1SXJD

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
328
structure length
328
Chain Sequence
PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASQCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Activator 1 95 kDa subunit
total genus 92
structure length 328
sequence length 328
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00004 AAA ATPase family associated with various cellular activities (AAA)
D PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjD02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjD03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjD01
1TEVA 4Q00A 3FFBA 1YR9A 4YXWD 1G8FA 3MMPA 4Q1CA 4ZIRB 4JBWA 621PA 4N0EA 4FXPA 1KK2A 1Z0IA 1XZQA 4PC7A 2AKAB 2FH5B 5JMTA 4EAQA 2N1BA 3LA6A 4KBFA 2AXNA 3CF0A 1F2TA 1E9EA 2CCKA 2FNAA 3TR5A 3U4QA 2ZI6A 1P5ZB 1GNRA 4NE2A 5FPTA 2Q3HA 3Q8XB 4I99A 3KX2A 1NSFA 4FWIB 4UKDA 3IPXA 1KO4A 1AS2A 2G88A 4ZDWA 1T5IA 3IKJA 1Q1BA 5KOYA 1CIPA 1XMJA 5L3QA 2G77B 4M9QA 2D4HA 2OFWA 1M34E 5J4LA 3BFXA 4PSAA 3H4MA 2IEZA 2FPLA 1HEIA 2H18A 4R2IA 4URYR 2GCOA 5KO2A 2XJ9A 4C0SA 2GEVA 1N6OA 3IQXA 3HPRA 3K0CC 2IW3A 4Q4HA 4V0MA 4FWDA 2QE7D 3X1WA 2DPXA 5DN6D 2HYIC 5H70A 3NH9A 2HXYA 1OKKD 5DSZA 5DNYB 3T35A 2V3CC 3GJ0A 4C0JA 3NG1A 4PQRA 1NY6A 4PHGA 4XVQA 2OXCA 1D2MA 2R6DA 1W1WA 3TK1A 1DAMA 4TLEA 5FBRB 3ZIAD 5KDOA 4BZQA 4Q7JB 1TF7A 1RC8A 4IOMA 4PQYA 3KQNA 5FH9A 3AB3A 4HAYA 1E4VA 3CF2A 1J8YF 4YDHB 3BOSA 1H65A 4TMWA 1G64A 2IXEA 2SHKA 1F2TB 1W4AA 4WVFA 2DFKB 4IDHA 4UXHA 3VR3A 4B3FX 3I4LA 1IY1A 3K0CA 3PJRA 3FE2A 1OFTA 2QAGC 1A2KC 1F2UA 1VPLA 2QPTA 2YNMA 3OIVA 4MA4A 5AJZA 5DN6A 1OHHD 4G5GA 4QFMA 2ZS8A 3NH6A 1FTSA 3FMPB 2J45A 4GOJA 1QHGA 3U3OA 3VAAA 4B6EA 2IYXA 4PR0A 1E0KA 4DHEA 1E69A 1ZM3A 5JCPA 4LZZA 2WM9B 1GKUB 4TYNA 1ZBDA 2E9SA 2ZUCA 4BZXA 4WIAA 5DHAA 1X8LA 1ZCAA 4URUR 2F1HA 4UNPA 3EWAA 5G41A 3IHLA 4ESHA 4B71A 4B2LA 2F1IA 3GJ6A 1BO6A 2X8AA 4EFMA 2GHIA 3I5XA 4DKXA 2NQ2C 1DS6A 1KAGA 2ZRBA 1P2TA 3GMTA 1DG1G 1VIAA 4A4DA 2GCPA 2ZRAA 3BD9A 5FUWA 2QT1A 1GZSA 3B6EA 3L2OB 5FOTA 4RVCA 1LS1A 5FBLB 1CBUA 4BASA 4W5JA 4B32A 3LQRA 2ZRNA 1F6BA 3CUEF 3TNFA 4DDUA 1ONBA 