 5DI9A 2ZVQX 4EPYA 1UBEA 1OXTA 1NG1A 2CLCX 4N1AA 1Q0UA 1VYVA 3PEUA 3PUWA 1P60A 2GESA 2QU8A 3X1ZA 4M1YA 5EXSA 3ZZ0A 2CCKA 2FSFA 5JECA 1CEEA 4LYFA 1E96A 5H70A 2C5LA 5FOSA 2WWWA 2XZLA 2NTYC 5GJCA 2FFQA 2W2VA 5LDDC 4J0QA 3P26A 3LBIA 1GWNA 1G8FA 4JLOA 3TAUA 3A36A 4TT3D 4DXAA 4KAXA 2I3BA 2ZEJA 1EX7A 2P5SA 1KIMA 1OLOA 5TVKA 2J7PD 1WE2A 1S9HA 1CIPA 1XCGB 2AD1A 3GFPA 3K0EA 1S9DA 3QKUA 2WWXA 3VU9A 2KBFA 1FPMA 2EU8A 3GFOA 1ZAKA 1KK0A 3HPRA 3BFXA 5KOYA 4YQFA 1VIAA 4G5GA 3LLUA 1SULA 4HDOB 3RS3A 4OK3A 4C3ZA 1NL3A 3ICQB 4NH0A 1UEIA 4JLDA 1SXJE 3ZD6A 4Z8YA 4EIWA 2J9RA 4HI0E 3RS2A 3Q3JB 3AVTA 2EW1A 1O87A 2NO0A 1W0KA 4TT3A 2IXGA 3I4LA 1OE0A 3WHKA 3FVQA 4Q00A 3OFNA 4FIDA 4EFMA 3IILA 5CJ2A 3OEHD 3CPHA 4B48A 2QAJA 3VMFA 2OLKA 1AGRA 2P6UA 3VFDA 2Z0MA 4Q01A 3B1WA 3THXA 4OHYA 4JN6A 121PA 3U44B 4HB3A 4WZAE 4M1MA 1FMJA 5FI1B 4FCWA 5JWRA 3MGCA 3P20A 1L4YA 2OT3B 5J4KA 1N6NA 2MSEB 2BEJA 2RGBA 4JKYA 3L2OB 1U94A 4WAUA 3EPJA 1KI4A 1NBME 3L0IB 4D25A 2B8WA 5JSZA 2NO7A 4UNNA 3T06B 3TQFA 3OEHA 1G291 3EX7C 2OCAA 2GWHA 2ZS9A 3DOEA 4JLAA 5FOUA 2J45A 5EXPA 4V0LA 1KJZA 1IN8A 2GTPA 2ZYTX 4M1TA 5GJWC 2BM0A 1DVRA 2V55B 3QXXA 2G1JA 4M1KA 1H65A 1MT0A 4O2LA 2XSZD 3VU9B 4I1UA 3KXKA 4QBGB 5HKKD 1I4LD 1FTSA 2KJQA 2WJHA 1GNPA 3IPXA 3WP1B 3UMFA 3W5JA 2BKEA 1U81A 1J90A 3Q85A 2NG1A 3NBYC 4XD7A 4B71A 4DIDA 1XEXA 2JASA 3PUZA 1IY0A 2ZPTX 1SVIA 3SJBA 3K70D 3I32A 5J4YA 1R0YA 1OPXA 1EESA 1XU4A 4IDQA 4DLTA 2ZRAA 4K8OA 4JLVA 4M1SA 2PJRA 4L9SA 3GLGE 4JZKA 3EAQA 2O8EA 3QOFA 3CF2A 3CR7A 4DDVA 3VR4A 2GZHA 3RABA 3PJRA 1MO4A 3PIRA 3TJZA 4NYJQ 2XSZA 4LYJA 3F8TA 1CULC 2PMKA 5DGXA 2GEUA 3ZJYA 2XGJA 4NBSA 4MRVA 4DSOA 5FPTA 2H18A 4GP6A 1SQ5A 3BFVA 4M2LA 4KVAA 3SU8A 2V7QD 3K53A 4JBXA 5IK2D 1X37A 1GSIA 3ADKA 3KJEA 5DIFA 4WW0A 1M1YE 3QNUA 3K0FA 4TL6A 1JQLB 5BWMA 3THXB 4LC1A 4R9UC 3K0SA 2G88A 5IRCD 5JCZA 2WBLC 3FB4A 4GBMA 3AB3A 1WF3A 2GK6A 2ODEA 5HZHA 1SVMA 5KNBA 2XOKD 4B75A 4CIDA 2BJWA 4Q1DA 1TF7A 3TUIC 4UJ5A 2C99A 2OEPA 3B9QA 2JLVA 2OBLA 2ZR7A 3CRW1 3OHMA 2AXNA 3P27A 1XX6A 5JSZB 1P9RA 2GCPA 2ZRNA 4GOKA 4P4SA 3B1ZA 1E2IA 3QQ5A 3AGPA 1PJRA 2OBNA 3C16C 4AKHA 2V7QA 5IK2A 5DYIA 3A4NA 2GVZC 1XCPA 3IQWA 3KXLA 3LX8A 1WBDA 1MO3A 5J40A 2B7BA 4C0AC 1N6HA 1BMFA 2IS1A 4AK9A 2ZJ2A 2IUUA 5FBLB 1E3MA 5BYJA 1HY3A 1D8TA 1W49A 2P3SA 2NOAA 2QZ4A 1CS4C 2ERYA 3LWNA 4M9QA 4D0GA 1XEXB 3MCAA 2ASEA 2VHTA 1TUEA 5FUWA 1LF0A 1TAGA 4JL8A 2ZRDA 1NNEA 2DHRA 3VHXA 1BS1A 2O8EB 1QHGA 3T1VA 4H1UA 3F5FA 1KI9A 4NU0A 2HCBA 1HEIA 1LVGA 1GRNA 1Z6XA 4MGIR 1W4AA 3ASZA 4Q4AA 3TR0A 1Q22A 1E99A 1G3IA 2E87A 4HB0A 3TVDA 4GMXA 1KZ7B 5DISB 3HPQA 4FMBB 4URWR 3ZIAD 4HDQB 1FMLA 4BE7B 3K0FB 5SZKB 4E22A 4TTRA 1VG9B 2F6RA 4TMWA 4NCKA 2C03A 3NDPA 4M53A 3TUJC 1S4QA 5CJPA 2VO1A 2ZRIA 2ZROA 1VYUA 5G3YA 3I8XA 4QJ5A 2XTZA 1GM5A 1GOTA 2AKAB 3OIWA 3MWYW 1EK0A 2V3CC 1T5IA 4WIAA 5KUTA 5BQ5A 3FHOA 5CK5A 3EA5A 3WBJA 4PFSA 4Z54A 4P4SB 4NYIQ 5G40A 4L9WA 