1SXJD

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
328
structure length
328
Chain Sequence
PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASQCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Activator 1 95 kDa subunit
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 92
structure length 328
sequence length 328
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00004 AAA ATPase family associated with various cellular activities (AAA)
D PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjD02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjD03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjD01
1NN1A 4TQ9A 4LJ8A 4I1VA 2OCPA 4MITA 1IBRA 2JGNA 4F38A 3U3MA 4JLOA 1T4GA 1II8B 1QG4A 4QBFA 3IIJA 2FMXA 3GLHE 2ZREA 4KAXA 3AVXA 1E32A 2ZR9A 5CJPA 4HUTA 2JLXA 4JKIA 2QAGB 1HTWA 1KI7A 5FUVA 2RGNC 2N1BA 3QBTA 4N3NA 4TLBA 4JJKA 2ZI4A 2F7SA 3IQWA 4TN1A 1EXMA 1G3IA 1ESMA 1FQKA 2NO9A 4XVRA 2ZIAA 3PUZA 2BVNA 1IN4A 2W00A 2QTHA 1JJ7A 4GPTA 4TTQA 2G1JA 1XCPA 2G6BA 3QKUA 4PANA 1JQJC 2H16A 4AC9A 5JHHB 1KO4A 3GJ6A 2ZYVX 5GJWC 3TK1A 1GAJA 2ZETA 4CDGA 5JMTA 1SVWA 1AGRA 3FYHA 3WNBA 2BKUA 1SVIA 3UMRA 3DMDA 1OHHD 2ZE7A 4TL7A 3KL4A 1AIPA 4PC2A 1G8PA 4MUAA 2QAJA 3JZMA 2D2EA 3CPEA 2X8AA 1TUEA 1U9IA 4LYFA 1KJZA 2WSMA 1W7AA 3AM1A 1JR3D 1TPZA 2CHGA 1EESA 2NGRA 2QORA 3PUWA 1OFTA 2JJ1D 3DL0A 2FF7A 1P75A 4Q4LA 3L82B 1MO4A 4TL6A 3IBYA 3RSLA 1X1SA 3OAAA 3B9PA 2KI5A 3MCAA 3QKSA 1H65A 1G8FA 4IJMA 4KLZA 4G0NA 3F3YA 3H84A 2FGKA 4XOIA 4C2TA 4I4LA 4RZXA 1MR3F 5EQTA 2V3CC 3HP1A 1C1YA 1C1KA 4Q9HA 1NJGA 2FFHA 3AVYA 3EARA 4QBGB 2XZOA 1Z5ZA 1AK2A 2ZUBA 5KSOA 2ZRHA 1TF7A 2C9OA 3QKSB 4ZKEA 3A6PC 2CLSA 2YOHA 2WOOA 4BECA 1E2HA 2DWQA 2CVHA 3O8DA 2QMHA 1IQPA 5B2ZA 2GXAA 1KSGA 2SHKA 5JWHA 1R2QA 4H9GA 2JLYA 1VYVA 4S35A 4NONA 4LSGA 2XOKA 3JVVA 3THYA 1JAHA 5CDFA 4JSYA 4KFRA 1JEEA 4DZZA 2B21A 2YV5A 4BFVA 4GI7A 3EPLA 1AJEA 1KZGB 4I1UA 4PAQA 4A9AA 4JL8A 3ZQJA 3C7KA 3C14C 3CUEF 2P3SA 4PO9A 5HR5A 5FPYA 1IN6A 1L7VC 2WWHA 3CIOA 4NU0A 1GWNA 2FV8A 4MRNA 5EE1A 4E09A 3THYB 5E3HA 2PH1A 1J70A 4O2RA 1FX0A 1GL7A 2FFBA 4Q7KA 3B1YA 3PFIA 1M8PA 1Z6AA 2W6JA 1I4LD 4NKRA 3Q72A 4D0LB 3SI7A 1RC8A 2AX4A 3GLFA 3A37A 2GBLC 3BH0A 4Z54A 3Q9LA 2FSGA 2K5UA 4PHHA 3T1OA 2ZROA 4NDZA 3E70C 4TSFD 5IRCD 2P6RA 1G4UR 5LD2C 3OE7A 3CPHA 4Q1EA 2V7QD 2ZRIA 1FX0B 1UADA 2XSZD 3TH5A 4PC7A 3VR6A 3KW6A 4NHOA 5GJBA 3HU2A 1AS2A 3GLFB 4II7A 5EE3A 2C8VA 2RKOA 2J7PD 3QG5A 3RWMB 1Q1BA 2NO1A 4BZXA 2UVQA 2GCNA 3B78A 3WNDA 5J40A 4H1UA 1CULC 5AR1A 3QQ5A 3U7HB 2MMGA 2KRKA 1J8MF 2FA9A 3TR0A 2FEOA 1S1CA 2IEZA 2OO7A 4LPKA 1W4RA 1D2NA 1WF3A 2ZE6A 4DCUA 121PA 1NLZA 1XMIA 3AKEA 2DZNB 1YR9A 3PG5A 5KO2A 1GNPA 1IM2A 2ZAOA 1Y3AA 3OEEA 4OHXA 621PA 2C77A 3G82C 5FOXA 4M1MA 1FOEB 4D82A 2YHSA 3KB1A 1DAHA 3C41J 1OH5A 1JNYA 1CEEA 3I4LA 1DG3A 1R10A 4HB0A 3SHWA 4M21A 1CJTC 1G64A 3EW9A 4QXAA 5DYIA 3F0TA 1CP2A 3KZ1E 4ARZA 5ELXA 1UDWA 2FPMA 4HSEA 3H0KA 3QUSA 3AP3A 4OHZA 3RC3A 4QJ3A 3CRRA 4YDHB 2CHVA 3PCRB 2W2TA 1E2JA 5JZVA 4US2R 1E9BA 1DE0A 4C0AC 2CE2X 4I99A 3P27A 4LHZA 1S3GA 4Q9KA 5KNDA 3A8TA 3W6OA 3QEOA 2A5GA 2ZS7A 3KJEA 821PA 5L3RA 4PQYA 2PT5A 4MDEA 4YLGA 1OXXK 5DHAA 1P62B 4BLTA 4JL6A 1Q21A 1BMFD 2I3BA 2NOAA 4A15A 5FPSA 1M34E 1FL9A 2GILA 4URVR 3QY0A 4TZ0A 2JIZD 3CTDA 1DEKA 4A3VB 5C18A 1WDTA 2YC4C 5CJ2A 4A8JA 4A2WA 4OQXA 2J5XA 3OIWA 5G3ZA 5C4GB 2W0MA 2JLZA 4QJ5A 2WMOB 1VCIA 2WMNB 2ORWA 1ZM4A 3EIQA 2GJKA 3MAAC 1WBDA 4B34A 3T35A 3THWA 1VIAA 3FMIA 1TQ6A 1SZPA 4FMBB 4M1OA 1J99A 4FWHA 1CXZA 1QZXA 4MYTA 1E9DA 1FP7A 4URYR 4A8JB 1E2LA 3D31A 4DLTA 1SQ5A 4GOJA 4CT5A 3EPHA 2ZRKA 4OI1A 4LYHA 3V9PA 4ZI2A 1OPXA 5F9HA 2VH5R 1TTTA 3DKVA 3QNUA 2G3YA 3TUJC 3ZZUA 2HDNB 1ZC3A 4BZPA 4LYJA 1IY1A 3THWB 3SDZA 2IYWA 1VKJA 3LXXA 3KXKA 4ZDJA 3AUXA 4E07A 2OXRA 4IOMA 5FI1B 1DO0A 3M6AA 3GJ4A 4OK6A 3VR5A 2PEYA 1F2TA 4LHWA 521PA 3CBQA 1FMJA 1IJFA 1P2SA 4OQMA 3THOA 1JR6A 3AGPA 1H8HD 3RRNA 1BO6A 4TWZA 1FTNA 1M7BA 3SZRA 4EIWA 4C0SA 1A2KC 4QGFA 3MGCA 1AN0A 5AK0A 1MOZA 2PLRA 2JLRA 2WIBA 3SBDA 2WWXA 1F2TB 2YC2C 3MFYA 3W5JA 4XWKA 5IHPA 1Z0AA 3K0CA 4DB4A 1ZUHA 2QGZA 4Q66C 1CU1A 2ZI5A 1E79A 3SFVA 3ADBA 3N70A 2ZANA 1E9FA 1WA5A 2XGJA 4WOPA 4TL8A 1VCNA 1KK0A 2WPDD 4DLXA 1E94E 4ILEA 4V03A 1NLFA 3DDCA 5FR2A 4LGMA 1S9HA 4C30A 4UNRA 3NBFA 4EFNA 2RGGA 1HE8B 4G5QA 2YNMA 4XVQA 1ZUNB 2OBLA 1COWD 1XZPA 1CRPA 4BE7B 4KYUA 5KHOC 3M1IA 1UBFA 3W6NA 3FMOB 1T3LA 1XPOA 5FBWB 2O8DA 1W4BA 1XB2A 2VP0A 4JVNA 2IYYA 1WCV1 2HJGA 1OB2A 4TMZA 1MRSA 2FE4A 2E1RA 4M8NE 3LV8A 4MRVA 3W6PA 1NI3A 4BGDA 3NVAA 2H17A 2FDCA 4LPSA 4YMTA 4KO8A 1Z6YA 1SXJA 3VHLB 1TEXA 3P26A 4RZ3A 4PPQA 2FX3A 2QSZA 2O8DB 4OHVA 3IIMA 2A30A 3QXHA 3OIVA 1H8ED 2WJVA 1E4VA 3P4YA 3CWQA 2FWRA 1TQDA 4Q1DA 2ZU0C 3KKMA 2ZSBA 4DLVA 2GAAA 1N6PA 2RGXA 2XNSA 3RWOA 2FSFA 2OUKA 1SXJB 1Q0UA 2QQ0A 1W2GA 1EFRD 1LB1B 1G5PA 3KJHA 2VHJA 2B8WA 2RMKA 2AN9A 1DVRA 4DIEA 2XJ4A 4XSHA 1KO5A 1KMHA 1N6KA 2BM0A 2ZJOA 1A4RA 3WNCA 4A1FA 5JFGA 2D62A 5CLQA 4PZZA 2OFWA 2V4ZA 3CX6A 3R9XA 3TBKA 4CF7A 1D2MA 4WAUA 1OT3A 1Z29A 3VX3A 3K70B 1KK1A 3W8NA 2BMFA 3SJZA 4E03A 5EP3A 