2I1QA 4PC2A 2QENA 1QHNA 1IQPA 3SBEA 4EUNA 2ZRLA 5H8WA 1NMXA 1X37A 4D80A 3DL0A 3THYB 2VHQA 3OFNA 3P32A 4LPKA 1FUKA 3CPEA 3L0PA 1Z29A 2RGEA 1GILA 5CM9C 1NI3A 3DMNA 2IS6A 1OPXA 1ZW6A 2Q9CA 2ZI5A 3MWKA 4EFLA 4DIEA 1EXMA 1E0JA 1U8YA 5L3SB 1G19A 4E03A 4ZDIA 1II8B 3B60A 3U7FB 4TWZA 2FE4A 4LPSA 1NBMD 1ZM9A 4Q7LA 4TYPA 2AD5A 3G0HA 3UMRA 4XOIA 2J0UB 2RCNA 3LNCA 1U90A 2BM0A 2OBLA 4JVSB 1ZU4A 3M4YA 4RCZA 4BLTA 1R2QA 4NCKA 3PFIA 2AFHE 2GXQA 5IRCD 4MUBA 1W2HA 2XAUA 1YQTA 3CM0A 1H8ED 2CCGA 1CKEA 3K9GA 1ZAKA 4M1WA 5SZIA 4C2TA 1R0YA 4LC0A 1KDTA 4MUAA 3VHLB 4A82A 1T91A 2HT6A 4IJMA 5TVKA 5J4VA 4HSEA 1ZUHA 2QMEA 3QF4A 2JGNA 3OESA 2ZUBA 1SVMA 1XPUA 4QC2A 4JLVA 4BLSA 4F7WA 3TBKA 1FQJA 3SJZA 3VKWA 3D3QA 5IHPA 1L2TA 3ASZA 3THYA 1NL3A 4L8GA 4AG6A 2I1VB 3QKUA 4K81B 4Z8YA 1D6JA 3C16C 2P3SA 4LY6A 4ZPXA 1KO1A 1J70A 1L8QA 1EX6A 1KMQA 2C2HA 1TUEA 3GLFA 4EFNA 4X8MA 3CRMA 2ZJ8A 3AF2A 3OIWA 4NH0A 3T1QA 3TR0A 1A82A 5AJWA 3O8CA 1CP2A 5CDFA 5CB6A 2YWFA 3LBHA 4C0QC 4E09A 2V8OA 2IWHA 5AUPB 4DLSA 3TVTA 1BYUA 2GESA 3EIEA 1JQLB 2V54A 4FMCB 3T15A 1S3SA 3AJIB 1W44A 4ZV4A 3I61A 4RSGA 1Z6GA 1DG3A 1YHNA 4JS0A 2KWIA 1IN8A 5SZJA 3FVQA 1HYQA 2F43B 2A5GA 4LOAA 1S0UA 1XWIA 1GL6A 3EA0A 5JS8A 2YOFA 4FWGA 2GZAA 2WSSA 2ZRPA 3SBDA 4S35A 3B1WA 2XNDD 3DPUA 1OH6A 4LI0A 2QU8A 2PMKA 1DEKA 3QNUA 4Q01A 4CZ2A 4U00A 5JI2E 1JALA 2JATA 1QDEA 2P67A 1N3BA 2ORIA 3VU9A 5L8VA 3VX3A 4JBXA 2QG6A 3KB1A 2QTVB 2CLCX 1G4AE 1YKSA 2W00A 3I72A 3AVOA 1Z6TA 821PA 4JLMA 2O8CA 4DCTA 3O8RA 3BB3A 2ZI3A 2XEXA 4LJ8A 3MHVC 3D31A 1KK0A 3BAFA 2WJYA 4HB2A 4MITA 4UQOA 3ADBA 3WP1B 1M8PA 4LBVA 4RD4A 2CHGA 1MO4A 2KE5A 2OILA 2GEUA 2QM8A 2O8CB 1NBMA 4OK3A 4US2R 3WYAA 4NMMA 1IY2A 2BJVA 5JLJA 4AKIA 3UPUA 4DVGA 1KIMA 4R2HA 4FWTA 1P75A 1ZM2A 3I62A 3AUYA 4ZCMA 2W58A 1OKKA 2MSCB 3T06B 2ZE8A 3EC1A 3BORA 1IY0A 1UBCA 4E22A 3SYKA 2FN4A 2QE7A 2CK3A 5CLQA 2ASEA 2VTKA 4F4CA 1TNDA 4ZCIA 4EKDA 1SHKA 1N6KA 1IXZA 4FN5A 1SVWA 2WHXA 3GJXC 1US8A 2B92A 4NCJA 4PSKA 5EP4A 2CK3D 3TSZA 5DYGA 3JVVA 2G1KA 1E98A 1S1CA 2QSZA 2VEDA 3E5HA 3R9IA 3CIOA 3NIBA 4DCUA 1FFHA 1KYIA 1LY1A 2Q0HA 2QAGB 1Z22A 2HT1A 2FU5C 3KW6A 1WE2A 1OB5A 