5BXQC 4EPRA 4N0DA 4DRZA 4NHOA 4AURA 3MWJA 4GNKA 2GJSA 3TR5A 2W0MA 5P21A 1UJ2A 3GJ6A 1RRGA 2ONJA 4DEXA 3B85A 1KI6A 4CEJA 3KQNA 1Z2CA 3EC1A 4K46A 3WY9A 1ZU5A 4JMPA 3TLXA 3MWKA 4ASUD 4UNQA 4A0HA 4PX9A 1SGWA 3GPLA 5FL7D 3KKQA 2DB3A 1GKYA 3AKYA 4LI0A 3QENA 1UM8A 3GLGA 4I1VA 1N5KA 5CIQA 5LB4A 2ZAMA 3U5ZB 2GEVA 1E2LA 2WWYA 1KMHA 3R9IA 1F6BA 2GNOA 3BERA 3EIHA 5L3RA 1K8RA 5KNCA 1UKVY 3U7EB 1MO5A 2RGGA 2GCOB 3NEJA 1SHZA 4JIMA 4M8NE 2ZI4A 3ZGXA 1VDZA 4EPTA 1W36B 2W2TA 4DEYA 1E9BA 3W90A 3MLEA 3U6BA 1NIPA 1FNMA 3KKNA 3TGPA 4ASUA 2NGRA 4PPNA 2ZI5A 5FL7A 1AZSC 1BIFA 1US8A 5AJXA 5CK4A 3EA0A 1XXHE 1E0KA 2J46A 1RRCA 2PX0A 1OH7A 3SQWA 1LTQA 2OILA 1OIXA 1FP7A 3MAAC 4Q4LA 1TEVA 3J81k 4NYIR 2BMEA 3UG6A 2IUTA 3CNOA 2NQ2C 4TWZA 5AJWA 1F3OA 4JS0A 1OH6A 2HJGA 1G8PA 4NL4H 1HTWA 4KYUA 2NPIA 3LNCA 1W4CA 1VCMA 4C0KA 4O3MA 2YINC 5ELXA 2D7CA 2IUSA 5LD2C 2J7KA 2ZE5A 1XEWY 2YC2C 4Q7LA 2HXYA 3BORA 5FTJA 1J8MF 1N25A 1E2NA 4IOMA 4MYTA 2V1UA 1F2TB 4CEJB 1GIAA 2QA5A 4LWZA 2KWIA 5GVRA 3TBKA 1E9AA 1HQCA 1AZTA 2A5JA 1Z0DA 4A8JB 4TMZA 1YZQA 3P4YA 2IYZA 3L8ZA 4Q1CA 4OI2A 521PA 4Y0AA 3WYFA 2CCGA 2RGDA 3W9YA 3IIMA 1P4SA 4EPWA 1BO6A 5EZ6B 3GLGB 2QSZA 3KQLA 3EG5A 3HDTA 4YMTA 4V0MA 5L8VA 3W3AA 5GJBA 5EP1A 1KMHB 4PC1A 4A0FA 2GJAA 3P32A 3E1SA 4AWXA 4C0LA 4DKXA 1XTJA 1YR6A 4FI3C 4PTLA 3CPEA 5FTNA 4EJSA 4Y0VA 1AKEA 1ELOA 1TQ2A 4B6EA 4EPXA 2BMDA 2DWZB 1AS0A 4QHSA 5DSZA 1RVDA 1C4OA 3AKDA 4AC9A 4F92B 4BLSA 4KLNA 2QMEA 4JSTA 4V0KA 1W4BA 4GOJA 1WMSA 3H2YA 1EXMA 5LPNA 1ZMXA 4PPGA 1KI7A 4HZUA 3MFYA 2QRNA 2GZDA 2VIIA 1CXZA 3IO5A 1US8B 1E98A 1R7RA 1E2GA 4ZPXA 3K9LA 1NIJA 1O3YA 1UAAA 1UDWA 3OIUA 5AUNB 4GSYA 1Z28A 5SZIA 3B82A 3QF4B 5TY0A 4D4JA 3UG7A 4CF7A 3DHWC 1A4RA 2TMKA 5L3VA 4WBSA 4G01B 4BRWA 3QSYA 1E2QA 3D3QA 4JVLA 4URXR 2RH5A 3TH5A 4YDSA 1OW3B 1YR7A 3T5GA 2P6NA 3A37A 1M34E 4TLAA 3ZS8A 1OV4A 4BFSA 2H7VA 1JR6A 3SJCA 1V43A 4PC7A 2CDNA 4KO8A 1OB5A 2ZJYA 3H1TA 3PUVA 4GI7A 4RJLA 2G83A 2W6JD 1PZNA 2ZU6A 4P33A 2IHYA 3CBQA 4OQNA 1IN7A 1DAEA 2V6IA 2QN6A 5JCPA 5AJVB 1VIYA 2ZANA 1W1WA 4LUCA 3TUZC 4FWIB 1G16A 5L3SA 2JAQA 2HEIA 3K9GA 1P5ZB 3CUEF 1ZCBA 1EFTA 2QTFA 2GZAA 2IX3A 2R6AA 2QNRA 4M1OA 2ZXUA 4FCTA 4OBEA 4DLXA 1JXMA 2Z83A 2IWRA 3JVUA 3EZ2A 4UNRA 3U60B 1VYTA 3H86A 2O8FA 1UBGA 3AVPA 3NKVA 2IXFA 4EJSB 2W6JA 3I73A 2VHQA 2ZRKA 1HT1E 1Z22A 1Z2AA 1ZUNB 5JZVA 3PCRB 4KCGA 4TZ0A 1GP2A 1P72A 5JFGA 1FX0A 1SKYB 4NYMQ 3SEAA 4D80A 1GNRA 4HYYA 2D62A 5KTYA 4JL5A 1KYIA 1LW7A 3RYTC 2BVNA 4HZUB 5TARA 4RD4A 5JBQA 2BBWA 5IT5A 1DTSA 3IIJA 3FKQA 1YJ5A 4HB2A 4IVPA 2IL1A 1PUJA 4YONB 4L16A 3CZQA 5J5CA 5CDFA 3SE0A 3TW8B 1SXJC 2OG2A 4MA4A 2WAXA 4II7A 5EE3A 5IF9A 3T61A 2KSQA 1R2QA 2VHUA 2RGAA 2ZSAA 2OE2A 4XWOA 4PHFA 2QPTA 3L0PA 1N6PA 1DG3A 3EZ9A 2ZRCA 2O8CA 1DOAA 1XZPA 2OZEA
chains in the Genus database with same CATH superfamily