2BM1A 4PXAA 4L9WA 4US1R 1LS6A 2ECKA 3U3OA 1KMHB 3FTQA 3FWYA 5H70A 2C2HA 2RHMA 1SVLA 3EZ2A 5BN3A 4RD1A 3W9YA 4FW9A 2MSCB 3VKHA 3A1UA 2BBOA 1NKTA 3U2QA 2FZ4A 4FXPA 3KB2A 4G5RA 4IXMA 4FWGA 3RS3A 4DEYA 3ZH9B 1A7JA 2BKEA 3B60A 2IS4A 1XNJA 3WHKA 2WPDA 3DOFA 3EXAA 5EP2A 4Q9IA 1G5RA 3V4FA 1YR7A 4B75A 2VP6A 1P3JA 1XU4A 3N5CA 2XEXA 3CX7A 3RC8A 4JMPA 4LK2A 1COWA 1VYTA 1Z0FA 2H7VA 2J0UA 4D2IA 4G5OA 4L8GA 4PC3A 1U0HC 2GXQA 3B5JA 3BOSA 1CLUA 5FL3A 1N3BA 4QRHA 4Q1AA 1Z3IX 4GDFA 1D9XA 5KSPA 1II9A 3I73A 1D6JA 2WKRA 2R6GA 1T0JB 1E4YA 1XXHA 2WSSA 4UQOA 2NO7A 1IXZA 1XBTA 1HQYE 2V9PA 3EZFA 3PITA 4MGKR 1PLKA 1ZU4A 2J0UB 2J87A 4IVPA 5HE9A 1GIAA 4O2LA 1G41A 2ZSAA 2OXCA 2QRNA 3Q5DA 4LJ6A 4R98A 3BAFA 1OV4A 2ZTSA 4FD2A 1VCMA 3GEHA 4HI0E 2FPLA 2RCNA 2PJZA 3T12A 4D0NA 2P0EA 4JVSB 3RYTC 1XXHB 1QHYA 4DVGA 1CJKC 2VEDA 2JAQA 2IBMA 2R6FA 3C4JA 3CR7A 4M4SA 1DADA 1E2GA 2R9GA 2QMUA 2Y8EA 5B64A 2ZRNA 1S9DA 1VG1A 2RGBA 3QXCA 1DBSA 1XRJA 2V6IA 1XEXA 4L16A 1YRAA 3HR8A 2G0NA 4P32A 5HKKA 2QPAA 3NWJA 5FOTA 4B6EA 4NCJA 2WWFA 4LDJA 1N6RA 4PO1A 5SZJA 421PA 1QZMA 1GILA 3B1XA 4MYCA 4F4IA 2GVDC 3E5HA 4A0GA 4ITRC 2IYQA 3F5FA 2ZS8A 1XEXB 1NMXA 4BLQA 2VP9A 2JLUA 2R6CA 5DSZA 4JBWA 3WY9A 2QTFA 3ADCA 1N5IA 3AF3A 1UKYA 1ZMXA 5J47A 2XNDA 4G5SA 5FH9A 1HURA 3K09C 5EZ5A 4FWIB 5GVRA 2OILA 1NKSA 1A5TA 3DPUA 3GFPA 1NG1A 1ZIPA 4BASA 3ICQB 2ZYUX 2ERYA 1ELOA 2QA5A 4DXAA 2R8RA 1YZLA 3T06B 4LC0A 1TQ2A 1OIXA 2HLDD 3EWAA 3CRQA 1X1RA 3CB4A 4DB2A 3NC0C 1U8AA 4MH0R 5EE9A 3UXMA 1M1YE 2NO0A 1RKBA 1TAGA 2QT0A 2DYKA 3ONWA 5HCIA 2C99A 2Q0HA 1TMKA 2NPIA 2WJJA 3LD9A 2ZRLA 1XJQA 2IEYA 1E9EA 1NMYA 1OW3B 1UKEA 4FCTA 1E2MA 4YMVA 5TVKA 4Z51A 2PJRA 3AKCA 4N1AA 1PV4A 3DM5A 4X8MA 1IY0A 4B71A 5FR1A 3VKGA 5L3SA 3PQCA 1UEIA 3TVDA 2VQSA 2ZS9A 3RRYA 5FUWA 1G291 4MYHA 1GKYA 4IRUB 2GZDA 2HT6A 2ZI7A 3T15A 4IDHA 1G7RA 1EX6A 1Z83A 2CK3A 1W36D 1FPMA 4BFYA 2F55A 2VIIA 2JJ2A 2IYLD 1RIFA 4LI0A 4BFXA 4GNKA 5L3SB 5FOVA 4D81A 1DG1G 3T5GA 3CNNA 4EDHA 4I81A 3K9LA 1FNNA 2FSHA 2VRWA 3K0SA 2PBRA 4UXJA 3AVUA 1UEJA 4UNNA 3KJGA 1W4CA 5BYKA 4N0EA 3W5IA 1P9NA 4JLPA 3DMNA 1W2HA 3GLIA 1XX6A 2VHCA 3SOPA 4Z1MD 5KPJA 2B7CA 1MABA 3R8CA 2JLSA 2ZRBA 2IXFA 5D3QA 1NJFA 3A36A 1YZUA 1WQ1R 3X1DA 4EPXA 3BB3A 3I5XA 4HDQB 3CH5A 1L4YA 2XX3A 2JLQA 4OI4A 2AK3A 2RAPA 3GLIB 5TXGA 1K5GA 3EZ7A 4Q19A 4PPNA 3ADDA 3K1JA 1MABB 2D2FA 1F6BA 1WBBA 1J7KA 5EUMA 2BC9A 3MHVC 2BDTA 1B23P 1E99A 2JDIA 2ZYWX 4TLCA 2ZI6A 1R4AA 4P4SA 5DO9A 1RPZA 3E2IA 2XITA 4PC6A 3RS5A 2ZRMA 5EE5B 3UANA 3TMKA 1XF9A 1OYWA 1G18A 2KBEA 3EZ6A 2QUZA 3K0EA 4JKYA 3FFBA 5E7JA 2OEPA 4PSVA 4Q9JA 1OJLA 1NVUQ 4UXIA 1XD2A 3DZ8A 3MWYW 3MLEA 3QI2A 4P4SB 1SULA 4TYQA 3BB1A 2CEAA 1VG0B 5IF9A 5AJYA 1LNZA 3MWJA 1ZNZA 3CM0A 1I2MA 4GFDA 2BEKA 3O8BA 3PUXA 4M1SA 4XTRA 3DOEA 2HXYA 2OFXA 4B2IA 4EFMA 4XVUA 5FBQB 5CYPA 1KDTA 1IJEA 1DAKA 1X8KA 2WKPA 3AF2A 3CPJB 1YRBA 2VF8A 1XD2B 3FKSA 4RCYA 2W6ID 4GOXA 4TMVA 3QF4A 3EIEA 2F3TA 2IL1A 2IW3A 5FTLA 3KUDA 3QVVA 3RABA 1KI3A 4Q4JB 3UG7A 2MMCA 1R0XA 2CVFA 2EVWX 2W58A 3TRFA 2GXUA 4B43A 1U94A 4BQSA 2CL0X 4PZLA 2EFGA 2G9NA 3GMTA 2GVZC 4KHZA 3QF4B 1NSTA 4Q48A 3TR5A 1E9CA 4Z8XA 1YZQA 4LRTA 2UZ3A 3IO3A 3TLXA 2FGJA 4H1VA 1Q1ZA 2WVJA 4UJ5A 2EYQA 2QAGC 1W36C 4FMCF 3EA5A 3AVQA 5HZHA 5L8VA 4RJLA 2WWGA 3GLGE 3HWSA 2QP4A 2J41A 1G7CA 1X86B 4YXWD 1NP6A 1US8A 1XD8A 1W5TA 4LC1A 3QKRA 3LY5A 1W0JD 3K8YA 4MDFA 2QL6A 4DBLC 4R71A 2OCYC 2KB0A 4DHEA 3RS2A 3R7WA 5K8IA 4C0KA 1G16A 1P6XA 3AF4A 5B58C 1SKQA 1UDXA 3OESA 3SHFA 1XFAA 3LLMA 3NG1A 1US8B 4BFTA 1CR1A 4OQNA 4HLDA 3QKRB 1Q20A 2BCJQ 3KTAB 4TTRA 4LJ5A 1BOFA 3C5HA 1TX4B 4ABYA 3TIFA 1G9XA 2FNAA 3R7WB 2Q6TA 1X6VA 1UJ2A 1SKYE 2BBWA 3SJAA 4EFLA 5L3QA 1L8QA 4JBXA 1NN3A 1KZ7B 2V1UA 1Z6TA 1ZNXA 1RYHA 3EC2A 2IK8A 5FTKA 1DAIA 2ZE8A 1GOTA 1CJMA 1XJCA 2CE7A 1OKKD 1RRGA 4DT1A 2ZQ5A 1P61B 3ZVRA 1G6OA 5L3QB 1ZAKA 5J4YA 1ZD9A 3Q7QA 2WJIA 4QBIA 2JLWA 2GK7A 2IHBA 1NVVR 4HDOB 1KI8A 4DDVA 3L0PA 4B3FX 4CEHA 4DT1B 3SYKA 4C4PA 4RVCA 1T8TA 3I8SA 4O25A 4MKFA 2C03A 4HAYA 2ONKA 2ONJA 4B2LA 3IKJA 2RGCA 1MO3A 4BFSA 2REOA 5CB8A 4XJXA 1SVKA 5CK4A 1PZNA 4FMDF 5KYKA 2QM7A 3NH9A 1XWIA 1ODFA 4V0OA 2VL7A 2ZVPX 2XB4A 3UPUA 3RHFA 1QG2A 4CEHB 2JASA 2NIPA 3P1JA 3BJIC 3AVWA 3M0EA 1KKLA 2JEOA 2ASEA 1KDRA 1I2DA 3CO5A 5FI0B 3TUIC 4B6FA 3U60B 3BH7A 3ZJYA 4ESHA 1QHXA 2ERXA 1GRNA 2EWVA 4IOJA 3AP1A 3RAPR 4LZZA 4URXR 5JI2E 1QVAA 1XTRA 4BLPA 3GP8A 4TYNA 2QPTA 3W3AA 1KI2A 4M9QA 4OHWA 4WZBE 1ZM3A 1NBMD 1LTQA 4NMMA 5LD2B 1OHHA 4D4KA 1NVWQ 4FN5A 5IDVA 3KX2A 4DCVA 3WYFA 1YHNA 1Z63A 2ZVQX 2C98A 2J46A 4HDCA 1UBCA 3IUYA 2VLIA 5DI3A 3ZD6A 3SNHA 1JR3A 3NEJA 4IDNA 4ZIRA 2JJ1A 1F60A 5IK2D 2Z4RA 3TVTA 3BD9A 1KDPA 4QGAA 4HLUA 1AGPA 3X1WA 1HV8A 4U02A 1E96A 4LBVA 1O3YA 5JI3E 1Q1QA 3I3SR 1YKSA 1J90A 4IVQA 4CZ2A 4OK5A 4ZKDA 1JB1A 1E9SA 1ZM2A 1NSFA 1G8HA 1ZBDA 2R2AA 3CRVA 1P9WA 3KKNA 5DI3B 4F4JA 1AZSC 1P72A 2BIFA 2WIAA 4YQFA 1XTIA 2PMDA 4ZIRB 4TL9A 2FFQA 1E3MA 1S4QA 1XTQA 4IW3B 1GUAA 1KHTA 2OCBA 5JJLA 1OXSC 2ATVA 3D6TB 3TSWA 4PSAA 2VP4A 2IHYA 4US0R 5J4HA 2ZUDA 4GZMA 3HDTA 5EXTA 1N5KA 4QNMA 4RFSA 4GMDA 4OL0A 3LQRA 2QTVB 4D0GA 2Z83A 