3BJIC 4CEJA 1TQDA 1N6HA 4GITA 2OO7A 3NHBA 1KKLA 2GA8A 3GLGB 2J7PA 4Q9JA 5GVRA 1KSGA 2CHQA 3UATA 4CIDA 3KQUA 3TLXA 5FI1B 1BH2A 2V4ZA 1DOAA 3K9NA 3BIFA 3JVUA 2OV2A 2D3WA 2WWGA 3CZQA 4P4UA 5BN3A 2QAJA 1S3GA 2ZJYA 4GNKA 4HDQB 1IXSB 4D25A 2P6UA 1OJLA 2MMCA 3SI7A 3Q5DA 2JAQA 1OH7A 2WWIA 3DDCA 4P32A 2ZI4A 1F5NA 1KI3A 1EFRD 3C5CA 5B57C 4BFUA 1PLLA 4LRWA 4LV6A 3U7GA 2ONKA 2IF0A 1YZGA 4JJKA 4OHWA 4ABYA 3G82C 4LCBA 3MJHA 2XSZA 4QL3A 2P6RA 1ZUIA 4URZR 4KU4A 1KMHB 2W6JD 1TMKA 1G5PA 1KNQA 3GD7A 3K09C 1E2IA 2PCLA 2ZITA 3N70A 3EPJA 3TJZA 2RGAA 2FSHA 3PITA 1E9RA 1X8JA 1K5DA 4A2QA 4ZI3A 4JKIA 5EE9A 2EYUA 3UXMA 2J1LA 4KFTA 1IOZA 1IN5A 1LW7A 2DVWB 4D4LA 4U7DA 4JVLA 2OXRA 1EG7A 1RIFA 3C14C 4WXPA 1VDZA 1CULC 2ZAOA 1W0KA 1XEWY 3W34A 3B2EA 3S1AA 2WPDA 4MRPA 3P20A 4A9AA 1UKEA 3F0TA 3H0KA 4LUCA 4TLCA 4A0GA 1YRBA 3CO5A 2BV3A 4PC3A 1GDDA 2IBMA 1E2NA 1II9A 4PHTA 3EPLA 4RD0A 2AL7A 5TDHA 4G5OA 4IXNA 2R62A 3GJ5A 2W83A 2EW1A 4QM6A 4PAQA 1E79A 4IHQA 2IXFA 4LJ9A 2R6FA 1D8TA 3OIYA 2F9LA 4B76A 1FP6A 3KTAB 4FMDF 5FFMA 2BBSA 5K8TA 2AR7A 5K8UA 4RZXA 3TVDA 3L43A 1XPRA 1XEFA 1WXQA 1SHZA 2OUKA 1XXHB 3D7MA 3EAQA 4B48A 4GMXA 4HB4A 2VA8A 5D3MA 3AF0A 3RRMA 4LJ6A 1UDWA 2P65A 3B1YA 4R7ZA 5HZKA 4W7SA 4L4UA 1YR6A 3TUIC 2O0KA 3W6NA 3QXSA 1W5SA 2ZU0C 3THWA 2NO6A 2CHVA 2J0SA 4JSYA 2QA5A 4OQMA 4EPXA 1NG1A 3BGWA 4GMDA 4Q7KA 1HQCA 1JR3A 2ZSDA 5CITA 1NVVQ 2I4IA 3RSLA 1E79D 3CRQA 3ZH9B 5K8IA 2ZSFA 3LX5A 3FHOA 3LX8A 1O87A 1I2MA 2QMHA 3J81k 2IS4A 2GXSA 1CJMA 2IUSA 3UG6A 4YMTA 3HR7A 4WBSA 3DZDA 2ZRJA 2I3BA 1IN7A 2AHOA 4AK9A 2ZXUA 1V43A 4O2RA 2C96A 5FTKA 1KO7A 2V7QA 4ESVA 2PT5A 5J4HA 1VCMA 3CZPA 4ZCLA 4LYHA 3FMOB 4Q1DA 1N0VC 4DT1B 3CH5A 3ZZUA 4Q1AA 3VR1A 5G40A 1J8MF 4KHZA 4MYHA 4CW7A 1M7HA 1V5WA 4BFWA 2G6BA 2BEJA 2J3EA 3RC8A 3QXJA 1JPNA 5L3SA 4YC7A 1G6HA 1NLYA 1VHTA 1L4YA 2C04A 4G3XA 3VR5A 1F60A 5J40A 1PLKA 2LKCA 1LF5A 1QZMA 1P4SA 2FFHA 3NEJA 3U6KA 1FOEB 2EFCB 4L16A 2PT7A 2QP4A 2ZRMA 1T8TA 1W4BA 3W8NA 2DWZB 1DPFA 2EQBA 2XNDA 2G0NA 2YWGA 1SZPA 3CW2A 3MWYW 1KKMA 2ZTSA 1ETUA 3A1UA 1L7VC 3ND8A 1OT3A 2XNSA 3HU2A 5AUOB 4EPWA 5CYOA 1PJRA 4MYTA 3AP1A 5CIQA 2KB0A 2GBLA 