4OYLA 5CTAA 3M4ZA 3DDCA 3F7TA 4AF7A 4JOCA 2Y3IA 1KH1A 5AVXA 1AA6A 1JLLB 4ESOA 5A2GA 1GG2A 4RTRA 2ZR0A 4R0VA 5K2OA 4RVSA 2WWRA 3JQRA 3PUXA 1WSDA 4GXTA 5KX5B 2Z7JA 3JV7A 3ZDRA 2X2OA 3C58A 3OOHA 3MC1A 3CRRA 1U7UA 1QO0A 3UV6A 1YSCA 3U4DA 1BD3A 3QLJA 1A2OA 5EZQA 4DUZM 2JP7A 3OQPA 4CHGA 5CCXA 3ROZA 3U7HB 1YE5A 2REXB 5A3JA 1V1MA 4DXHA 3I4FA 3PUHA 2V3WA 5FYDA 3QPUA 3SSAA 3KKMA 4LTNA 3I2FA 3FZYA 2JKYA 3UUWA 3L4BC 4N76A 2R4JA 3BGWA 5DNYA 2PS3A 2Q46A 2VQEM 3N2GA 5B1DA 5EHGA 2EX4A 3W05A 4DS3A 3KD3A 2QMQA 4UOQA 1QVAA 4PYQA 4CM9A 1XMQB 4X6UA 1QPBA 2EEPA 5HIJA 3DZCA 5DNAA 4KN9S 4M60A 1YOVA 1KSHA 4BAGA 4BQPA 3E2IA 2FUKA 3CSUA 5HIIA 3SZMA 3TJMA 2C2KA 3DMNA 5IJ9B 4DV6B 4ND3A 1OTRA 2BFCA 2K7FA 1WXHA 1W87A 4P58A 3OOYA 5GKNA 1HT0A 4OTZA 2EDCA 1GU1A 2NO4A 2KNZA 3OECA 2C42A 1QRTA 3GL9A 4DR7M 1FRNA 2DT5A 3ZVLA 2WVAA 3C8HA 2OQRA 5GIOE 1U8TA 3BSSA 2Q9CA 1PFQA 1OV6A 5DXAA 2J0SA 3EXEA 3TW4A 1WZCA 4IUYA 5MGBA 2RMKA 4IJEA 1JJ7A 1FBNA 1K7YA 1CSEE 4GI2A 4LK2A 5DVZA 4B3GA 1DO2A 2CBZA 3GFVA 1YNSA 3JW8A 2GZRA 3DO6A 3M5PA 1OA1A 3HB0A 2O8BB 5E7IA 3R76A 1PAUA 1GL6A 3AL2A 2Q41A 2YX1A 1BMQA 3L0OA 2EFHB 2F9MA 1JHYA 1NUPA 3Q72A 4QYXA 4FDTA 4PBTA 4XB1A 4ALJA 3PGJA 1JNXX 5HKBA 3KFVA 5DLEA 2YV5A 3ENQA 3MERA 1I8TA 1ZRSA 4RF2A 1SU4A 1XZAA 4LRSB 1G5PA 3Q6IA 4BZXA 1UINA 4IUDS 3WMFA 1URPA 3TOXA 4D96A 4XZ3A 4GLLA 5JVDA 3LUFA 4H60A 4E46A 4Q4HA 3WHPA 2HK7A 2YIVX 5SZJA 3GCZA 4XVCA 4KGVA 2I67A 3QHPA 4EO7A 4Z4FA 3HJSA 3PJEA 4LC0A 4BFYA 4BO6A 4ZAYA 4MKHA 5FEMA 4E21A 3UXEA 1OXVA 2NTVA 4ZV4A 2HREA 3V3KA 7ADHA 4WK2B 5CT6A 2HZ7A 3FMOB 1T6ZA 1HE4A 4QGHA 1DAHA 2LKCA 2VSFA 1VBMA 2JATA 4X3CA 2PTGA 5TPZA 2XB4A 2ZXEA 1XAJA 1UT5A 3W5VA 1E8MA 3VPXA 3G79A 3CZ4A 4A4DA 2HM7A 1XC8A 1WG8A 1TM4E 1GZ3A 2FMIA 4HFJA 5DNWA 4YRLA 4EG3A 2RKWA 2D2FA 3QLVA 1A5BB 1M2EA 3LWBA 4Z7OB 3MK31 4XE5A 3HJUA 4FUTA 3DE5X 2CVZA 1NPYA 1Q1BA 1IMJA 5LWQA 1AGYA 3L27A 4ND6A 4F38A 2COUA 1HT3A 4J0DA 4OMFG 1EFRA 1UKYA 4U2KA 2CLEB 2IHZA 4BZZA 5FPKA 1HURA 1JR3A 3WLRA 5KHOC 1J39A 4Q15A 4PLYA 2XKBA 1T3GA 1ULZA 3LY8A 4LDJA 1SKMA 2CJWB 4QOHA 1NVMA 3I9OA 3ZWCA 4ZDWA 1ZM4A 1RQGA 4LJ7A 1AQLA 5J9FA 4LNHA 4EHLA 4W4TA 3ROTA 2VYVD 4EI7A 1ZD5A 1JLHA 2IEGA 1CUUA 4D3FA 1VG8A 1YJXA 3NUGA 2PQ0A 3GLFB 3D4NA 3DCYA 3RRJA 3BXWA 1Z7BA 3F9RA 3K1TA 4JI5B 4HPXB 5LUAA 1TO6A 5C51B 4LFAB 1EUCA 3KT8A 1QMGA 1RKXA 1GXSA 4EBBA 1NMYA 3KWJA 5CFMA 2DTXA 4LRQA 2J09A 3FMPB 4KO1S 1FNBA 2QNIA 1CF9A 3MLAA 4ILEA 4GH5A 1NWHA 1M73E 3RSFA 3REGA 4GOOD 5E3IA 1S1MA 1TLLA 1T8RA 4MP8A 2IH5A 3VR6A 4YJ3B 2ODNA 5DMHA 1U5AA 1F60A 1E7RA 3NKLA 2R1VA 3CF6E 5KX5A 3BHJA 3OZVA 5B7GA 1THTA 3VYSB 1ZIXA 4ZVRA 1LFAA 2RHCA 5MN6A 4KMOA 4CHTA 4DV2B 2WPDD 3GXOA 1HG0A 2AZ4A 2C95A 1I24A 5ED0A 4WJZA 1U31A 4ZT7A 3FTNA 4FZJA 1YMVA 2XTAA 3EVFA 3CWQA 4J6EA 2AKEA 1PLLA 1IQPA 1VDDA 1E3WB 3C3JA 3L26A 1K4YA 4BAUA 1F4VA 2PKRA 5BN5B 1SHUX 4KIUA 4QUIA 5ISMA 2POCA 1MJGM 2BR4A 3P0IA 3R9XB 2RB4A 3L8CA 4AY4A 3GLIA 1JFSA 3OQ6A 1DRKA 5KWJA 4HDSA 1J8DA 4EG1A 3LYAA 2VRCD 4X6YA 