1L4UA 2B7BA 3KXLA 1S1MA 1JI0A 2OM2A 3LX5A 3KJIA 5G53C 5E4FA 3PXGA 2PZEA 2ZR7A 3I61A 4JIMA 1N6NA 3RRZA 4DLRA 2QP3A 4EPTA 3SS8A 5KTYA 3ETLA 3NDPA 2CNWD 1EK0A 1F2UA 1AQUA 3RNLA 5BW8A 1MRNA 4PQRA 4RFSB 4ZCMA 1E2KA 3REGA 4EQ6A 4JLJA 2VHTA 4V0ME 5J4VA 4X8LA 4HLQB 1Z47A 2GESA 3TAHA 1GKUB 1P4SA 3HR7A 2CXXA 2ZJYA 2DFLA 1M74A 4M9XA 3ZZTA 4DDTA 5HZKA 1YZKA 3MMPA 2WHXA 1FZQA 2OZEA 1E1QD 3PEWA 1F2UB 1MKYA 3QVUA 3BB4A 1OIWA 2QRZA 4KLNA 4OYHA 4P33A 1CR0A 1GITA 5JS7A 4TSFA 4EQ6B 2OESA 3A4LA 4LOAA 5G40A 3IIKA 1KI1A 1C9KA 3NBXX 2V7QA 3C15C 3KXIA 1II0A 2XSZA 4Q47A 5FFMA 4DEXA 1OIVA 5JLJA 2GETA 2AK2A 4OJQA 5JCZA 1S2MA 4OBEA 4EPRA 4KCGA 5EP4A 3VNUA 3H4MA 3CLVA 3PEVA 1G17A 3CNOA 4KBFA 2J7PA 1LFDB 1NF3A 2BOVA 1VECA 2WZQA 4O3MA 2YWEA 3AVVA 5ANRB 3BGEA 1ZD8A 3H2YA 2D74A 4A8JC 1G7TA 2XAUA 4Y0AA 5J4KA 3REFA 2EU8A 4DLWA 1P7CA 4KITB 3QENA 1E98A 3TQCA 4BWYA 4GRAA 3CH4B 4P4TA 3DVLA 2DVWB 4LY6A 4RD2A 4E22A 4OJKA 1IY2A 3RS4A 3KQLA 2ZXUA 4AI6A 3TE6A 4PSKA 2YOFA 4L5BA 3Q85A 4MYUA 3QSYA 4LJ9A 2CCJA 3FMPB 4TMKA 3L0OA 4WBSA 3G5UA 2DB3A 2QPOA 5DLQC 1TU4A 4B74A 5LB4A 4AYXA 1OXVA 3FHCB 3OFND 4JT4A 2DCUA 3EA0A 1OXUA 4ACBA 2GK6A 3CKLA 3NHBA 4WVFA 4Q02A 1G19A 4HB3A 1T6NA 1UBGA 3DKPA 2GEVA 3OEHD 5HPYB 3GJ7A 2G0TA 4ZCLA 2IUTA 2QE7D 4IDOA 4JYBA 3TQFA 1FW6A 3BK7A 4PHTA 3PV0A 1N0UA 1VMAA 2YINC 5AUNB 2A5JA 2DFNA 1JJVA 3FOZA 1DO2A 5HE8A 2V6ZM 2FG5A 2EFCB 2GJ8A 3NXSA 3GLHA 1XEFA 1XZQA 2AFHE 2CNWA 2OT3B 3N2IA 4ESVA 4OHYA 1JPNA 1HT1E 3MUFA 2QBYA 4IOKA 4TYWA 1P5ZB 1BMFA 4P31A 2MSEB 3GEEA 4A6XA 4QOSA 3UATA 3QEJA 2JIZA 5E7IA 4MRRA 3Q8XB 4B3XA 1S96A 4IFBA 1Z0DA 3SEAA 2G83A 1EWQA 4QHYA 1VHLA 3GLHB 3ZIAD 3N2EA 3QPVA 1ZUIA 4Z8YA 2QBYB 1OXTA 1VDZA 4LJYA 1ZCAA 2YJTD 2VA8A 4WXRA 2GJSA 2ZJBA 4JVMA 3R8FA 2WWYA 4FCWA 3K9NA 1G5TA 4AK9A 2W0SA 1JPJA 3FE2A 3MD0A 4Q4AA 4Y0VA 4GP7A 1D8TA 3EWSA 4YC7A 3RLFA 3ZS9A 2VHUA 2RH5A 3GEIA 4UXHA 4JLKA 1ONBA 2YYZA 1A82A 4V02A 1NRJB 3B7GA 3P32A 3KKOA 4OQFA 2GCPA 3THXA 4JZKA 5AJWA 1RFLA 1YJ5A 1NN5A 2PT7A 2ZJZA 5FOSA 4DDUA 3LO5A 4Q4AB 4EJSA 3R9WA 2GF0A 2J9RA 1UF9A 4ZV4A 3AP2A 3ADKA 5TV2A 3U6BA 1Z0KA 2QROA 1Z0IA 2IS6A 1CBUA 4URZR 1XPUA 4Q7LA 2AKYA 4XD7D 1H8HA 4ZI3A 5F9FA 3QXJA 2DWPA 1CJVC 2ZJAA 2A9KA 1U8YA 2FJUA 1SXJC 5FUYA 4BLOA 4OK3A 1AZTA 3VU9A 3EX7C 1XMJA 3THXB 1W1WA 3ND8A 2Z6VA 3CF2A 4PZYA 2ORVA 4UKDA 4EJSB 2WAXA 3CF0A 5A5GA 5C46F 2F1JA 3SR0A 3NDBB 1FNMA 1NVVQ 3QE0A 4IOLA 4A2QA 2GF9A 1GL9B 5DN6D 5LBIA 2Z4SA 4KU4A 3WRYC 1TUIA 2GKSA 3FHTA 4ZCIA 1E1RD 1RRFA 3D3QA 3VU9B 1GRRA 2J59A 4MGZR 3K70C 1AS3A 1W0KD 2AXNA 1E0SA 1Y63A 4P0TA 4AYWA 2ANCA 5EXPA 1IXSB 1VIYA 3U6KA 2O8CA 4C9BA 1T9HA 2AFIE 4PR0A 1Q44A 2NZJA 4RFVA 1N6OA 3GCGA 2H1LA 2TMKA 2YKGA 4DWJA 4TTPA 4LBZA 5M04A 4OI0A 4HB2A 4KXFB 1SVMA 2RB4A 2LWIA 3LBHA 2D7CA 2LKDA 4C0LA 1NY5A 2MSDB 5JEDA 2ZRJA 2GWHA 1U81A 1LV7A 1T5IA 3QBVA 3SJBA 4MA4A 4QC2A 2O8CB 2JATA 2P6NA 1E0AA 1JEDA 1KGDA 2WBLC 3IEVA 1XTJA 5H68A 2BMEA 4PPFA 3CWZA 2QEQA 1GKIA 1LS1A 3KUCA 1I4DD 2CJWA 2F6RA 3WYAA 1KI9A 3GJ0A 2AL7A 2WJGA 3VHXA 2HUPA 4DSOA 5AUPB 3GQBA 2WJHA 5C4MA 3CW2A 4AWXA 4HAXA 4GITA 4CVNA 2BBTA 3QXSA 4RY2A 2VTKA 2GJAA 5TMPA 5DYGA 4KVAA 3B85A 3VR1A 1H8EA 1S8FA 2BJVA 1BIFA 4ACAA 2D7DA 3BS4A 1QHNA 5KSYA 4QGHA 3QJYA 4M2LA 4BFZA 1ZD1A 2QMEA 3G0HA 2ODWA 4B3CA 2CJWB 3GJ8A 1RE0A 5CDFE 4G01B 2AD5A 4Q7MB 3U44A 3ZLJA 1KY2A 2X19A 1EFRA 4EUNA 1LF0A 1D5CA 4JBYA 1WRBA 4DLYA 1GG2A 4M1TA 2CL6X 4IEEA 4PAOA 2XTNA 1FP6A 1O87A 4DCSA 3PUYA 4BEBA 2CLDX 2R6AA 4AD8A 4DIDA 2Q3MA 5BN4A 1TF2A 2WJYA 1IN5A 3MWLA 3E1SA 5EXXA 3WYGA 3DO6A 2ZPTX 3IGFA 3FGNA 5FOWA 3U44B 5SZHB 2FN4A 1XCGB 2VBCA 2IYZA 3T1VA 2OHFA 2QM8A 1EG7A 1IN8A 3GLFE 3VAAA 4I1SA 4IEIA 2PL3A 3IILA 2VSOA 3AB3A 2ZEJA 5JSZB 2Q3HA 4A0FA 1D2EA 3LBNA 1N2CE 2J1LA 2QY9A 3I8XA 4TT3D 3W3ZB 3VR3A 4M1YA 3BORA 3MWKA 3V4RA 2F1RA 1VHTA 2DWOA 1G7SA 1W0KA 2ZJ8A 4TLDA 1IHUA 1G6HA 3U3KA 3S1AA 4JLMA 4BLRA 1TF5A 1BKDR 3WMEA 2CLCX 1JR3E 4Q1CA 2XB2A 1M7HA 1E2FA 2R44A 1Z2AA 2P2LA 2AKAB 1ZU5A 4LWZA 1SVOA 2WV9A 4KSBA 1GTVA 2A7QA 2IXEA 1HA3A 1OSNA 2O5VA 4IDPA 1Q3HA 3S1AB 4DUGD 1PLLA 1HUQA 3P4XA 5FPTA 1Z6XA 2IA5A 4HAVA 4HZUA 2IWRA 3MG9A 2IYVA 1UPTA 1U2RA 1JAIA 2C78A 4A92A 3KQHA 3IDQA 4RD0A 4R7ZA 3PENA 1OFUX 3VTKA 3AJIB 4LX0A 1YZGA 5FPKA 4AURA 4GMXA 2CDNA 3ASYA 4XTCS 3WXMA 1TL7C 1DS6A 1E9AA 1WXQA 2CBZA 2FZLA 4HUQA 4V0NA 3UG6A 1G8GA 4NPHA 1JBKA 1VTKA 2V55B 4HZUB 4PX9A 4UJ3A 2XXAA 1W5SA 2BMDA 4C2UA 1UAAA 3A1WA 1P60A 1CF4A 3IO5A 2VF7A 3WP0A 3SYLA 4D4MA 2QNRA 4NYMR 4Q9LA 3CRW1 4HLCA 4KBGA 2OLKA 2GDJA 2H57A 3NBYC 3VNVA 721PA 4HUQB 4KSCA 5DNYB 2I4IA 2RHDA 3BFKA 2XXAB 4GBMA 4JLDA 4X8HA 5AUOB 1AKEA 4EPVA 2ZSDA 5GJCA 1PLJA 4GP6A 5UKDA 1EFCA 2IYRA 2QG6A 2DPXA 2Q9AA 4NE2A 2VO1A 3MRSA 5J5CA 1E0JA 3FVQA 1AM4D 4FIDA 3T1QA 4CW7A 1V5WA 1OB5A 2IYSA 3LFUA 2G1KA 2W2XA 3I92A 2KE5A 4URWR 3BH6A 3U5ZB 4YMUA 1IN7A 5TDHA 4F4CA 4RZUA 1GZSA 2EFDB 1KO1A 4KFTA 2IF0A 4LV5B 4MGIR 3EPJA 5CIQA 4JLBA 2ANBA 3EAQA 4TT3A 1ZINA 2A5YB 3U3JA 4AKEA 4JSTA 1QVRA 4MKGA 1EX7A 1YR8A 1CS4C 3QPUA 1E2IA 2IYUA 2WM9B 1AQYA 1KY3A 4RD3A 1YE8A 4HAWA 4AKGA 3LVRE 2HLDA 4QL3A 2A3RA 1P2UA 1Z22A 1ZJ6A 