2WWFA 1E94E 3WRXC 3FHTA 1L4UA 4UNNA 3CH4B 5KHOC 1NNEA 4R98A 4DCNA 2BOVA 4DCSA 1UKYA 2C98A 421PA 3QJYA 2PLRA 4LX0A 3RAPR 3PQCA 3EARA 1JNYA 4LBYA 4F93B 4PHHA 2ZE6A 4DRZA 1G3UA 5L3VA 2JLSA 1ZCBA 3EC2A 3PIRA 3ADDA 1O3YA 3WNDA 5KNBA 1QVAA 2D7CA 1R0WA 2FSFA 2ZRFA 1NVMA 4Q4JB 5HCNA 1Z8FA 4YMWA 3QIAA 2E87A 2NIPA 4TTQA 4GFDA 4LJYA 4OQXA 3GLIB 2DY1A 1KY2A 1UBGA 4R9UC 3WNCA 1JAIA 1K5GA 5DI3A 2CCJA 1S2MA 4A1FA 5KSYA 5F2EA 4PZYA 5M04A 4E5UA 2EVWX 3QBTA 2Q6TA 3FYHA 2WAXA 4C3ZA 8OHMA 4OHXA 1JEDA 5P21A 3VTKA 1MABB 1TQ6A 2GEDA 1M7BA 4AURA 1CR4A 5B58C 3BB1A 2YWEA 2IYQA 2Q3FA 1XD8A 1XXHE 3EIQA 1AS0A 1S9DA 2B8TA 2TMKA 1FMLA 2RGXA 3PEUA 2B7CA 2R2AA 5TMPA 2ZYTX 3OAAD 1GNPA 4JSTA 3L8ZA 4A0RA 3EPHA 3GJ4A 3K53A 1E6CA 1IHUA 4O3MA 4Q7MB 2OM2A 1RYHA 4CEHB 4JLKA 1XRJA 1G8YA 4HUQA 3WHKA 2QNRA 3K0FB 5CK5A 1AKYA 1KZ7B 2ZU6A 4QBFA 2QTFA 3PUWA 3LQQA 3QBVA 4ZO4A 1CJVC 1ZD1A 3QI2A 4XIGS 3GEEA 1Z47A 4DLVA 1PUIA 3WBKA 1G20E 1W36C 2GJSA 3HR8A 2IYUA 1PZNA 2R44A 4IW3B 5FPKA 2GWHA 4Q4LA 3BFVA 1MOZA 3QXXA 4K8OA 1UEIA 4BECA 3ZVNA 3OF5A 1A7JA 1OYYA 1S96A 2ZJ2A 4RKFA 1HY3A 4LBWA 3U6BA 1G7RA 5FOXA 3TUZC 1ZC4A 5JECA 5J4YA 3UKDA 2D2EA 4ZI2A 3NBYC 2V6IA 2DFLA 4OQNA 3CX8A 4KITB 4M1MA 3OE7A 4D6PA 3TUJC 1E2DA 2Q3MA 4OKSA 1XCPA 1RRPA 2G83A 3AQ4A 4B2IA 3QUSA 3ECCA 5C4GB 3KDSE 4XH9B 2VF7A 4ERNA 3VR4A 4BPBA 3AEZA 4QJ4A 3EA5A 5DHFA 3KB2A 4TMXA 2JLQA 2FGJA 3HJNA 3FWYA 1OH8A 4D26A 5B2ZA 3BERA 4C2UA 5KNCA 1JR3D 1Z0JA 4M9SA 3Q5EA 1EX7A 4AYWA 1NKTA 4BFTA 1AN0A 1HE8B 1DAEA 1MH1A 2QP9X 1S9HA 3GJ8A 2AWOA 3LY5A 1YZKA 2OLKA 4UNRA 2DYKA 4RFSA 4JLAA 5B64A 2OHFA 3C7KA 3KKMA 1W2GA 3H2YA 1DO0A 2ZUDA 4C0HA 1Z5ZA 5FBVB 1BKDR 4AD8A 5LB2A 2ZR9A 4MDEA 2ZROA 4TQUS 1WMSA 2CBZA 2QI9C 1EWRA 2QM7A 1PVOA 3IDQA 1MO5A 1SULA 1GWNA 3ICEA 4A0HA 1AQUA 1SXJC 1UBEA 2EFHB 3LW8A 4HUQB 4CDGA 4GP6A 3MRSA 1KY3A 5A5GA 4HB0A 2QQ0A 4LYAA 3LD9A 1UJ2A 4LSGA 3QKSB 2CE7A 2BC9A 5DE3A 4IDPA 4O2LA 4NHOA 3MAAC 3PEVA 2R9VA 3WRYC 3T1TA 3C8UA 2ZR7A 1PUJA 2ZREA 1KO8A 1FPMA 1KDRA 4BRUA 3EASA 4RCYA 3U7HB 4IOKA 4BLOA 1RKBA 4KFUA 3MGCA 1TAGA 2BHRA 1G18A 4LHWA 2WJGA 2GAOA 1QHHB 2FMXA 1XX6A 5EJEA 3O8BA 4CEIB 1CR1A 