2NTEA 1G6OA 2C5BA 3RTEA 1W0CA 3VKUA 3FSEA 2PUVA 3CNHA 1LLUA 2GQ0A 1E0JA 3E6AA 3JRWA 2ZCJA 1AQIA 2CVFA 3LPCA 1RAGA 4NCHA 2Z1NA 3IUEA 1SCUB 3EZXA 2HRDA 3OC6A 3ND9A 2ESRA 1DJQA 5JXHA 2BISA 2VF7A 1Z4IA 4J49A 2YVUA 4RX1A 3WGOA 2I3DA 4H7HA 1RBMA 1UPXA 2EJBA 2WK1A 5AKZA 3RJ9A 3TIXB 3A27A 2EFEB 3SS9X 3R5TA 2KEBA 5TQVA 4IQ8A 4GO1A 1QK5A 1W93A 3I62A 2QD4A 2TMGA 4HQKA 3GC6A 4HL6A 1A71A 1LTHR 4JGGA 3AHCA 3UWOA 3KETA 3K3PA 4U7WA 3M4XA 1ZGHA 1W8DA 5K3EA 3WK8A 1ZVMA 3H2ZA 5IN5A 4CGZA 3GJ7A 1X14A 4QO8A 5F2KA 2O2EA 2BD0A 5A5VA 3BF7A 3DM9B 4BLPA 5GONF 3OWOA 2Q5CA 4N3CA 3DZDA 4LRSA 4FZVA 5BN4A 2AYZA 3CO0S 5LDHA 1C4KA 2C07A 3L04A 3LZDA 3ZCRA 1XQWA 1NVAA 1QHEA 3ZX5A 3K0CC 4AECA 1G9XA 3ISVA 2Z8XA 1Q19A 2O3TA 2G6BA 2WUDA 4IXNA 3JQ7A 3NHJA 4YCBA 4E30A 3KVOA 3C3BA 2OUKA 4NABA 13PKA 4BWYA 1UFVA 4FI3F 3OSZA 2FEKA 3IE2A 2ORVA 4ZPJA 1NI4A 3NASA 2I91A 4M9UA 4Y28F 2EGHA 2AE2A 1T34A 3EC7A 1ZSNA 4PC3A 5J4VA 1ECFA 1VRWA 1E3LA 4ZT2A 1KIAA 1N4DA 1UBTS 4REQA 1SAYA 1W4LA 1U1EA 2BONA 4OL9A 3VX4A 1MGOA 3EPHA 4OFZA 3OZFA 4OJKA 2B5WA 2YWGA 4MJXA 1TT5A 2ZB4A 2PX4A 1C7QA 4F9GA 3MUFA 1DC4A 1ZOIA 2EKKA 2WHPA 2H5IA 4NCIA 1GARA 4AMZA 3BIWA 4HNGA 4C7XA 2PPLA 2DFLA 1MNAA 3QFTA 1VHLA 1OWNA 3RS0A 1X1AA 2PXXA 2AX4A 4WEOA 5KSYA 2O2IA 3DFMA 2O7VA 1AUVA 1R8XA 4RZUA 3A4MA 5D6NA 3IV6A 2H4JA 3AUSA 2WSMA 3EGEA 2G28A 1XD8A 3AM4A 1BXZA 3TG8A 1WW3A 1KO8A 4G1CA 3BMQB 1MHPA 2XTJA 1HUQA 1AC5A 1B93A 2J0QA 1GZHB 2ZBFA 2R4UA 2QY9A 3GLFA 3AH8A 3MJVA 2WVJA 3KHTA 2OWEA 1DNPA 3OTOM 3NHSA 4FCCA 1QB8A 1T2CA 3OFVA 4PN7A 1IBLB 4L02A 2B3TA 2BCGY 2IYPA 4YY3B 4QA9A 3GD5A 3X1WA 4X45A 4CFZA 3KEOA 2W71A 3MN1A 2QP9X 1YVDA 3KJIA 1YZYA 5G53C 4YJ3A 1L5RA 2ZJ4A 3UYLA 1H0HA 2WZQA 4MVJE 4K6CA 3JS5A 2BMVA 4DBGB 3VU3A 3VQTA 2F3UA 2NZJA 4JNKA 2W4IA 4TMVA 2JK1A 1G8KA 2XB9A 1SXQA 3A10A 2JFNA 1EP3B 3EIQA 5UKDA 3D8UA 2IDMA 5ITTA 2V4ZA 1DTWA 2MSLA 4PRLA 2XNDD 2AK2A 4IDFA 2I1WA 3QVTA 4FFNA 4OHRA 3DD5A 1FLAA 3DNFA 3KUXA 1L2CA 3VSAA 4W5JA 1GILA 1CP2A 5KQMA 9LDTA 1WULS 3WV4A 1EUYA 1AKWA 3JQAB 4NXNB 1TL7C 4IXMA 4RLQA 2EWVA 5E38A 1D2RA 3V7WA 2J4DA 3MIIA 2YOHA 5A4IS 3PTLA 4HXEB 2FSVA 4U0KA 4TV8B 5DGIA 1CJBA 2ZBRA 2O3JA 1N5LA 4RGVA 3FUXA 5H02A 3BAFA 1FCJA 4PVCA 4JL6A 1G21A 1WX1A 3HCCA 1SNYA 1XTBA 6Q21A 1M54A 3NPMA 3HVHA 3QE0A 4PCZA 1QYXA 3FWKA 1T6NA 3E4RA 2JLAA 3HCFA 3FUWA 1NUAA 3VTKA 5LP6B 1HFEL 1VLMA 3DT8A 1VGVA 1DQNA 2HYDA 4LGVA 1E1RD 3WMRA 4RV9A 2EUCA 5A62A 3GJ5A 4IHJA 4FKZA 1QNLA 1L5HA 3VGPA 5HCNA 2XBMA 4XFKA 4ZYZA 2ON6A 3ZHOA 3KUCA 2WLTA 1H5NA 2PBLA 5FLKA 1FP4A 4R2IA 1X8LA 3KB2A 3QOWA 5EE9A 2DRIA 3WGVA 1F14A 4G4JA 4P92A 2DWLA 1R6VA 4GSKA 3SR0A 1PKXA 1PBNA 4N5HX 4BX3A 2WKQA 3EWIA 1W59A 3D31A 4PSVA 5BSTA 3FGZA 1RAAA 3CUUA 4ZVQA 4Q1AA 3C5VA 3M81A 3DHVA 3OTHA 3WQHA 1Z8FA 4FFOA 3EPRA 3PQCA 2PZJA 3FCCA 1L1EA 2W82A 3W6OA 5LJIA 4B3HA 4HQFA 1ZD4A 2JIZA 2CYBA 3DTTA 3EGDB 1ID1A 4Y6OA 2WOOA 3ILSA 2N47A 4RM2A 2P30A 1KU0A 