3M4YA 4KV9A 1YQTA 4B76A 1V43A 3B9QA 1ZYUA 4QNRA 2V8OA 4JL5A 3RANA 3RVBA 4BZQA 3OAAD 2C96A 2XTMA 5KU1A 3Q3JB 1M6NA 4Q4JA 2L0XA 3NH6A 3HPRA 4JVLA 3NKVA 4DC9A 4GSYA 4OI2A 2CL7X 2ZRDA 1LY1A 3FHOA 4BPBA 2ATXA 2J0SA 4RD4A 1BS1A 2ZI9A 4Q18A 2XTZA 3AUYA 2RGNA 4V0KA 2C9YA 1KK2A 3WBKA 1DELA 1K6MA 4U7DA 3RS7A 1ZIOA 1Z8FA 2O8BA 5KDDA 1DAEA 1N6HA 1TADA 2F9MA 1R8QA 1QDEA 1RZ3A 2H18A 3DZDA 5JEEA 5KSZA 4FMCB 4W5WA 1ZM9A 5E95A 4U5XA 2FU5C 1Z2CA 1CKEA 4Q21A 1NNEA 4LRWA 1YZNA 3GD7A 1HQCA 4LHYA 1G21E 2PLFA 3K53A 1P9RA 4C0HA 2XOKD 1GRQA 4RCZA 2VSFA 4Q4HA 3L43A 2O8BB 2GEDA 2VPPA 4KVGA 2J45A 4PFSA 1KSJA 3RRMA 1KO8A 2A78A 2WICA 5JRJA 3ZQ6A 5EP1A 4TYYA 3UWKA 2CCGA 3UKDA 5H8WA 1TEVA 2EW1A 2R6DA 5EXSA 3EZ9A 4JLNA 4QFMA 2EQBA 2AWOA 3B1VA 3Q7PA 4LBWA 1W36B 4D4LA 2VP2A 4QJ4A 1J8YF 4AY2A 2YVUA 4Z1MA 1GDDA 3JVUA 4C0JA 1X37A 4Q4HB 4JYCA 4M9SA 4NL4H 3ZS8A 2HYIC 1JQLB 3KTAA 2X2EA 3FPAA 2YWGA 4AIIA 3HU1A 4QHTA 4WA7A 1DAMA 3TUZC 4RD6A 1UBEA 2W6JD 3BXZA 4R2IA 4DCNA 2Q9BA 4ZDKA 2Q21A 2IF2A 2GAOA 5AJXA 4WIAA 4CT4B 3BRWD 1YZTA 1MH1A 5AJZA 5KOYA 1SXJE 3K9HA 3OE7D 4TMTA 2BWJA 4I1OA 2PCJA 1KK3A 1M7GA 1FUKA 3PEYA 1CRQA 1R0WA 3TW4A 2FPKA 4JT2A 2FFAA 4CYMA 4L4UA 5B30A 1RRPA 2PX3A 5CM9C 1UFQA 4P3YA 3TKLA 4FCVA 2HCJB 3EIHA 3KDSE 1W4AA 2Z5FA 1DPFA 3ZGXA 2H92A 4QGGA 4LYAA 2ZSFA 1PVOA 2QENA 2NPFA 4MQBA 1KAGA 2BEJA 4DSNA 1XPRA 5FTMA 5LPNA 1U9IC 3TAUA 1U8ZA 1XJ0A 1IOZA 3F8TA 5DIFA 4WXPA 5JCPA 4XWOA 1P2TA 3DM9B 1R0ZA 2Q3FA 1PJRA 3JZAA 1RW4A 3D8BA 2DFTA 4EPWA 4CEJA 1NVXQ 4TLAA 2XZLA 4FMDB 1LF5A 5EJEA 2WTUA 2HF8A 5F3WB 1N6LA 2ZRAA 4UNSA 2W6IA 1E69A 4NBSA 3OEED 2GNOA 4LHXA 1R5OA 5CYOA 2W83A 1QHHA 4BUJA 5K8TA 2WAYA 1S3SA 4W5JA 1N5JA 4NTZA 1Q22A 4CEJB 4QG7A 1JXOA 2ZYTX 5E7MA 2GBLA 4IHQA 3HYRA 4NZYA 2QSYA 4NCHA 2HJVA 3DHWC 1W46A 3L0SA 5K8UA 5KUTA 1QHHB 3NHAA 1OF1A 2F9LA 4LJ7A 1CIPA 2F1IA 5BQ5A 5GVSA 2DBYA 4KFSA 4KYIB 5TY0A 4RSGA 3WMFA 2D4HA 3X2SA 4XWAA 4YXWA 3D7MA 5EE0A 1GFIA 1KI6A 1W0JA 3LH5A 4S2EA 1KIMA 4B47A 2C5LA 2H5EA 3W8RA 4A2PA 2B6HA 4Q1BA 4B32A 4A4DA 2ZRPA 2F43A 3LQQA 4M22A 2GZHA 1WE2A 2QW6A 1Z07A 4D26A 2YZ2A 1XXHE 1DARA 1U99A 4A0HA 4NYIR 2KJQA 4J0QA 4PHGA 2I1QA 2NG1A 2F1HA 4ON9A 3TSZA 1W47A 3RSOA 3VQTA 1NIJA 1P2VA 1LW7A 1NY6A 1KI6B 5DH9A 4ZDWA 1U98A 1TNDA 1FQJA 2F43B 4D80A 3OZXA 4PQFA 4Q01A 5L3VA 1XCMA 3GFOA 4NH0A 4F7WA 3FB4A 2EFEB 2ZI3A 4JS0A 1HE1C 3WHLA 3AKDA 4KI0A 4X8OA 5J4LA 5FL7D 4QM7A 3AV0B 1KJWA 4HB4A 1OH8A 4RKEA 4W5HA 1T3HA 1HEIA 2IXGA 4DJTA 2PEZA 1OKKA 4HYYA 3V00A 1G3RA 3LNCA 3BFXA 4CRWB 4XIGS 4IDQA 4C0QC 4HZIA 3SFZA 1KNXA 3SQWA 2J0VA 1B0UA 1E2PA 3B82A 3BWDD 4YONB 3VLFB 4NYJQ 5JBQA 2AR7A 5JWOA 1R0YA 3UIEA 1KAOA 4HLUC 2V6JA 4FWDA 4D4JA 1TU3A 3C8UA 3QF7A 3ZVLA 4A0RA 4OQLA 3ZVMA 1Z6GA 3NC1C 1X8JA 1Q3TA 4B73A 2FEMA 3B8HA 2XJ9A 4K46A 2B92A 3W90A 5FBVB 2IUSA 4LV8B 4M0LA 4DLSA 2QZ4A 3P20A 1E2QA 1K5DA 2PZFA 2XZPA 4AYTA 4NYMQ 2R62A 1E79D 2ORIA 2V54A 3QXXA 1U0LA 8OHMA 3AEZA 4C0BA 3BERA 3LA6A 3LVQE 2ZU6A 3PIRA 3K0FA 3FKQA 4TLEA 2JLVA 1HT2E 1X3SA 1KSHA 3QG1A 3R9IA 2BCGY 2JCSA 5KNBA 5LB2A 3LX8A 3PJRA 1SHKA 4BRUA 3SN6A 3U3RA 3X1ZA 4DLZA 3ND9A 3GJ3A 4ARZB 3U4QA 2ODBA 3UK6A 2OV2A 1NBMA 4NCKA 1NMZA 4WZ6A 2N42A 3TW8B 1W48A 1L2TA 1IONA 2OFOA 1N25A 2IWHA 3VR2A 3K0FB 3ZZ0A 5CB6A 2OE2A 3OF5A 5D3MA 2WKQA 3AVOA 4QHSA 3KQKA 4G3XA 3KFVA 3BIFA 1U90A 2YOGA 2GHIA 4CIDA 3CNLA 3U4QB 3NEYA 5IK2A 1N6IA 3BBPA 4ASUD 3IHWA 1QHSA 1XTSA 1SXJD 1ZW6A 5KDOA 1EFHA 2CMKA 1VPLA 4GOKA 2OBNA 4FWTA 3B6EA 3AH8A 2Z43A 1SGWA 1DAGA 4TYPA 3T1TA 1KSFX 5D3MB 5DE3A 2IUUA 1OE0A 4B48A 5JECA 1R6BX 5P21A 3CONA 3AF1A 2EYUA 2BMJA 2VHQA 5FBRB 1KI4A 1GM5A 3LDAA 2FSIA 1Z08A 4WZAE 1AA9A 5FL7A 2ZM5A 2NQ2C 5CLLA 1R5NA 3R20A 2E87A 3WP1B 1N5LA 4B35A 3QIAA 5A4JA 2UKDA 4JLVA 2ZRGA 3UWOA 5BWMA 3AVPA 3CRMA 2HYDA 3K70D 2OCAA 1D9ZA 3PUVA 4RZ2A 2DHRA 1KJYA 3NTUA 4F92B 4NCNA 1ANKA 2DFKB 3AGQA 3IEUA 3J81k 3GLIE 2NO6A 4M1KA 3SE0A 1G20E 3SC3A 5C1BA 2P67A 4TQAA 3SQXA 1XTKA 3ZYCA 4O0MA 3BE4A 5FOUA 4TZ6A 5TB5A 2X1VA 2WOJA 4ZO4A 4Q00A 2Q9CA 3TJZA 4LJ4A 1T91A 5CIWA 1CR2A 2IS1A 1G3UA 2W2VA 1NIPA 2HEIA 4DCTA 1QRAA 4YMSA 5EUQB 1ZNWA 1YU9A 1PUJA 2BHRA 1RJ9A 1ZRHA 5SZIA 1QHGA 5FBLB 1F48A 3ECCA 2B8TA 1I4TD 3VMFA 3FFAA 2KBFA 3BFVA 3C5CA 1ZVQA 2NTYC 5DHFA 1XP8A 1ZM7A 2DZOB 1Q57A 2PZGA 1NG9A 4DLUA 3K0CC 1FFHA 2QI9C 2ZSEA 1E1QA 2V1XA 5JWRA 1RJ9B 2BBSA 1AKYA 1BYUA 2RGDA 2F3RA 1RVDA 3LLUA 1CR4A 4DRZA 1SVSA 3C16C 3CF6R 3CZQA 3GLGA 4ERNA 1KTVA 3KQNA 3U7EB 1Z28A 5LDDC 1W44A 3B2EA 2NMVA 4MKIA 1DOAA 4MKHA 1CTQA 1BYIA 2O8EA 1GL6A 4DSUA 4XSGA 1E6CA 1S0UA 3K0AA 4PTLA 1G3QA 3GLGB 2WSSD 3U7FB 4TMXA 3O8RA 1QF9A 4BFWA 3LRPA 1G1MA 4ASUA 4JN6A 1R7RA 4M1WA 4CGZA 5DGXA 5GJVC 4Q03A 1MO6A 2O8EB 1XMVA 3A4MA 2PX0A 3HU3A 3MJRA 3SJCA 5JHGB 3X1XA 3B1ZA 1TQ4A 2CCKA 2EFHB 2VP5A 1Q12A 1YR6A 3K0AB 2GA8A 4P4UA 3BGWA 4G5GA 2CHQA 3VFDA 2QMOA 3QPWA 3U61B 3LAWA 3UMFA 4D25A 2ZJ2A 4BEJA 2HXSA 1MT0A 2ODEA 4LUCA 3ZDQA 4JJZA 4A36A 3T5DA 2UZIR 1ZNYA 4UNPA 2R9VA 2ZRCA 3PR1A 5AWFC 1T5LA 5CITA 5HKKD 1SKYB 2NZ8A 2KSQA 3I1FA 3LXRA 2IC5A 3Q5EA 4R2HA 5BYJA 1GNRA 3OFNA 3O8CA 4V0LA 1MV5A 4LV6A 2IYTA 1OFHA 3KKQA 1N0WA 