1YJ5A 1XTRA 1QHHA 1SVKA 3TW4A 2EFEB 1VYVA 2ZPTX 5AK0A 1E9AA 2QPAA 1E0AA 3FTQA 4CRWB 2C03A 1TU4A 2NPIA 1ZIPA 4OJKA 1OIXA 1G21E 2HCBA 1TF5A 2XOKA 3U44A 4B3GA 2REBA 1UPTA 2ZS9A 1U0LA 1N5IA 4GZMA 4M2LA 2JLUA 4D2IA 2RGCA 1QHIA 3ASYA 2QBYB 1X1SA 1Y63A 4OQLA 4Q21A 4KSCA 4DB4A 1QHSA 4M0LA 3X1XA 4EIWA 5IT5A 3QVVA 1X3SA 5FUXA 4DT1A 1EFUA 1DTSA 3RS0A 1F3OA 2PJZA 3U3JA 2EU8A 3OEED 2ZIAA 1KJWA 4DSUA 4YMVA 3AV0B 1ZM7A 3H1TA 2ANBA 1MR3F 1N25A 2OCYC 5EUQB 2YVUA 2ZJAA 2LKDA 2N42A 2X77A 4X8HA 4BEJA 1XJCA 2VYFA 2FPKA 1E1RD 4Q19A 2ZYVX 4KSBA 1II0A 3RNLA 1R5BA 2O8DA 3EZFA 4AC9A 2IYWA 4L9SA 1JXMA 3JZMA 4O25A 5F98A 1ELOA 1AQYA 1P2UA 2FFAA 3IO3A 2CE2X 4ZKDA 2K5UA 1W7AA 2KI5A 4BFSA 1LFDB 1XMVA 1E2LA 2DFNA 1COWD 3CBQA 3IILA 1NIPA 3WYFA 1P2VA 2JIZD 3UK6A 4EPVA 3QPVA 3R8CA 1U2RA 4HLQB 4NONA 3TH5A 3ZLJA 3R9XA 3SOPA 3UMFA 3AKCA 2OBMA 4JMPA 4LYJA 1IAQA 2BVNA 5AJXA 4PC1A 4JYBA 2ZJ5A 2ODNA 4K46A 4JLPA 2FSGA 3CNOA 2ORWA 4DC9A 4EPYA 1IN4A 2GNOA 3KTAA 5DI9A 1Z6AA 2DZOB 3Q7PA 2A5JA 4WZBE 3K70C 1R8SA 1G8GA 2G1JA 3PEWA 1E2GA 2W2VA 2ATXA 4ZIRA 3CRRA 2QY9A 4OI1A 1IN6A 4KFRA 3NDPA 4OYHA 3N5CA 3RABA 3UMSA 1XD9A 4BFZA 1DAKA 4LV8B 4DLTA 4JLDA 4BFVA 1VIYA 1FTNA 2MMGA 2G0TA 2VP5A 4NYMR 2OBNA 1QHXA 1E2KA 2VF8A 2QT0A 1Q57A 1UKZA 2F3TA 4UNQA 3KJEA 2BMJA 1ZU5A 2YOGA 4NL4H 3H86A 2OE2A 3EIHA 3VFDA 1GUAA 1UEJA 1XTJA 4M53A 4YONB 1RYFA 1A2BA 2QP3A 3E1SA 1KHTA 4L9WA 4C0AC 1R4AA 4FMCF 5JBQA 3EZ6A 3PUZA 4IDOA 3TAUA 2OAP1 1JPJA 1MV5A 4LYFA 2CEAA 2ZRCA 3GLFE 1BOFA 4A36A 2J7PD 2PEZA 4WAUA 3I5YA 2X2EA 1HT1E 1G8HA 2A3RA 2VRWA 1NY5A 4YMSA 5EE0A 4Z1MA 1GKIA 3K9LA 5EXXA 2IUTA 4QBHA 4OI4A 1DBSA 1RJ9B 1W4CA 2VHCA 4JZKA 2BCGY 3AGQA 3A6PC 4HLUC 1P3JA 1E32A 3RS4A 3QKSA 2O0JA 1KAOA 4JL8A 4TQ9A 4TMKA 5LD2B 1N5KA 1OLOA 2EWVA 1KI8A 1KI4A 1UM8A 4KCGA 4Q9IA 4KFSA 2P2LA 1U9IC 2BKUA 5FBQB 4YXWA 3FKSA 1SVLA 1XEWX 3TSWA 2J0VA 1OFHA 2VHJA 4P4SB 2FX3A 1AZSC 2PH1A 2RHMA 1XJ0A 2IYYA 4HYYA 3VR2A 4DJTA 3SC3A 3GLHB 1NN5A 4B47A 3EPKA 1FQKA 1J2JA 4M1OA 2OZEA 1JECA 1YVDA 4OHYA 1J7KA 1LB1B 4KYIB 4QBIA 1P61B 2FJUA 3E2IA 3W90A 1JXOA 2HDNB 2NZJA 3LXXA 1JJVA 3T12A 1NLFA 4B44A 2A78A 1KNXA 3K0AA 