5B36A 3BD7A 4HYQA 5AUQA 3B12A 4UU8A 4N1AA 3PUWA 5HQJA 3FCYA 4RAQA 1TJPB 1KJ9A 2C5LA 3DQZA 4J0QA 1VLHA 4ZYUA 3TAUA 4B08A 5CA0B 3RUAA 5IYZA 1VJ1A 4HTFB 4DR6M 2AG1A 3ITDA 3W9UA 4FYHA 3GOQA 4E5PA 3TG2A 2EW1A 1GCAA 3ESDA 1D0SA 1I1QB 2FOIC 1XLTA 1OE0A 4IV5A 4G0YA 1SM4A 1A77A 1UFRA 2PY6A 1ISMA 4YRDA 2HHCA 1AGRA 2QUKA 5DLDA 4Q01A 3HZJA 5KWSA 3RSCA 1GNVA 4HB3A 2R7LA 4L4YA 2AMYA 1RNLA 3WK5A 1XMOM 2V55B 2JC3A 1UP7A 3NXKA 2PSDA 3FUVA 4P81A 1L7MA 3RG8A 3F67A 1QE3A 2ZP1A 1T6BY 1G98A 2WTEA 4L9SA 1T1IA 4JZKA 4V1CI 5D8DA 1VLQA 4MRVA 3EGCA 4C14A 4JBXA 1Y34E 3KVYA 5BWMA 2AXEA 1O9BA 1VJTA 1Z5CA 3TZBA 1POXA 4Z9AA 2XOKD 4OXXA 4UJ5A 4Q3NA 3D5QA 3KC2A 4KIWA 5IXYA 4GEWA 2YMLA 1DQYA 2B7BA 1KVUA 3O1HB 3WZLA 2BEVA 1A50B 1JG3A 4DIUA 5I8PA 4LQCA 2VHTA 1B0PA 1LI5A 5FUWA 2XIQA 1BS1A 2HCBA 3MGGA 1TYAE 3PGA1 2L17A 3E05A 3V8EA 5JAZA 4X54A 5SZKB 2H29A 2C03A 1TK3A 4EMUA 3A14A 3GX1A 4MQ5A 1K8ZB 2W11A 2G5CA 5JO9A 1KDYA 1LPNA 4EPRA 4C6TB 4AURA 4AL4A 1H3EA 2ZBKB 3GJ6A 1WTAA 1ZU5A 3VR3D 4UNQA 4TRMA 2LD4A 1UM8A 5DPMA 1X7GA 3BERA 1VC2A 1XYYA 2RGGA 1L5NA 4M8NE 4YGXB 4RIIA 3JPWA 3STUA 3T4UA 1E9BA 1HK7A 1IUNA 2XCOA 3HNRA 4UMVA 3NMUF 3UA3A 5D3ZA 1OBVA 4PPNA 2XMCA 4QFCA 1LTQA 4GLFA 3VSCA 4Q4LA 5ETJA 1PV2A 3HXMA 4NYIR 2HBZA 4JBNA 4ZOLB 5MN4A 8AT1A 1ESCA 2GZMA 1RHRA 4Q0MA 3BXPA 4FYWA 3TIIA 1HG1A 5U4XA 1Y8RA 4YP1A 1RJFA 4IHAA 3OG9A 3T9FA 4OAQA 1DAOA 1BHO1 4KR2A 3GLGB 3KQLA 3I2YX 3ZDBA 3DYBA 3OCXA 3K30A 1C9EA 1ESZA 3E1SA 3FCXA 4DKXA 1YR6A 1DIOB 1PJJA 1SQGA 2R6JA 1TQ2A 3ZWXA 3UENA 1JR2A 4DV3B 3ZU5A 3EZGA 2FPIA 3HL4A 3FAZA 3H2YA 3E23A 2GZDA 3UK7A 5FWYA 4FYKA 5K05A 4MW0A 3PPVA 3DBLA 5ALNA 3NWLA 3KIPA 1WXFA 3RE8A 1KS9A 3OCCA 2X86A 4UREA 2H7VA 1ZH2A 4ZHQB 3TPZA 3DVQX 2ZU6A 1XG5A 4KXLA 2Q9UA 1J9ZA 1T13A 3B6MA 3LCRA 4EHDA 1XCOA 4YRJA 2R6AA 3CG4A 5DLPA 1HGXA 5FT9A 5EA2A 3TMYA 5LC1A 1FJHA 3DFIA 3EFBA 2GZ1A 2PGNA 3DV0A 4KCGA 4MVJD 3UMCA 2QRLA 5E6UB 4N41A 4HYYA 4YAIA 3Q8WA 4PX2A 2WAOA 2HHAA 2P9EA 1SXJC 4II7A 1X7WA 3TO5A 3ZE2B 2DEUA 4EHFA 4W6QA 1H2RS 3IG8A 2OM6A 5AQ1A 2ZRCA 3HHEA 3AY7A 1A8HA 2FEWB 4YXWD 3JALB 5F2NA 3IHWA 2FN4A 4C7JA 4NU5A 4YUVA 5EIEA 2G3QA 2XCLA 4B73A 5GJVC 4XB6B 2OZVA 4Q7JB 3KLPX 1LSJA 5AI8A 3NHBA 4D98A 2RHMA 3CG0A 3Q0IA 3CLVA 1K86A 1AS2A 2KHZA 5FL3A 1PM5A 2BE7A 2BFDA 4QATA 1TECE 4GZ3A 4XLZA 1H4TA 4BO4A 3EGDA 3FMIA 4ARUA 4TMXA 3W5IA 4ZN6A 1YZNA 5LYJB 3KLMX 4GMQA 4OLHA 1X80B 5DW3A 2HU8A 1IIBA 4ER0A 4DV4B 4X71A 4YTEA 5THQA 1O03A 3IA7A 1UAGA 5F7OA 6AT1A 1VEJA 3S8EA 2C2YA 4LDRA 1KDTA 2PGXA 1GZVA 4PLFA 3H1EA 4KEAA 2AOXA 2B1RA 3AJ8A 1NHGC 3E3MA 5B6PA 2NSHA 5CFLA 5EJ8A 1M0TA 2P90A 1OF1A 3OM8A 2OPBA 2XTMA 1VMDA 3SLGA 1G8HA 1PDOA 1FTGA 1SBNE 3AIKA 2BFWA 5EPOA 1RCFA 2PE5A 4RF0A 1MH9A 3SMPA 1KXJA 3KU1A 4LHZA 4I7EA 4ZYXA 2P2DA 2GHQA 5CFZA 1BRMA 1PFWA 1J0CA 3NVKI 4K05A 4Z51A 1XPOA 4X5OA 1U0BB 3KSAC 2RHHA 3NNNA 1OPRA 3LMKA 2VCYA 3T9DA 5DO9A 1LDNA 4GL4A 5HJ2A 3TLAA 1NLFA 