2QQEA 3IPXA 3OEHA 1G3MA 3KKPA 4EJSC 2QE7A 4B44A 2PMKA 2G77B 1T8UA 5F2EA 4CEIA 3CZPA 1JECA 5DISB 2H8KA 1NN0A 2BV3A 5IT5A 2XNDD 4QBHA 2X2FA 1M2OB 4OKSA 4DKXA 3CR8A 2A5DA 2REBA 1NL3A 5BN5A 2OAQ1 2OLJA 4Q7JB 2RGAA 3LW7A 1JALA 1VCOA 2EWWA 5EZ6B 4E5UA 4N0DA 1UKVY 4UNQA 2C95A 4BLSA 1FTSA 3RDPA 4CEIB 3FMFA 4C7OA 3GPLA 1F5NA 3LW8A 3ZIAA 2N46A 1ZP6A 5K8LA 2JA1A 5BXQC 1W49A 2AXPA 2X77A 3L2OB 4MUBA 3SYNA 1AS0A 5FPHA 3QOFA 3K9GA 2LKCA 3ZVNA 2VYFA 5G41A 1FMLA 3IPYA 1VG9B 3IQXA 1DTSA 2AD1A 4GZLA 5GADl 1ZC4A 1HY3A 3EASA 3LWNA 1GNQA 1KYIA 1KOFA 3BC1A 3B13B 1ZCBA 2HT1A 3CX8A 4C7OB 2IX3A 3H1TA 4NYIQ 3OIUA 3T61A 4DDWA 1G4AE 3VKWA 4B3BA 1HYQA 1R5BA 4HATA 2J7KA 3PVSA 1KKMA 2QGNA 3A4NA 5C2JB 2FOLA 2Z0MA 4TQUS 4L9SA 1E2NA 2PCLA 5KDLA 3EC1A 5HTKA 4QM6A 1EFUA 1MO5A 4AKIA 3RS0A 4B33A 3A1TA 3A58B 2REXB 4YMWA 1OH6A 1XEWX 2HCBA 4L15A 2P6UA 4KODA 1XDBA 1Z06A 2P65A 3A1VA 3DEFA 3IBGA 3A1SA 1J2JA 1VG8A 2QN6A 5JSZA 4MRSA 3EPKA 3T34A 1RYFA 2CK3D 3WRXC 4C3ZA 2IS2A 2A5FA 221PA 4XD7A 1IAQA 2JJ2D 4EPYA 1XD9A 3TNFA 4AG6A 1CJUC 1GVNB 2ZITA 3K09A 4AG5A 4HAUA 5HCNA 4GT1A 4ZPXA 2IT1A 4PAMA 4MRPA 1IXRC 5JJIA 4POAA 1A2BA 1KDOA 3W34A 4FINA 4LHVA 2J0QA 4G1UC 5DN6A 3HYTA 4NP6A 1FUUA 1E1RA 5KPDA 4URUR 3FDIA 3I32A 3VR4A 1SHZA 1ETUA 4PO8A 1ESNA 1X8LA 3EG5A 4D6PA 2P5SA 3TGPA 4XH9B 4IVRA 3MJHA 3ASZA 3PEUA 1BH2A 1KNQA 4PPGA 5JS8A 1OYYA 1C4OA 3HPQA 4LRSA 3KQUA 2O0KA 2JDID 3SBEA 4V0MA 4MGYR 4AKHA 3MSXA 4QKQA 4A82A 2O0JA 1GP2A 1E9RA 5AJVB 5F98A 2GTPA 3AQ4A 1VYUA 3TSOA 2OG2A 2VSXA 3HJNA 4M53A 4R9UC 2O8FA 2FH5B 2HF9A 1OH7A 4U00A 4NYJR 5H1YA 5SZKB 4BFUA 4LJAA 3OIYA 4K81B 3WMGA 4EAQA 4LCBA 4DSTA 2YWHA 2WWWA 5G3YA 4B3DA 2LCFA 1QHIA 2HV8A 4M9ZA 2ZJ5A 2O8FB 3U7GA 3UMSA 2ZUCA 3FKSD 1G8YA 3WBJA 2BJWA 2ZR0A 1R8SA 3NBZC 5CM8B 3ICEA 3AVTA 2ZE5A 1Q1EA 4IXNA 4PHFA 1YVDA 2GCOA 4Q1FA 4GL2A 3I62A 2J3EA 4F91B 4PC1A 4Q5IA 1WP9A 2JJ8A 5A0FA 2DWZB 1EFTA 5TARA 6Q21A 1UM8A 1K8RA 2RGEA 2ZRFA 3KFXA 3B1WA 4W9MC 2GJ9A 3L0IB 2QU8A 4HEJA 1Z0JA 2C9CA 1F3OA 1WB9A 4LBYA 2C04A 3QKTA 2GCOB 3VX4A 5B57C 3L8YA 1XMSA 1EWRA 2OBMA 5FTNA 2QT1A 1T3SA 2O52A 2YWFA 4F93B 1JXMA 4KJZA 2GEUA 4A6PA 3AKYA 2D06A 1PUIA 2GXSA 1T0HB 1DAFA 1E2EA 2G88A 2I1VB 2IYXA 1WMSA 1NBME 4W7SA 1HH4A 2A2ZA 2AWNA 2GZAA 4B3GA 1NVMA 3GJXC 3GJ5A 1XEWY 4TMWA 1KO7A 1RRCA 3O47A 1U0JA 1E0KA 2O0HA 1A1VA 4WW0A 5FTJA 4B2PA 4NCIA 4IFEA 3H86A 2OAP1 1E2DA 1UKZA 5CK5A 5FUXA 2WWIA 3NIBA 3I72A 4EKDA 2GRJA 4YDSA 3IHLA 1P73A 4DUGA 4ZDIA 4IKEA 1N0VC 2KWIA 1OFIA 2R65A 3ZD7A 2ZAMA 2AHOA 2D3WA 1LVGA 3I5YA 2P5TB 4JLAA 4FI3C 4KFUA 4RKFA 2QP9X 4BRWA 3AF0A 3LBIA 3SU8A 3OHMA 2E9SA 3GFTA 3X1YA 5JRZA 1OLOA 5JJKA 5KNCA 1II8A 2OSBA 1KMQA 2ODNA 4HAZA 1EGAA 4K8OA 5DI9A 1GSIA 2QAGA 1NLYA 2DY1A 3L8ZA 5AUQA 2DR3A 1QBKC
chains in the Genus database with same CATH superfamily
5YASA 2OCPA 5BRAA 4P17A 3TRIA 4UMEA 4M99A 4JSRA 2VTVA 4BLVA 1VIMA 3AI1A 2ZREA 5CJPA 4JKIA 4QJIA 5FUVA 4J6FA 3OOHA 1ESMA 2BVNA 3W2EA 8ADHA 4MB2A 1VKZA 2G6BA 2IY7A 1PGJA 4AC9A 3TOCA 2ZWOA 2ZYVX 3TK1A 4X94A 5DOVA 3AEUB 4ZAWA 3DMDA 4QTZA 4QE3A 1C2TA 1G8PA 2O23A 3LTNC 1XROA 1AE1A 4MEJA 1BS2A 3V46A 1T0PA 3B9PA 2AEMA 1WZEA 3F3YA 1L5QA 3BE8A 1L2CA 1YJXA 2AMJA 4YMGA 2IY9A 2K9DA 3A2KA 3UAZA 4JITA 4G3OA 2Y9MB 2GXAA 1JR4A 2IEIA 3L8DA 4HDNB 1C3XA 5K05A 1JAHA 1K75A 3FRHA 5CXUA 1CQJB 3VNAA 5HJ5A 2ENWA 3NUQA 2JA2A 2DHDA 2Y9PB 3ONDA 4BYGA 2FFBA 1GL7A 4TVBA 1KRHA 4QEDA 1ZY2A 1EM8A 3L6OO 3FOAA 1VBFA 3OE7A 1G2PA 2BR3A 5DLDA 2XV1A 2P4EA 1OTXA 3DTVA 1H2XA 3KEGA 1JS1X 4RPGA 3CEPB 2UVQA 1N2CB 4YQZA 3PHIA 3MWEB 2P91A 1QQWA 5AR1A 4YUAA 2FA9A 2JBHA 1BX0A 1GPUA 2IEZA 1LDNA 3PG5A 1YR9A 5AVXA 4YT8A 3VR6H 4OHXA 3SICE 2XMQA 2O9JA 4ZO7A 4MRMB 1CJSA 4HSEA 3OECA 1RC1A 3TTXA 2HFKA 3CRRA 4C0AC 4LHZA 4MS4B 3T3DA 4QTTB 3JQ8A 3I23A 5DHAA 2UDPA 4A15A 5HX7A 1X14A 1QX4A 3ZWXA 4MAFA 1W6UA 1U1FA 3L84A 4P8RA 1VIAA 2J09A 1TQ6A 3MJSA 1BXZA 2C4UA 1FP7A 1VLMA 2VKTA 2G3QA 2GAFA 1VIDA 3RRJA 5F9HA 1ODSA 3BWMA 2DPYA 1IBCA 2ZCJA 1UKBA 3LT4A 3PGKA 1VE9A 4I08A 3LY9A 3UVEA 1XMQB 3STTA 4R7GA 3C74A 5H83A 3JQEA 4DG9A 5FWDA 1PR0A 4AJ2A 6PFKA 3HO1A 3T3EA 1SURA 1J9EA 1L5LA 1OC4A 1ZGAA 2WIBA 1WB6A 5LN1A 4ZVTA 2H0QA 2QTWB 4DB4A 4L8FA 4EW6A 4UE2A 1XYYA 2A94A 4RLFA 2V1CA 3AUFA 4L6AA 3W4JA 1T43A 4EFNA 4KYUA 2G4VA 1EWKA 1EVYA 3L1VA 1MRSA 5C80A 4MRVA 3ROTA 4YMTA 1J8VA 3P26A 4G0XA 4RZ3A 4YJHA 4NV0A 3AB7A 2WJVA 1UQRA 4D9BA 4RULA 3KKMA 2DHQA 4JKOA 1STOA 2GPSA 2AN9A 2C8KA 2PGIA 1D2GA 1YL7A 5HM6A 2V4ZA 3CX6A 2V65A 4U2CA 3VI3B 3E7XA 1ZRNA 1R88A 4L9WA 2UYYA 4CJ6A 1M72A 3D2CA 1VHWA 4Q9AA 4H1WA 2CFIA 1RWKA 1M76A 1P0FA 2QJOA 3P9NA 4XPIA 4EW1A 4FXPA 5IDQA 4ITQA 3ZH9B 3B60A 3DEYX 2CHUA 4BX3A 4Q9IA 2YVLA 4BO4A 4YUXA 4A16A 2GSWA 1JQBA 4QEKA 4EKIA 1GN8A 3I73A 2V0CA 2JKZA 1PLKA 3HVUA 3F6CA 5LZ4A 2FPLA 4KW7A 5L3ZA 4YUZA 5IM5A 2PD4A 1NR5A 1TJPB 2UZ1B 1PGYA 3QVGB 4YRZA 4S24A 4E5DA 1W85B 2GYWA 5CP8A 3HR8A 2I6SA 3NWJA 1RKUA 4L8VA 3I8OA 5AXBA 3B1XA 3O73A 5GZ6A 4MVJE 3QH4A 3EULA 4C5AA 2CWDA 4ITRC 1ECGA 1CUWA 4BLQA 4B3TB 3JZDA 5JYDA 1V16B 3I6IA 3DPUA 1N8NA 1RZVA 2R8RA 3TF5A 3MAGA 5BQFA 5ALSA 2UXBB 3QTLA 2NPIA 1WW3A 1HL7A 