4B3XA 1G16A 2RKOA 1NP6A 1SXJD 4JLOA 1OSNA 4ZDKA 1KI1A 2DWPA 1ESNA 3LVRE 4RFVA 3A4MA 1RFLA 1W47A 3DEFA 4X8OA 4CT4B 1E0SA 1AIPA 1KJYA 1I4LD 1W46A 1XD2B 2ZSAA 2OESA 2CJWB 2FZ4A 2CVFA 5IDVA 4O0MA 1EFHA 2RMKA 1N0UA 3LWNA 3IBYA 1NKSA 3Q85A 4OI2A 1P73A 2REOA 5KU1A 3AKDA 3GFPA 5DIFA 1GFIA 3UANA 1H8HD 3FDIA 2CLSA 4TYYA 1OW3B 4RKEA 3G5UA 4B2PA 3P4YA 2GILA 2NO1A 4AY2A 3W9YA 2A2ZA 4G1UC 2BMDA 2GCOB 1OXVA 1D9ZA 1MKYA 3DKVA 3QPWA 3I32A 4JN6A 2C5LA 2HLDA 2IL1A 3IO5A 5AUNB 1W36B 1IJEA 4NKRA 2V6ZM 3DOFA 1DARA 4AYTA 4LJ7A 2X1VA 4MYUA 4CT5A 4C30A 1R10A 1T5LA 2W0SA 4WZAE 3SJCA 3A1WA 2ZI9A 3TW8B 2CNWD 5B30A 4DCVA 1YU9A 2ZE7A 4Q9KA 1ESMA 4B35A 4TZ0A 2GXUA 4Q1EA 2QRNA 3SU8A 3T1OA 3VU9B 4IEEA 4LV5B 1Q21A 1ZMXA 2BM1A 4UNSA 2KRKA 3U3RA 3PUXA 5FOWA 4DSTA 1PLJA 1D2EA 4M9XA 3QPUA 4Q1FA 1VCIA 2KBFA 1N2CE 1G5TA 3FPAA 4ASUA 1DAFA 2O0HA 4DEXA 3LDAA 2JA1A 4PPQA 1QG2A 4IXMA 4D0NA 1DADA 1FW6A 3B78A 2OFOA 3RRYA 1Z2AA 2AFIE 2OCPA 4LWZA 3M6AA 2GDJA 4BEBA 3FKSD 4V0KA 5A4JA 4JKYA 4XSGA 1GRNA 4RD1A 3WMGA 3ONWA 1FX0A 3LW7A 4HLUA 4PSVA 2GKSA 3QY0A 4MGYR 4RZ2A 4LBZA 3CF6R 4D4JA 2O8EA 1Q20A 2GJ8A 4B3DA 2QGNA 1B0UA 4RD3A 4M22A 2OLJA 3V00A 5F9HA 4EJSC 5JJIA 3ZZ0A 1IBRA 3CWZA 5J4KA 4NYIQ 1AZTA 4XWKA 3QOFA 2L0XA 4RZUA 6Q21A 3AP3A 1ZNYA 1E3MA 1AGPA 1SXJE 4NYIR 2CL7X 3OIUA 2IT1A 1QF9A 4M1TA 1GAJA 2QPOA 2J41A 4F91B 4M1YA 5EE1A 3HDTA 5KPJA 5J5CA 3UIEA 2AD1A 2ZAMA 1N6LA 1P2SA 1R8QA 4OL0A 2IXGA 3F3YA 1CU1A 1GOTA 3CR7A 1XMSA 3P27A 3MCAA 3QXHA 3ZQ6A 5E3HA 1CR0A 4IEIA 1G7TA 3X1ZA 1XTQA 3ZIAA 2JLZA 3NBXX 3HYRA 5C4MA 4JL6A 1NN3A 2XOKD 1GM5A 5CJPA 3KXIA 1FP7A 5JCZA 1XTSA 4QJ3A 4D82A 1X8KA 1AGRA 4QHSA 5BWMA 2FWRA 1ANKA 3C4JA 4E07A 2PBRA 2YHSA 2DFTA 2RGBA 2DB3A 3T1VA 3MLEA 4JL5A 4DSNA 2GZHA 3QG1A 3C15C 5LBIA 3RANA 1KK1A 2DWOA 4JVMA 4DLRA 721PA 3H84A 5E7MA 4JIMA 1LTQA 1MABA 3AF1A 2IYTA 1S1MA 3VHXA 3QSYA 4DXAA 5HKKA 5JFGA 4KXFB 1XBTA 5ANRB 5SZHB 1G3MA 1WF3A 1MO6A 2H7VA 5CYPA 4HUTA 4QOSA 1OXTA 2ZE5A 3A37A 1JR3E 2WJVA 3U2QA 4TLBA 2PLFA 2X19A 1FNNA 2A5DA 3EX7C 2GJKA 4US1R 1VYTA 2Z4SA 2R6AA 3HU3A 2JDID 2PX0A 2XTMA 1G3RA 2NTYC 3CRVA 5CM8B 3M1IA 5E95A 2ZVPX 5EXSA 