3HI4A 5AXAA 1PYOA 3C8UA 4F4FA 2FDRA 3RROA 3THYB 4NQZA 2ZTCA 2XXJA 4D3ZA 1SWWA 2H5LA 2Z04A 2FZEA 3ZLBA 1IB0A 1TC1A 2O8DA 4HVAA 3GEEA 3ZGLA 2FUEA 3ZVMA 1TXGA 1PX2A 2I2CA 2R6FA 2OOSA 4EK9A 1JXOA 2UYQA 3TSOA 3WWPA 1U8ZA 2AWNA 1C8VB 1L7AA 4AZ3B 4AG5A 3WLAA 3SZUA 3WQBA 1BW9A 5CP8A 1KC3A 4N7RA 3R8FA 2ONKA 4UPEA 1DC5A 4D3DA 4DLRA 1Y48E 1E9RA 3H1GA 1KOFA 2UVPB 3DBHB 1ULSA 5KNBD 2IQIA 3PITA 1QIDA 3VNVA 3AEZA 5F9MA 4KFUA 4TMKA 3EZ7A 2W2NA 5AXDA 3UMRA 1H3NA 3EYAA 3T7JA 3BRWA 1ZD9A 4XJTA 1WXGA 1KYXA 4Z4IA 2YZ2A 3M5DA 4P98A 1ST2A 4C6TA 4TKLA 4QXPA 4QM7A 5IC6A 1DJPA 1N2GA 2YQ4A 4EO4A 4AX4A 4C7VA 1SUBA 3K9WA 4BASA 3IOCA 1SUWA 3O9ZA 5CVJA 1MJNA 2PMDA 1U3WA 5FI3A 3LQ2A 4ZYVA 2FDXA 2O0HA 4IIJF 4MV1A 2HFJA 4FHDA 3KWLA 4OHXA 1NSTA 5AHXA 1NBEA 2RGYA 3V2GA 1MORA 5BSFA 4KBYA 4JVMA 2DBVO 4RCYA 1X8KA 5I9MA 1AA9A 4L9RA 3W2GA 3OOWA 4PLPA 5J5VA 1TKBA 2DPHA 4P0QB 1A27A 1A82A 3OJXA 4OGLA 2G0TA 1VB3A 5F52A 1YL7A 1N0WA 4X20B 1CD5A 2QNJA 3GHHA 1OVMA 1ZK3A 3F92A 4Z0HO 4IRMA 2FKNA 4E12A 3W9SA 1PR0A 2C84A 4UARA 3D8SA 2GN6A 2VPQA 2FX2A 3HUUA 4WCFB 4Q7MB 1SRQA 5EXTA 1LQ2A 2BFEB 3MINA 5KPTA 3M6WA 2YICA 3L7LA 4ZHQA 5DXJA 3JASA 2F43B 5C8DA 3AL0C 1E4EB 2YCLA 3ZCUA 4HAUA 1IXKA 4N5IX 3EF3A 4MI1A 2AEJA 1ZJZA 5ER9A 3BXHA 5AVTA 1NUTA 4QOFA 2XY4A 2DVWB 4ARSA 4O4IB 1MC8A 2PMFA 1HSZA 3X1YA 1N5OX 3O83A 4D4LA 3FLMA 5HG0A 1GJSA 3NETA 4NX2A 3AUUA 4KLAA 2K87A 4QNRA 1N7HA 3MRSA 4IOLA 4TV8F 2HV8A 2RGNC 2A0KA 2QNBA 2WILA 5IX8A 1T0UA 3P4XA 3T1HB 1DAMA 4XIIA 3TSWA 1K2WA 2XDQB 4QU0A 4L8YA 2PVPA 4IXDA 1X7DA 4AZFA 2J30A 3RH0A 2GCNA 1J70A 1A8IA 3GLHE 1V3VA 1JIXA 2ZUBA 1W75A 3C6ZA 4KXWA 2QTCA 5LP6F 2VDQB 3RUEA 2J3IA 1XN1A 3EIFA 3VC3A 5DWDA 2ZVPX 4F0JA 1FTQA 4LPSA 1H66A 3KCNA 3FX2A 1R0KA 5ESWA 4GZ6A 3PV0A 4CV3A 2RJ3A 4JYCA 5ITWA 3ZY4A 3K5IA 4G5XA 3HCRA 5IBQA 4Y6PA 2DQYA 3UPUA 5CCEA 3EVGA 4MB2A 2NTJA 2ZRFA 2VXBA 2C2BA 3HSYA 1YCFA 4GQIA 3SBEA 4IDGA 2ODTX 3TOVA 3D6HA 4IIDA 2H07A 5KS2A 1UC9A 4A82A 1GEGA 4AI6A 4A2PA 1X1TA 5CIWA 2HXGA 5FA6A 3GDOA 4ZWNA 4MUXA 2ERXA 3ND8A 1V2GA 1LI4A 1OREA 3R7BA 3VSBA 1LS1A 3RYHB 2XOEA 3G6WA 5BWCA 3H0EA 1SIWA 3WMEA 5YASA 4LXIA 1CB7A 4I14A 1ML3A 2XFSA 5BT9A 5TQ0A 2V5VA 4OBXA 1PW5A 1RQ7A 4F3CA 3PHGA 1BFDA 3STHA 4I6GA 3RHTA 3OD5A 2O4UX 3AM5A 2FQWA 1HDOA 1E64A 1OXUA 2VZLA 3T15A 5CA0F 3KO8A 4AKTA 3BL6A 4Q18A 1SD5A 1P1JA 4I99A 5DCYA 4KR9A 2ZIGA 1W0JD 1G4HA 1FJXA 3GVPA 2COEA 4C6RA 4Y8VA 1K7XB 5AESA 1VB5A 2B8NA 1QGUB 4KQKA 4MVXA 5MFPA 4X60A 3M3HA 1ODCA 1YMUA 2QZ9A 2LP4Y 4C0QC 3WKAA 3HJHA 3CRQA 3ADPA 4MUGA 2NN3C 2OG1A 4U1RA 3QEBZ 3QX3A 4MSUA 2R46A 3ZV3A 1MIOA 2Y8EA 3WB2A 4IWXA 1EFHA 5AKLA 4DQVA 1ZX1A 3IJPA 1G8GA 5EY5B 5KJFA 5AK4A 1HA3A 7MHTA 3AJEA 4KBGA 5HNKA 2XGMA 5C9ZA 5CDYA 2NU7A 4NFHA 2ZSKA 2CB0A 2JY5A 5G3ZA 4XDZA 3UH1A 2XDAA 1V5EA 4TQUS 3A3KA 3U6OA 3KYDB 3SS7X 2KPOA 1G5RA 3SFVA 3OT1A 4P5EA 3HR4A 2MROB 1WW8A 2ZYDA 4E3WA 3B7GA 2EL7A 2AR9A 4RUKA 2JFXA 4YT2A 