4O2BB 3O2SB 1Z4LA 4ME6A 2JVIA 4YDQA 2IGBA 5AQEA 1FPMA 3JYNA 1MTZA 4G8CA 2O2ZA 1TDHA 3K9LA 1FNNA 4UXJA 3NAGA 3TN7A 3P52A 4HGYA 1G20A 3FTEA 5BNWA 3F3MA 2GUWA 1QU2A 4PU0A 1YZUA 3OOWA 3I5XA 1Y42X 2W8ZA 3C3CA 4OU4A 1WSBA 3K1JA 5EY5B 1TZBA 1E99A 3AY0A 4MV8A 4DNXA 3HJQA 1BWRA 3PX7A 4Q4DA 1YQXA 3K0EA 5AT1A 1WD7A 3WWDA 1XF1A 4PYJA 2B4QA 3MWYW 4P4SB 1SULA 4JYPA 4CLXA 1LNZA 4QT4A 1BCRA 1PSZA 2IEAA 1CRWG 5JMPA 2HHCA 2YV4A 3QU2A 1C5KA 2HC9A 2WJ4A 3ZTYA 2MMCA 3S0JA 2L2DA 2XCLA 2GXUA 1X80B 2GVZC 4RY8A 4C07A 3WKDA 1HJPA 4FMCF 5K3SA 2WY2D 4CBVA 1Y1RA 3HWSA 4F8EA 2QVYX 2FW8A 3ZU3A 3QKRA 3Q8LA 1I24A 3PC2A 3GN1A 1PYGA 5B36A 1E3EA 2C0CA 1XFAA 4CQLB 1K89A 4Y2XA 3IVMA 3MJTA 3HFRA 3KHKA 4KRFA 4U3JB 1WSDA 3GUVA 1YIDA 4QGBA 4XYEA 1YLAA 4WGGA 5CTJA 2BZ1A 1ONNA 1ZAKA 4IIXA 3O5AA 3N2ZB 4I1RA 1PL6A 2IHBA 1VB5A 3QOWA 3Q0TA 5C52B 1Y6QA 4BFSA 1NQVA 1PZNA 4FMDF 1I14A 3DW1X 2XB4A 3RHFA 2VNSA 2JASA 3BJIC 1JDNA 4TTIA 4IY1A 3NNDA 3AP1A 4BLPA 4UVDA 2F5SA 4CKBA 3H17A 2WD7A 3RIXA 4B3TM 1C14A 2HBZA 2J46A 3SNHA 3NIWA 3LKDA 2QR3A 3GJSA 5ITXA 1W8DA 3BWCA 4LYGA 4DMUB 1FYWA 3W3AH 4AZSA 1N32M 2UXBM 2EQ5A 3SLKA 1OXSC 2HJ9A 4AJ1A 1FUEA 3PHBE 2AXEA 4NDNE 3ZVKA 2FCRA 1Z5UA 4RSHA 3SZLA 4ZVOA 4AZ0A 3NOQA 3IQIX 3H5OA 4GE3A 3WJAA 3WDKA 3ZU6A 1K3WA 4E1AA 4N3CA 5G53C 1PHPA 2CNWD 5EJAA 1JTEA 2XBLA 1X1CA 3U3DA 3NOOA 1JG6A 1IL0A 1C29B 2GESA 3RI3A 5JQGB 3PQ3A 4DR6B 4HO1X 3QEMB 4G36A 1QK4A 4KAJA 4INPA 5JS7A 4GF5A 4EQ6B 3K32A 3WLIA 1T1JA 2YXDA 4IG9A 5IU6A 5JLJA 4YV1A 4JNKA 3DL7A 5B3JC 2YZNA 4X1YA 3ZHTA 4EG1A 3COWA 1JHXA 4GQAA 4BO8A 3DBIA 4WNCA 4GRAA 1NXSA 4W9RA 2A5LA 3SC2B 3PR3A 4CMKA 3FTFA 4IIWA 4MYUA 3KPYA 3PDIB 3QSYA 3GRYA 1J4AA 4WBNA 5D51S 4WJKB 3FHCB 1UBGA 2G0TA 3MGAA 1VMAA 2YINC 1CQWA 3NXSA 2CNWA 1Z82A 2QBYA 1P5ZB 2B61A 3FYUB 5E7IA 4ND1A 1G8JA 1EWQA 1PZEA 2FR8C 3H1AA 4LJYA 1VE7A 2P0AA 2ZZNA 1HE2A 1G5TA 3OQMA 4FFRA 2ZTMA 2YYZA 5GZ1A 1AUQA 1TMOA 2Q6LA 3HYLA 4O4LA 5KMGB 1EZ4A 5TV2A 1MXHA 1NDQA 1Z17A 1I0LA 3QXJA 3AUKA 1GL9B 3GFBA 2GKSA 5I9NA 3D3QA 1ZXXA 3EWNA 1JG2A 3K70C 5EL0A 5HF8A 4AYWA 4RTOA 3WSWA 3BE6A 4MICA 2H07A 3IULA 4UUQA 3SJBA 5LQKA 3E9DA 2QN3A 3M49A 3COYA 3K9WA 1PCXA 1YBVA 2WNHA 2ICAA 4DADA 2BBTA 3B85A 1PU2A 5FNZA 5HA5A 1GUYA 4Q7MB 1KY2A 2OMEA 5IKOA 1D5CA 5FHQA 3KNZA 3UO8B 1NP3A 1ZJZA 2BELA 5KIAA 2ZIUB 1IMJA 4MW6A 3WYGA 4MV3A 2PSEA 2QX9A 1YZ3A 4BNUA 2J1LA 3MTEA 1QYDA 3V7NA 4ZK2A 3L9WA 2XD4A 4RIGA 4WLVA 4Q1CA 4ZYXA 1FFXB 5AI6A 2R0QC 3NEAA 4R69A 4TXJA 1Q15A 3JQDA 2ZFUA 2AG1A 3RFUA 1DBRA 3DWGA 3L0DA 3SE7A 4HUQA 2V55B 3F5SA 4O8CA 1XV5A 2V7BA 1ZOLA 1Q0QA 2O2IA 1CF4A 2B6NA 3OZRA 4JB0A 5F2KA 1EXVA 2JZOA 3B74A 1KU6A 2BCEA 4PLHA 3VKFA 5TQJA 2RONA 2AR0A 2BEVB 3IL2A 2IYRA 4CR8A 1CY8A 2OWDA 1IN7A 4KFTA 1BU8A 4JQZA 3VSDA 4JLBA 2XGNA 3LLCA 2HKIA 4KO3S 2JIQA 2IYUA 4OF4A 1GPMA 5DTRA 3LVRE 4WD3A 1QRSA 2VUUA 3I1YA 3E84A 3DJFA 5EZYB 1B7GO 4INZA 2IXAA 4JLWA 1DELA 5KDDA 3QX8A 1SPBS 3DZDA 2XCUA 3AU8A 4RL4A 3AL3A 2FU5C 3OUZA 1SO8A 1VXOA 3QUQA 4KE8A 1R6AA 1UIMA 3G9ZA 3GUYA 2WICA 3IUJA 4R84A 1TZJA 5F76A 1ZWKA 4QJ4A 1GGHA 3R7DA 3EHEA 2YXLA 1IHOA 1UBEA 1VSUA 4ZDKA 4Y1RA 1NQOA 4LE1A 1MHPA 3REOA 1LK0A 3VR6D 1AMUA 2HCJB 4F2PA 3KDSE 2H92A 2ZSFA 2HHLA 3UT6A 4RVFA 3W5VA 1YUNA 4HVAA 1UJ4A 2WAOA 3MCZA 3CNQS 4DUZM 3V8QA 3EFOB 3HEBA 3M5WA 5U4QA 2YW2A 1S3SA 3TR6A 4NTZA 4WFKA 4LZWA 3FUTA 1VDDA 3HYRA 2BFFB 1NHWC 1U65A 3X2FA 3KD2A 5FBKA 4LRXA 1JG4A 3HGQA 4B08A 2JGKA 3B9RA 5CURA 2IYEA 1CG6A 3UB2A 4Q3NA 4YXWA 4LFAB 1U3GA 5I9TA 3CN7A 4RTNA 1V35A 3L7MA 1DARA 4NYIR 1JA1A 2NG1A 3LCVB 2PANA 1LW7A 5EXDA 1T29A 4LE0A 4D80A 1WNTA 3T4EA 5BR4A 3WHLA 4QM7A 1JPUA 3AV0B 3FHLA 4PIVA 3LJKA 4H3SA 3V00A 2R6R1 3EY9A 3U4AA 3B82A 2PMFA 3PTAA 3VLFB 4MUGA 1VRVA 1TU3A 1N7GA 3HCOA 3GK3A 3B8HA 2GERA 1IRXA 2CP8A 2P3QA 2QZ4A 3AUAA 2LIPA 3AEZA 2JWSA 4B09A 1NNUA 2X2PA 1QV7A 1Y9JA 3ND9A 2EP5A 2QQGA 2YIJA 5HZMA 2WKQA 7YASA 2WHQA 4HEOA 2YOGA 4BUZA 4U63A 1J0XO 4CTMA 1NFRA 3MW8A 2OBNA 3OLVA 5C1IA 1H0SA 1WABA 5P21A 3AF1A 2C9ZA 4X7MA 1KJJA 4KWEA 3AF6A 1O03A 3JQBC 1GGEA 2C2KA 1W59A 3FE3A 3Q0IA 4KMSA 4XI9A 4QXOA 4NMLA 1JZQA 4K9QA 3RC9A 4YWHA 3U13A 2WZBA 4JXZA 5C0OE 2KBFA 5K0TA 2A33A 2W4IA 2VSYA 3ET4A 2ASVA 2OC4A 1HDXA 3HUTA 4OA8A 1BYUA 1AUXA 4DHWA 1WULS 1BDBA 1JDVA 3WBBA 3P2JA 4MKHA 1AKVA 4O1IA 2RGHA 5D6NA 3H2HA 1RYBA 2JFUA 1I13A 2X2OA 4RK5A 4PCZA 3ZHYA 3AUJB 4FZVA 4A8PA 3FNQA 4BEJA 5FIUA 4X71A 4UNPA 4BS9A 2UXDM 5HKKD 2NZ8A 4EDFA 2PX2A 1OOEA 2IC5A 4KGZA 2XF2A 3SC4A 2HWWA 3FOCA 4LV6A 2IYTA 3KKQA 5CYFA 2PWPA 2QF7A 4O4JA 1V4BA 5EIWA 4JH0A 3LP8A 2RKWA 4PTZA 5TS2A 4PCAA 1ENYA 1UPCA 1ZH0A 2RGAA 5B4VA 1DRWA 3T7AA 2B9VA 2EWWA 3KELA 1VPWA 3HS3A 2CDAA 1YONA 1V41E 1UM9B 2HK8A 2LVNC 2NSJA 4OMCA 2VXOA 4R3WA 3EXIA 4JWTA 4IH9A 1YE9A 4BAZA 4YP7A 1QBGA 2J7KA 4L9SA 1E2NA 2J5QA 3VDUA 1EFUA 2L17A 2GEFA 3R0JA 2DJ5A 5AVJA 2Q41A 5IC6A 5E6UB 3ZX5A 4DG5A 1J9GA 3E9YA 4EHFA 4YCSA 3HJ8A 1UMDA 1QZEA 1FUUA 4QWWA 4URUR 4BX0A 2O3UA 1PJQA 5JVDB 3HKPA 3VZBA 1G2IA 3NHPA 4EI2A 2RHCA 1P5HA 2OR3A 3Q8GA 1HO3A 1OYYA 2FZVA 2OGZA 1K1EA 4V0MA 3A10A 3MSXA 3BXGA 4A82A 3IV7A 5DFLA 4P7KA 4LWQA 3WJ7A 3GP1A 2OG2A 