1XCGB 4JLNA 2BKEA 2ODBA 2PZEA 3IGFA 5K8LA 3BRWD 4NCHA 2ZS7A 2UZ3A 5KUTA 1CJUC 4KBGA 1D9XA 1US8B 1OFIA 4IRUB 2CLDX 3IPYA 3QKRA 1DAIA 5LPNA 2IHYA 1KDPA 3PV0A 1T0HB 5HPYB 2HJVA 3KL4A 1MRNA 1ZC3A 3AF4A 1CEEA 1Q3HA 2WKPA 4M8NE 3IHWA 2XB2A 2V55B 4FI3C 1TQ4A 2R65A 1E9BA 3SHWA 4GRAA 2FF7A 1KSJA 1MO3A 2NGRA 1YZUA 1E1RA 2JLWA 4HLDA 5EUMA 3FGNA 5FR1A 2WJIA 4ITRC 4MGKR 1C1YA 2DCUA 2JDIA 4C7OB 3CWQA 3RVBA 4BLPA 1EWQA 1Z83A 1P9RA 3GLHA 2ZR0A 2OAQ1 2OSBA 3DHWC 4NCNA 1ZVQA 1FL9A 1GL9B 3BC1A 2P5TB 2WJJA 2WWHA 1KI6A 3OEEA 4IVQA 3GFTA 2RH5A 2JJ8A 4J0QA 3ADKA 2VP6A 2XZPA 4MH0R 2PZGA 4BLQA 4Q48A 3LRPA 4EDHA 3AVTA 4OJQA 3MD0A 4Q5IA 1R0ZA 4BGDA 5TARA 3PG5A 4MYCA 1XFAA 1YE8A 2ZJBA 1VG9B 1CLUA 1NMZA 1N5JA 5FUVA 4AIIA 4LRSA 3NXSA 4HAXA 5JEDA 1CRQA 4TL7A 3P1JA 1CJTC 3MSXA 3DVLA 2NZ8A 4PFSA 3QF4B 2FFBA 2XB4A 4HDOB 3FMFA 3B1ZA 1P62B 3U3MA 4TLAA 1T3LA 2IWRA 2Z6VA 2H57A 3MUFA 3U5ZB 5JHGB 5JRZA 4A0FA 3RC3A 1WQ1R 3S1AB 1OH5A 3Q9LA 2IUUA 4D4MA 4DEYA 1UFQA 1TX4B 3GLFB 3Q7QA 1T3SA 3CX6A 4HAWA 3KFXA 1N6RA 2MSDB 3P26A 3BFKA 2HXSA 4L5BA 2WWYA 4BFXA 2W2TA 2W6IA 5A0FA 5FL7A 3PXGA 4Q03A 4R71A 2VP2A 5DISB 1ZNWA 3B85A 4D0GA 2XXAA 3NHAA 3AF3A 2CL0X 3K8YA 4CVNA 2C78A 4JLJA 5BYJA 2DWQA 3R7WB 4XD7A 4II7A 3REGA 1VCOA 1XXHA 3IEVA 3K0SA 3AGPA 2AX4A 2VHUA 1ZIOA 3X1DA 3V4FA 2HF9A 4DB2A 4Q02A 4H1VA 4U5XA 5E7JA 3W5IA 3ZVRA 4EPRA 1E9SA 2YINC 5JSZA 3TGPA 5EQTA 2W2XA 4TL8A 1NG9A 2XTZA 4P4TA 4EQ6A 4QBGB 1XNJA 1VYUA 4XVUA 2ZSBA 4QNMA 4PO8A 4H1UA 3RDPA 4LHZA 2JLRA 1IM2A 3B7GA 3SYNA 3U4QB 4NP6A 4PAOA 4DDWA 2G3YA 4ASUD 4ARZA 4TSFA 3ZGXA 1FMJA 3BBPA 1LVGA 2XJ4A 4N0DA 3GLGA 3GPLA 1SKYB 2BDTA 3FHCB 4G5RA 2FDCA 3KQLA 2QTHA 4M9ZA 4DLWA 3I8XA 4GPTA 1I2DA 4NYJR 4GT1A 2BWJA 2IS1A 2JASA 3U3KA 1H8EA 2CL6X 3CLVA 3IEUA 4W5WA 2PJRA 4ZKEA 3SDZA 2ANCA 1E2HA 4XTCS 4A3VB 2QORA 4KAXA 1TUIA 4FMDB 3SR0A 1X1RA 1II8A 4V0OA 3NC1C 2B21A 2WSSD 4GBMA 2GCNA 1G41A 1VG0B 1ZM4A 3AP2A 4MKIA 3BWDD 1K6MA 4DLXA 2X2FA 2FGKA 1KI7A 3CKLA 2QUZA 3SJAA 2FG5A 2R6CA 3MFYA 4I1VA 1WRBA 1JQJC 2RGDA 4NBSA 2VL7A 2O8EB 1HA3A 3CX7A 1YRAA 3B8HA 4KJZA 2HCJB 4GOKA 2WBLC 3ZVLA 3SN6A 1Q1EA 2C99A 1E2JA 4W9MC 2GK7A 