5J4LA 2Z2XA 4GWGA 4RSMA 4NSOB 1BEEA 1W44A 4Z5XA 2ZRBA 4MCAA 5GONB 2I9KA 3G0BA 3DNMA 1W9HA 2OK8A 2ZIVB 3IT2A 1J56A 3DYVA 1IIRA 2DPLA 2PM8A 2TSYB 3OZGA 4OREX 1CY2A 4HLQA 3DH0A 2CL5A 2D5IA 2L82A 3TLGA 1R3DA 4E2ZA 1U11A 1YIDA 3OZCA 3ABIA 1SC1A 2XKAA 3KQWA 3AV0A 2WDPA 3TQCA 3KJXA 4A73A 1JVSA 1WAMA 3EDOA 4FBGA 1AGPA 2H2IA 3CB2A 3AF1A 4P16A 1C3OB 4DRXA 3K0BA 1NRWA 2GNAA 4AMYA 1JAIA 4Y98A 5HF6A 3AFGA 4FWTA 3HKDA 4B8YA 3FR7A 4P84A 1XZHA 4CMIB 4N7BA 1CZUA 1JVNA 3M7IA 1ARZA 3MF4A 4YFVA 1SPBS 1FS6A 1VPLA 1UQTA 4ZOLF 4WXPA 1ORDA 2P2SA 2CMKA 3GPYA 4HJXA 3PYLA 2EWWA 1JJIA 4RD1A 3GDGA 3BMXA 3HRKA 10MHA 4EAAA 2Q3FA 3UC9A 4Q4CA 4FMCB 3ZLJA 4PO8A 3NUQA 4H27A 1ZJ6A 1DBSA 5KYUA 2EHDA 1HORA 1QAQA 1M2WA 3FTEA 2OQIA 1XQVA 3SQMA 3NBFA 3TZKA 4DA7A 1TEZA 5K4GA 1DQZA 2YNMA 4L8LA 4DHEA 3E7XA 2O19A 2VHZA 1Y63A 5KJ1A 3I6YA 4IBCA 3NU1A 1G2OA 4S1PA 1KRHA 2IEAA 1TZ2A 4I5FA 4TZTA 2UUBM 3E5NA 4XK8F 3AZOA 2O7SA 3RUDA 2BBTA 2Q6OA 3TZLA 4LZJA 2ZJ0A 5DGCA 1L5LA 2E82A 2ZLBA 2FKAA 2DFDA 2OHGA 4XFDA 4PPQA 1XJ5A 1EEHA 4TWRA 2MT9A 3PDJA 4WKOA 4JUAA 3COYA 5IDYA 3C7CB 2IV3A 2PUCA 1YFLA 2EFDB 1N92A 3QUAA 4FW9A 3PEVA 3DOIA 1KBOA 2B2NA 3VC1A 4KFCA 4PYMA 1SXIA 3EQ6A 2FFAA 2EKPA 1WHTA 1KAMA 1BROA 1HF3A 1DRJA 2Q2QA 1OB2A 4DG8A 1JKJA 1HYGA 1NW3A 1ONPA 3LBNA 3O2SB 2WINI 3F4BA 5A71A 3RIEA 3ZOKA 4BQRA 3VR5A 4LYEA 2I71A 1R9GA 4A91A 4L7VA 1PQYA 4ZO8A 2Y68A 5LZ9A 3PXGA 3QPBA 1XQ1A 3ZTWA 2CVPA 2CXQA 2X5XA 5LYJF 1M72A 1TQ6A 2F5NA 1BA3A 2PEYA 4FVMA 4TXNA 3ROKA 2L0XA 3FFAA 1OYVA 5C2JB 2JVIA 2J5KA 3NAGA 5L7WA 4Z7JA 1XRRA 3D6NB 4GWLA 1J20A 3E5MA 5A5DA 3WLLA 3ZW9A 3AHGA 4OM8A 5JS7A 2OA0A 4MEJA 1P77A 3OMLA 3W8RA 3B9RA 3DUWA 1N3IA 1BFUA 2FEMA 4L5CA 4B35A 2GYYA 3VYWA 3EIWA 3R0IA 1TZJA 1ZJYA 1CYEA 3B7NA 4RK4A 1T9ZA 1UWVA 2REQB 1SVOA 4BTLA 3A2KA 1PQPA 4IVRA 2OGSA 3PL1A 4CKBA 3GO8A 4PYOA 5KWIA 4FXPA 6LDHA 2SKCA 3I4CA 2K2QB 4BLUA 3WB9A 1BDMA 1BCSB 2JB9A 3GI1A 5GADl 1N75A 3AR2A 5BQ3A 5IARA 3UUEA 1EHIA 3LLMA 4EYKA 1U0LA 2VPWA 4ENTA 1GRVA 4R31A 5BSGA 3JAMS 2X15A 3I2JA 1JEOA 1MBZA 3WQQA 3O94A 3B74A 3UTDA 1F4PA 3ELBA 1DFIA 1Q0UA 1VA5A 1VYVA 3PEUA 3C3AA 1C7FA 3FJYA 2UXCB 4ZYWA 1X9HA 1X0XA 2PR7A 3LBIA 1ECJA 4DXAA 5TVKA 1J7JA 3K0EA 3W7BA 2KBFA 5GONA 1R4NA 3RSHA 5JIBA 3ULKA 1YCDA 2G1AA 2OUIA 3HKCA 4OOEA 4Z8YA 5EJ4A 1EBFA 3NNSA 3CWCA 2XMPA 2C3PA 4FLEA 2QIOA 3ZJ4A 3LKBA 3H5LA 4FYJA 1FMJA 2B34A 2QYSA 5JV5A 3DZGA 4WAUA 1XLWA 3O21A 2FYTA 1G291 4PD2A 3WLPA 1IUOA 2XQKA 3O1LA 4O4HB 5GJWC 1HDXA 2G1JA 2B35A 4EG4A 2XSZD 1IVYA 3TDNA 4GG1A 2K7ZA 4BU0A 1SOUA 1K98A 3G8CA 4KH0A 2R68A 3E18A 3K70D 3N58A 3FYCA 2O8EA 2Y1LA 4HFRA 3CF2A 1AHIA 2WIJA 4M0KA 3LKZA 3TQRA 1T1RA 5E1DA 5IC5A 2HTEA 6REQB 5AW5A 1E3QA 1VKZA 1TF7A 2B98A 1K2VN 5ADWA 3CVJA 3QFFA 3WGJA 1XVTA 3WGZA 1WBDA 1N6HA 4L0QA 4AJPA 3GHYA 1E3MA 5HA5A 1XEXB 3MCAA 5JFOA 5EOVA 2PX8A 1OA0A 3KV1A 4H1UA 1KI9A 4D57A 4NCBA 3IPRA 3WGMA 5IREB 2FEPA 4WZAA 5EUBA 5JSYA 