1U2DA 2HF9A 2CLIB 2FMFA 3L9XA 5EWMA 3ZD9A 5F64A 1L4MA 5J2UF 4X1KB 4BNZA 1Y8CA 3RFVA 1XJWA 3ICEA 1MLDA 2LDBA 4F4FA 3PQ4A 5FPPA 1T2DA 5IUKC 3GAFA 2GCOB 1GGFA 3JQ9C 4X85A 2VDWA 5ALTA 1MB0A 4F93B 3PNLA 1NBME 5IM4F 1BDHA 2GSDA 3QHAA 1O89A 1PQ4A 3KQQA 1JHQA 4NXMM 1JAYA 4NCIA 1ORWA 5CK5A 3PICA 2A9PA 3HY5A 2WFLA 4ZT4A 2GRJA 3HXMA 2W71A 2WLSA 5KJ1A 2WJAA 2ZTLA 2QP9X 4CUZA 1IIBA 1OLOA 1YK0A 3H6GA 1QBKC 2OBXA 3L27A 2F64A 5EAIA 2NQ8A 2BTEA 4JLOA 1J5XA 4KX5A 3D1LA 2C58A 1X92A 3RYIB 4LNHA 3ZKAA 3PUZA 4NDAA 1WZUA 4TTQA 1KAEA 5G0SA 4CQJA 3AKZA 4NEGA 5A62A 4GKBA 1YVRA 5HFNA 3NWBA 1G5IA 3GQ3A 4WCFC 3W3AD 4ZHQB 1P8JA 4NABA 1QDRA 3M6FA 2WM8A 1NNI1 1U9IA 2JCVA 1ECBA 1TU0A 1TT5A 2G8NA 1YHYA 1EESA 2JJ1D 3W2IA 4MQUA 4YRDA 2FPOA 3OAAA 4FOLA 1ECJA 3SSOA 1A9XB 3VJRA 1YOVB 2D5CA 4Q9HA 4HWPA 3EARA 4LJSA 1NQUA 1YFKA 1Z5ZA 2NVUA 2ZUBA 5KSOA 5BPVA 3N5KA 4HWSA 4BECA 2GT1A 1JEEA 1EIZA 2IP1A 4GI7A 5FUMA 2PSDA 5A6SA 4AJHA 1NYTA 3THYB 3DZFA 4XR4A 3ZDDA 5LQMA 3SI7A 1RAHA 4EENA 1VLZA 2AGVA 1S2IA 3LBAA 3A1NA 1F14A 2CYBA 2QSFX 2EFJA 1AS2A 1GR1A 3ZGZA 2UUBM 4II7A 4X1IA 3D64A 2Q5FA 4AG3A 3STHA 3SMPA 1H6UA 1V5EA 2QZ9A 1FSFA 1CUUA 4UM8B 2FEOA 3KSXA 4RTPA 3BWYA 3HV0A 1C9NA 5KO2A 1Y3AA 3FPBA 5KYYB 2VNAA 2YFHA 1JNYA 1CS0A 3KU1A 2B4AA 1ZHHA 3UH1A 4O6VA 1KFCB 4BV8A 2FP4A 2CB9A 3T7CA 1QS0A 2Y6VA 3U4GA 2N35A 3SBOA 4RVNA 2YC4C 1HC7A 2W0MA 3AEKA 2QSJA 1K6IA 4IIFA 3FMIA 2JAOA 4P35A 1E9DA 3O8QA 5K3OA 3UHAA 3QVJA 2HCRA 2V3WA 3PZRA 1K7YA 3AV3A 4LKOA 3QMWA 4KQIA 1V11A 1LRLA 3HVHA 1H8HD 1JFTA 3RGWS 3ORYA 2YASA 3MLBA 1E60A 3EYAA 1LDEA 1QE3A 3ZK8A 2B25A 3OCVA 2EFYA 4X91A 3DOHA 3TAXA 3G89A 5H9WA 5EYPA 5ELLA 2O3SA 2PV7A 3PKIA 1WIVA 1XPOA 2O8DA 4C2BA 1BQEA 1UWVA 1VLJA 1WPRA 2VP0A 2HJGA 4KQXA 3W6PA 4G9BA 4BGDA 1Z6YA 4ENRA 4FJ1A 1UK8A 1DTEA 2FX3A 3A6FA 4JI5B 4KXVA 4KR7A 1TQDA 1OWPA 3LI2A 3BTUA 3RWOA 4DPKA 1KEVA 1DVRA 3CUTA 5JSYA 1DC3A 5JFGA 2D62A 4PZZA 2OFWA 4QQ8A 3F3KA 4CF7A 1E3LA 2BGWA 1JU9A 1QQTA 2DENA 3TBHA 1HDYA 4PXAA 3JQAD 1XFDA 3FTQA 1RKXA 5K8VA 5CA0A 3EZ2A 3F4BA 3DDOA 3R9XB 4FW9A 1CB0A 1H0RA 3VKHA 3KBOA 1T2NA 4D99A 2JXNA 3BXHA 3FDXA 3DOFA 2IDZA 1HE4A 5J1SB 2XEXA 1BDIA 4YY3B 1U0HC 2DBQA 3IAS1 3LUBA 4GI1A 2HHJA 1JKJA 2AN3A 2OPFA 4MGKR 3FIUA 4DJEC 4S2UA 3FTPA 1TUBB 4LJ6A 3MQFA 2ZTSA 2ZXFA 3BJMA 2RCNA 2BKXA 3D5QA 4FNAA 4M4SA 3FPKA 4YHHB 1O2DA 2QMUA 2ZRNA 5LIPA 2G0NA 1XZCA 4OQ4A 2QQ5A 4B6RA 4A5OA 4FXOA 1MO2A 421PA 2JI6A 5FLYA 3F5FA 2EGUA 2PLNA 3AEYA 2VP9A 4YN3A 3IDZA 4Y6LA 2FMHA 3D0QA 5KX5F 3BKWA 1A9OA 3CJRA 1N2BA 5ALLA 3FDFA 1OTYA 1FE8A 4KVZA 3CRQA 1X1RA 1GJRA 2H52A 3R3HA 1J5EB 2OAEA 1RKBA 1TAGA 1VE1A 2QAIA 3BRSA 1TMKA 4FFDA 5DSTA 1RJFA 1Y8QB 1VMIA 2XCIA 2RDMA 3SIRA 2ZS9A 5BV0A 1G291 4MYHA 3OQIA 2P9JA 3UJBA 2Q4EA 1RMQA 4IDHA 2ZJ6A 2F5PA 4MS1A 1SCJA 4RESA 4LI0A 3WJ1A 2VRWA 4BQRA 1FYXA 1I3OA 1CZKA 4XFJA 1EUYA 1O7JA 5AOVA 3R8CA 1F4VA 2QD2A 3IVGA 3BB3A 1RWOA 5FORA 5CEJA 3I9KA 4KREA 3VTAA 3P94A 3EBOA 4LHEA 2WA1A 2XITA 3ND7A 4JKYA 1IZ0A 3GT7A 3F7NA 3HR4A 1TTQB 2QUAA 2V59A 4D0SA 5DEIA 3I2KA 3IP6A 3BE5A 4EFMA 1A1SA 1KDTA 3TLZA 1T9GR 2A3NA 3FKSA 4FUQA 3EIEA 1SCUA 3O8NA 2ZUSA 2DETA 3I9NA 5AKHA 5LP6C 2BKVA 3CG0A 5IJ0A 2W58A 4C03A 4D7AA 2EHDA 3K0BA 3B70A 1JSZA 2O14A 4AUEA 2VNKA 5AW3A 2QYSA 3D9QX 3C97A 1ZGCA 2ZRQA 1LSSA 3G59A 4KXYA 5K0EA 3DG9A 4LRTB 2J4FA 2E4ZA 1KQ3A 3QWFA 2BEUB 3NVDA 3PQ5A 3DLBA 3MGKA 3H1PA 4G07A 4UM9D 4RTSA 4NF2A 2Q6TA 4FOOA 3KSZO 3PXDA 5TEVA 4HGRA 4JBXA 2C83A 3JR7A 1U8CB 3EIXA 3TOXA 1GOTA 2OO5A 4AJKA 3BBZA 4RANA 3EDCA 2AXQA 3QMVA 4DV0B 1ZD9A 2JGDA 4LKRA 5K03A 5DHTA 4NZZA 3SYKA 4KWCA 4MWTA 1B3BA 3IKJA 2RGUA 4YHHM 3EEIA 2H2GA 1T4MA 2XUJA 4L5JA 4IOJA 4N8SA 4C21A 3PD1A 3RUEA 1ADCA 1OHHA 1UBMS 1DSSG 4FN5A 3DV0B 4HL6A 5HOEA 1DC4A 3LPDA 2OHXA 2CUNA 9MHTA 3C3XA 2PY6A 5H4HA 2O2CA 4P3NA 2IJGX 5DI3B 1J5EM 3QYPA 4N54A 4GLOA 4PX2A 4TL9A 4CG2A 2ATVA 4LAFA 2ZUDA 3OMWA 1BFKA 1XRMA 1MX1A 2AJTA 3ZHCA 2ZB7A 4RFSA 5FTWA 1K6XA 3PU6A 4DIBA 1NC1A 1ZI8A 2OM2A 3UMJA 4UBOA 3IOMA 3GYGA 5LQUA 5BW8A 3UTDA 1QP4A 3SQOA 3HBAA 3WGOA 2HK6A 5HZKA 3MMPA 3NM4A 2JFBA 3QVUA 4G81A 4D8WA 1V95A 1CYEA 3FBWA 2FN3A 3H5TA 2XUOA 1X1QA 4FYJA 4G4SO 2QVGA 1RBYA 1FSPA 2XAUA 1MC8A 1Y6FA 2XXJA 1YOBA 1I5RA 3WLNA 1LSUA 1L5VA 1GADO 1WV1A 4NRWA 4NJEA 1X1TA 3IQHX 8CATA 5EKTA 1OXUA 4NNPA 3ZXIA 3RAJA 3NHBA 4Q02A 3OEHD 3GJ7A 4ZZ1A 1N0UA 4RTQA 2R3SA 1MW9X 2ZAGA 3IUSA 5HDBB 2D1FA 4MHTA 2MSEB 2VJPA 3VMMA 4PN3A 3QEJA 2ISSD 4HFNA 2VT3A 5DNEA 2H2HA 1XLTC 5AIAA 3WDLA 3UXEA 1XCOA 3L28A 2VA8A 1NUHA 3WO1A 3C1AA 2W0SA 1JPJA 3A7EA 3ILHA 4X61A 2HW8A 3O2JA 2NU6B 3RLFA 4FX2A 3T5PA 4QIHA 1A82A 3K6KA 4IBEA 4WNIA 4D4GA 2UXCB 3PHLA 4OFBA 4RVSA 4CHDA 3WYDA 4ZEVA 3AP2A 3O3CA 2PT6A 4Q7LA 2OSVA 5FUYA 1CJVC 2FJUA 5ITZA 3OE4A 4HJXA 5A5GA 3ZXYA 1EGMB 4KRYA 4A2QA 3IPCA 4H17A 4ZCIA 2XA9A 4QARA 4G0OA 4L0DA 4MGZR 3RLIA 4Y30A 4IIUA 2II6A 3BWEA 5CA1B 5EXPA 4AROA 5BURA 3WL5A 1EDDA 4YRAA 1V8ZA 1P0MA 3COJA 1U81A 4D9NA 1PNQA 2DFDA 3DYVA 3OIGA 2PV0A 3K6SB 5I4CA 3AHFA 1P77A 3SX2A 5I7FA 3ZLBA 5AUPB 2WJ6A 3ZDYB 5AVZA 1H5NA 1QHNA 5KSYA 3BYZA 4BFZA 1J2UA 2ODWA 1FZTA 2CJWB 3GJ8A 2PZLA 2AD5A 4CM9D 3ZLJA 5DMHA 5F3RA 4BVLA 5FOWA 3HCCA 3JWIA 1DKUA 1T2UA 3PX3A 1Q2UA 2G0AA 3QGMA 3OZEA 2GS9A 3AM5A 1ADBA 4ZMRA 3NVKI 3DL4A 1P0IA 1IQUA 3HDJA 3L4EA 1E6MA 3U7IA 4C14A 3LYHA 2WIKA 4IUBS 1ZR2A 3OA0A 3EZXA 5J2TF 4W9NA 3UQZA 4NSOB 3G7NA 2X9VA 1OFUA 4XM2A 1KAQA 4QFBA 1HT3A 4F8YA 1NF8A 1FU4A 4GKAA 4HZUB 2HM7A 1WKVA 2YICA 4YJ3A 4BWFB 4CM9A 2WP8J 1UC8A 3W0FA 5AKLA 4QODA 1WUIS 1U5BA 1C1DB 3BFKA 3K96A 1PLJA 3CEHA 3E48A 2C3YA 2PWBA 1E0JA 4QUAA 5JD4A 4YMUA 5TDHA 4CV2A 1WB4A 3L7YA 1MORA 1LPOA 3EAQA 4JVOA 4B3SB 1DQPA 4JSTA 4PGGA 4OGWA 3L7BA 1E2IA 1AQYA 3OX3A 4DJDC 4F46A 2Y68A 3VGPA 1AKQA 3M4YA 1CUKA 4H2DA 2Q2QA 2WF7A 3T0FA 3IMCA 3VPGA 3VOAA 4Q4JA 3NH6A 2IY8A 2LBCA 1IWPB 2VH2A 4MQEB 1VQ1A 1YFZA 4B4UA 4U7DA 3RS7A 5F73A 1N6HA 3KT0A 3NV9A 3NJ4A 5EC8A 3JQ7B 4KUHA 1D0IA 2YW9A 4LFBB 1WVIA 3R3JA 3PPIA 3L43A 1KSJA 3RRMA 1G59A 3I2IA 5KO3A 3WVNA 2D2IA 4GX1A 1MQ9A 2RGYA 1JEJA 4R2IA 2VJOA 4NVRA 1EWYA 5A3QA 1WUJS 3H2ZA 3OE7D 4HXEB 2B1JA 3VNRA 2XCTB 1K4YA 3G2NA 3ZWYA 2Z5FA 2FZCA 3DTVD 4M7WA 2OYCA 3X44A 2NPFA 5FTMA 4MO2A 3LY8A 1MC5A 1R12A 1ZOPA 1SIBE 1N9ZA 1YDWA 4LISA 5EJEA 1N6LA 3DMGA 3DTYA 1KQPA 1J0CA 5LJIA 3J81S 5K5EA 4M1ZA 3C3YA 1T4BA 5HUJA 3ETGA 4XM1A 2LVQD 2BGNA 3NHAA 4R51A 5BQ5A 5IKEA 1VA5A 3AJ8A 5FYDA 4QECA 5EE0A 1DWOA 5B6PA 5CFLA 4B47A 5BWNA 2H5EA 3KHSA 3PHJA 2F43A 1F38A 4MEBA 3DMTA 2KJQA 5ECYA 4OGKA 4ON9A 2JP7A 4V3BA 1TH2A 1KI6B 3GC6A 4OKNA 1JHMA 2W98A 1CDDA 3RD5A 2QV7A 1ZI9A 4OJNA 3KSRA 1HE1C 3AX6A 5FL7D 5JH7B 2REQA 4IZ6A 1M1YA 3STWA 2YWBA 1PKXA 4XDGA 3WLEA 3F5QA 2YS7A 2WSBA 3FETA 1X8JA 3GCXA 2J3HA 2ORIA 1C8VB 3BHIA 4C0BA 1K8XB 4HY3A 2R5NA 2BCGY 1L4GA 4BRUA 4K5QA 3ZE0B 1YK1A 1FTGA 2Q4TA 3GO4A 3OIDA 2DTEA 3O95A 4G3XA 2GHIA 4UTPA 2OC9A 3V4SA 5D86A 2P9BA 1DGHB 2QTLA 1JT2A 1WMDA 4C7KA 4NOMA 1LNSA 1NLMA 2G7ZA 5FL7A 3LHDA 1N5LA 1NW3A 2KMLA 3O26A 3J81k 2VDLB 2Q1SA 1DGFA 5A7FA 3LUHA 3PGA1 5DGIA 1T91A 3BSFA 4HWRA 1JQAA 1W9HA 4L78A 1ZRHA 2LTAA 1LBQA 4DNFA 4IS3A 3ECCA 1ISGA 4HWKA 3THRA 3VMFA 3C5CA 1ZVQA 5IMSA 3NWLA 1NG9A 1C30A 3ED1A 3PDJA 4YRIA 1E1QA 2IHJA 4R1SA 4FJ2A 5ALYA 4CLHA 3H9CA 1E1YA 3LUPA 3L7LA 4K9KA 3U37A 4JUIA 3V33A 2F67A 2PTHA 1KEZA 2P7IA 1E1CB 1DEOA 2H29A 4F5WA 3EB9A 3C43A 2BM8A 4B3IA 2OHOA 2GPWA 1QK5A 5G0TA 2VP5A 2GA8A 3I83A 4RJIA 4JBIA 1JDZA 3N28A 1MUUA 2ZRCA 3JYOA 1YASA 4EI8A 1WEHA 1OFHA 2LXEA 4Q7JA 2QQEA 3TL2A 3SKXA 3PFBA 5GM2A 4EB6A 5B1SA 3EZGA 1GJTA 4M0WA 1F8FA 2V45A 1M2OB 1I4EB 1D7AA 3DR5A 1LI5A 5L40A 1EHIA 2ZKLA 5A9RA 1DV0A 4GOND 4MUBA 4LWOA 5I4KA 1DV1A 2H1IA 1DTSA 3VJKA 1YS7A 4WZBA 4RTJA 4EG8A 3WOVA 4ANFA 1DWQA 4HYTA 4HATA 3PVSA 1HOXA 2GPJA 3EMDA 2QRVA 2W2NA 4K05A 4B7XA 2BP7A 4AJ9A 2WKWA 4EPYA 1ULTA 3LG2A 2D2VA 1X19A 3JVDA 1FCJA 2IT1A 1KDOA 3B2QA 1KZ6A 1GTL1 3EG5A 3SS9X 3GELA 3KU4A 2J5KA 5I8ZA 4J2OA 2BFAA 2X7XA 2F8TA 3AUUA 3KQUA 4RSRA 3OOEA 2D7HA 3GLQA 4QLBA 1J9ZA 2YN0A 3LGSA 4LRSB 2VPWA 5M2QA 4PF1A 3ZDEA 4JASB 5EHIA 2A86A 2CF6A 4JB3A 5G3YA 1L6RA 4LYYA 1B74A 3JAMS 1G8YA 1ND5A 5CM8B 2BFDA 1PAUA 1SUIA 2XWJI 1AV7A 1A77A 1WP9A 2DWZB 1UIRA 1YUMA 1XMQM 1Z0JA 1SC3A 5EI5A 3LWBA 4OOEA 2JUJA 5FTNA 4N03A 1OWLA 1SAYA 4U7FA 3R0XA 3EIWA 5EG5A 3W5UA 3T8YA 2D06A 3COZA 3M5PA 1NVMA 1Z74A 2GLUA 2IOHA 4PAGA 4K3VA 1I2BA 1E0KA 3KVYA 5MN4A 1Y48E 4ZWNA 1QRDA 2Y67A 1UP6A 4MI3A 4YDSA 1Y0BA 4LDPA 2AFHB 4K2AA 1ZJYA 3GFTA 4GYWA 5JRZA 5JJKA 2JFFA 2EZ4A 5AUQA 4FP9A 3GH1A 3NM5A 2G8LA 3G13A 4MITA 2C4TA 4KSYA 5LA6A 2AH5A 1ZSNA 2EC5A 3GLHE 1AKNA 1E8MA 5KPTA 2W9XA 2C29D 2RGNC 4J91A 3KQMA 4YAUA 2A14A 1B8OA 2W00A 1ATZA 3WIDA 1XCPA 1JQJC 3HSKA 4B4OA 3KLBA 3MINB 3NX4A 3LFTA 1X8XA 2H8GA 1XZDA 3EVCA 2ZB4A 2X58A 2C8JA 2VNIA 3DVAA 2GZMA 1P75A 3MCAA 5GGXA 3HJTA 2IH4A 3NRCA 4C2TA 1XNGA 4Z9XA 3LX6A 1SCQA 1C1YA 3FVVA 4H1TA 5JZMA 4Z3OA 5T67A 1RHQA 4ZKEA 2O2HA 2CLSA 2QMHA 1Y7PA 4QU8A 1UINA 5B2ZA 4H59A 1H93A 5JJBA 1ZLXA 2XOKA 4BNVA 3BSYA 3EPLA 4I1UA 5ARBA 4A9AA 1WOMA 1BXGA 1PNVA 1SB8A 5HR5A 1L7VC 1FX0A 1JLRA 2A9OA 5FPQA 1P1JA 3FCAA 5ER9A 4GMFA 2Z3WA 1FNDA 5F4ZA 5A0TA 3KW6A 5H37D 3I6YA 4H1HA 4WXEA 1Y6ZA 3GD5A 3A2MA 1O4VA 3WWPA 1CULC 5EERA 4Y6OA 2QX6A 1CUHA 5KWVA 1NLZA 3I1IA 5AKYA 1U3UA 4XRRA 3HVKA 4GGMX 1NI5A 1R10A 1L2DA 2Q5IA 3BEDA 2O8VA 3NR2A 3AP3A 3O1IC 4KJXA 1BW9A 2JFOA 4I9NA 3OCJA 2QLTA 3RIMA 3QLVA 4MW0A 1Y6JA 1UP7A 4K86A 2FHSA 4A26A 4Q3LA 1I0ZA 1WPQA 1XZ8A 5GOTA 1ATIA 1FL9A 2I34A 4ID9A 1YVPA 4AF8A 2ZTHA 5DWVA 2FW0A 3OTWA 3TSCA 4HEA1 2TMDA 1UXOA 4G8BA 1SK8A 2AJCA 3EPHA 1ZC3A 2AYZA 1W76A 5ULLA 1JFLA 4M1EA 4OK6A 3HJRA 1FMJA 1T0UA 3THOA 3GGCA 3NT4A 1FTYA 1BO6A 1V9SA 1JEOA 4ARSA 2LW7A 1DGBA 5TGDA 1EJ2A 1V3QE 4ZPJA 4AAYA 5BVGB 2VQEB 3SZ3A 1G21A 3DHNA 1ZJ5A 1KBZA 2O0MA 3LC0A 5CX1B 1DBWA 2PA3A 4BNKA 4DE5A 3P96A 1UANA 3ZI4A 2Q3CA 4OHRA 1USWA 5J1TB 3W6NA 1JJFA 2Y2VA 1TYZA 5FBWB 1WCV1 3G88A 4PSUA 5BT8A 2FDCA 2H17A 1GNSA 2JIDA 3U7RA 3RV4A 3VHLB 4YXFA 3OPVA 2G28A 4P0PB 4Z0PA 1T2EA 3EMKA 1TUGA 4RF1A 3WRYA 2XH9A 2EGHA 2ZIXB 3U56A 4NZ9A 3GU3A 3IUPA 1D4OA 4IWNA 4XSHA 1N6KA 1WU8A 4BDSA 1A4RA 4IUCS 3ILXA 3OEYA 1SUWA 1DINA 3CXRA 3O93A 1S5PA 1NXPA 1UJMA 1M2EA 1KMHB 4TKLA 2K7FA 4WJLA 4B79A 5BN3A 1JSLA 2XUHA