2I3ZA 2EV9A 3H17A 2I4TA 3LY9A 4NCKA 1UH5A 3M9WA 5G3YA 1JUDA 3SR3A 2QCUA 3MWDA 5TF4A 1T5IA 1IFXA 3DZKA 3SYRA 2E4AA 4NHOA 1U9ZA 1DHRA 3DW1X 3LQ1A 1UZNA 3W7AA 4LTMA 1W2WB 1AHHA 3IEMA 2PO5A 4MR7B 2H1VA 4CIZA 1FYDA 2BL4A 1T4CB 3RREA 3FHJA 3G7SA 4KKXB 2ZOSA 3HUEA 3ORYA 4O4IF 3KEFA 2A67A 4EUKA 1FNMA 2Q5HA 2X42A 4OP3A 4OVKA 1N1GA 4TXMA 1JDBB 4C89A 4B7XA 4DYDA 1DO8A 3AG6A 3J81k 2BMEA 2IUTA 2E5LM 2RAVA 4C0KA 2FQQA 2IUSA 5LD2C 3RHSA 2HMSA 4UZFA 2PH7A 3ZTYA 4P9NA 3K9FC 3J2PB 1OROA 2P6PA 3N75A 5I45A 3L7AA 4RL4A 3BJZA 4ZVPA 1CK4A 1ELOA 1QYRA 1BS9A 1ZUNA 4CU2A 4RKQA 5IWCA 2GARA 2QW1A 1RQXA 3KTOA 4RTSA 4B3MB 4BB0A 4D43A 3QHQA 3T3NA 3FVRA 4UM8B 4DM7A 4BQQA 2VKQA 4IG4A 3D3QA 4CCYB 1J9GA 1J8QA 1OW3B 1YR7A 3AK4A 2IZ6A 3OLYA 1MOPA 2M6LA 2G83A 1QYDA 2ONCA 1JLLA 2IHYA 1W1WA 5GZ1A 2HEIA 1EFTA 2DWCA 2XKKA 1HFWA 4EB0A 3EZ2A 4IIWA 1O5IA 4KK4A 2WQ7A 2VHQA 4JFAA 4DKJA 3V4VB 4BE4A 3SNKA 1JMYA 3TSYA 3U9SA 5IT5A 1R1DA 3SE0A 1Z4QA 1EK2A 3DTVB 2VHUA 1M6WA 3A0RB 3BTUA 1G5FA 4PIMA 1K6MA 3H99A 5AJZA 4S1WA 1FSPA 3V7UA 3OIVA 3WTCA 2ZYHA 4FCVA 4O8CA 2Y0DA 2XEPA 2JGLA 3A3NA 3PKZA 4G6ZA 1I4TD 1BCSA 2JIPA 4LF6M 2N75A 1K63A 2WJPA 4A3SA 2EW8A 5H0IA 1ZCZA 3ZLUA 1SHKA 1GAQA 2J5YA 1HKUA 1DXOA 4Z86A 5TLSA 2RARA 1JLSA 4N0QA 3M2PA 2IU4A 3V1YA 2Z6VA 5IJ9A 2PLRA 4BHTA 3U4AA 4NV0A 3E9SA 1C2YA 4HS9A 2QVZX 3JD4A 4FINA 3V7YA 1CJVC 3TN7A 2Z4SA 3QJGA 1P0QA 1JSXA 3GMSA 3H05A 3D7MA 3LS2A 3GD7A 2OXCA 1AURA 2XRFA 1K97A 2OORA 4E6PA 1QHHB 4EKDA 4E88A 3KJNA 4KXFB 3AKEA 4LSWA 1RCTE 1KDVA 2O2HA 3OQBA 2V65A 2XYRA 5F4ZA 4C06A 3G2OA 3LYHA 1O0SA 1YRYE 1Z59A 4G85A 2QLLA 3ABOB 2V6ZM 3RWOA 2O8BA 2JAXA 2EARA 1N2CB 3OFND 5DBOA 3C1AA 2XE7A 4ZI3A 1U3GA 1BOFA 5HTKA 2R96A 4YFYA 4DR1M 1X1RA 1RAEA 4QUGA 3ESYA 5BMOA 1JAXA 2I4OA 4R2KA 1JHDA 3QKRB 5IUJC 2CFIA 3LW7A 3KAJA 4HV4A 1QBKC 6REQA 1W1IA 2RC5A 2EL9A 3W79A 5JARA 2YXBA 1ZEJA 3PCTA 1M2OB 1Q7CA 3WKEA 3CZMA 2FRDC 2ZCVA 5LMUM 1KTVA 2A1IA 4MUHA 4GT1A 2IPNA 1N2IA 3MTAA 1CQWA 3ZWWA 4CUKA 4G67A 3G0HA 2FFBA 1NASA 3GK3A 5KCZA 4LS3A 1E7MA 1JKMA 3L18A 1U8AA 3I23A 1JEAA 3HACA 3HEAA 5DFLA 5EJ5A 3SEZA 3PQ6A 3BWBA 1DJNA 5J58A 4JOSA 3F5DA 3ZVNA 3HHWA 5FOXA 3AJAA 2QN8A 3QFCA 3AR9A 4KQ2A 4RKFA 5BMVB 2FFHA 2BWJA 3WGHA 4AP5A 4L76A 1YJAA 3Q3IA 5D1HA 3HYRA 1ZZGA 2Q7OE 3AF5A 4IOJA 2Y1GA 4MVJH 1DWPA 4WGFA 3RAPR 2EFJA 3FHLA 3QG5A 4MR7A 3SMVA 4F2GA 4TTQA 2H2FA 1D0IA 1G8JA 3CLTC 1JIJA 3LQYA 3SHGB 5DTJA 4IMRA 2Y2VA 2V0GA 2I8AA 3K8QA 4NOLA 5CNMA 4D4HA 2HDOA 4AUMA 5JS8A 3SC3A 3FZQA 1D2NA 4FMCF 4JH0A 2JIMA 4G3XA 3CX3A 5AI4A 3WWCA 3K9HA 1XQ6A 1MABB 2Q4OA 3M3PA 1YOBA 5BW4A 1JEQB 2CJWA 2B2CA 1LB1B 3P7MA 2IHBA 3U3OA 3VYTB 3NC1C 3CNNA 1FNSA 5JS2A 3K9OA 4AYXA 1R2ZA 1IY8A 3S2EA 5KJEA 3A1WA 1AKMA 4IIJB 1Y6QA 5C5CA 3RCBA 3ONDA 3GJ3A 4RYLA 2C57A 1EBBA 4KHZA 3COJA 4RNAA 4R1TA 2OGWA 1JJFA 1WGNA 4ZTZB 1F0PA 2DAPA 4BVLA 4KPGA 5K20A 1NBAA 3A9SA 2IV7A 3I2KA 1CZOA 1WR1B 4TTVA 4CCYA 2ZFUA