2JCSA 2PMDA 1GVNB 2B6HA 2IEYA 3DKPA 3KJGA 3GLIA 3KKOA 3TMKA 5H68A 2BCJQ 2NG1A 3THXB 1Z63A 3ZS9A 1XCMA 4XWOA 1R7RA 3GP8A 5CB8A 2EFDB 1C9KA 1XTKA 1NJGA 3RS5A 4QKQA 2CJWA 3NEYA 4B34A 1T9HA 3VNUA 4X8LA 3RWOA 2ZETA 2ZANA 4OK6A 1OXSC 1Z06A 3PVSA 4JJZA 3EW9A 1UAAA 4FCTA 4EJSA 5FTNA 2V1XA 4HI0E 1XD2A 2J5XA 1COWA 2JJ2A 1FUUA 1NSTA 3HYTA 1DELA 3VLFB 4PO1A 4KODA 2WMOB 3FKQA 2WOOA 3KKQA 5CIWA 4F92B 1P6XA 1Z3IX 3OHMA 4IDQA 4ON9A 3CPJB 1Q44A 4D4KA 1NVXQ 4IFEA 1Z08A 1K8RA 3LBNA 3VMFA 1N5LA 5L3RA 2W6ID 1TEXA 4NTZA 4B74A 4P4SA 1U0JA 1UADA 2GAAA 2ZRIA 1LS6A 2IK8A 3AVQA 4XTRA 3EXAA 5LDDC 1OXUA 1S8FA 1G9XA 2GZDA 3IQWA 3LV8A 2YC2C 4Z51A 1Z0DA 2AKYA 1EFTA 4FW9A 2RGNC 1CXZA 4C0BA 2HUPA 4JT2A 2DZNB 1R0XA 1EFCA 2YWHA 3ADCA 1T8UA 3KQKA 4QNRA 1Y3AA 1G3QA 4B3BA 2ZYWX 2YOHA 2H8KA 3SEAA 4TTPA 3HU1A 1U81A 1YZLA 2QEQA 3RRNA 3GEIA 1R6BX 3QF7A 1UF9A 1XP8A 5C2JB 4QGAA 1GITA 1WBDA 2Z83A 2WWWA 4LJ4A 2ZJZA 4KLZA 3QKRB 4CEIA 3B1VA 4XVRA 4MRVA 3LO5A 1HQYE 1GTVA 2ZJOA 2GBLC 2YZ2A 5ELXA 4HLCA 4Y0VA 2CNWA 2EFGA 4URWR 3ZZTA 1LF0A 1A4RA 1CTQA 4TSFD 3L0SA 4IVRA 3QQ5A 4URXR 3C41J 1W48A 1J90A 1C1KA 1JR6A 3GCGA 4Y0AA 4PXAA 4KYUA 1N6PA 4TT3D 5FOVA 2F1RA 2O8FB 3AVWA 4D0LB 2AN9A 3F8TA 3NBFA 5KDLA 2D74A 3D6TB 3RS3A 1ZP6A 1SGWA 3KUCA 1AK2A 4DDTA 3JZAA 2D7DA 1DO2A 2VLIA 2ZM5A 2IYZA 2ZQ5A 4PQFA 2VSOA 5FTLA 2N46A 1GRQA 2YC4C 1H8HA 5EE3A 4HAZA 1P7CA 4MQBA 5BQ5A 4NZYA 3OEHA 3WY9A 3QEOA 3A1SA 2BBTA 4TL9A 3ZD7A 3NDBB 1UDXA 3ZJYA 1G4UR 1OXXK 5G3YA 1FZQA 3KJHA 121PA 4WA7A 3CRW1 2NOAA 2ZSEA 4JBYA 4V0ME 3SYLA 5HE9A 1G5RA 1QRAA 4AI6A 5AJVB 3CB4A 5HCIA 1ZINA 2D2FA 2XZLA 2H16A 4Q18A 1G7SA 5BN5A 3LLUA 4RJLA 3TIFA 1KO5A 2YKGA 1XJQA 4GOXA 5C1BA 1E96A 2JIZA 4FCWA 4ARZB 5J47A 4JT4A 4QJ5A 5JS7A 1TL7C 1NLZA 1YZNA 2FFQA 3B9QA 3CNLA 4OI0A 4I4LA 1QVRA 4Z54A 4C7OA 4DSOA 4F38A 3HPQA 5KSOA 3BH7A 5JJLA 1SXJB 4Z1MD 4NDZA 2PL3A 1U9IA 4PANA 3P4XA 1TTTA 4HAUA 2J0UA 2XTNA 4A8JB 1B23P 3KQHA 3DZ8A 4DLUA 1VKJA 1CR2A 3UWKA 2ZRKA 4B75A 2NO9A 4BWYA 1R5OA 3LBIA 3TRFA 1NN0A 3WYGA 2D62A 3L82B 2ODEA 4LHYA 2ERXA 4N3NA 1YR8A 4PZZA 3SHFA 1Q1QA 1PV4A 3LLMA 1NVUQ 1P9NA 2C95A 2VBCA 3EZ7A 3CNNA 3B13B 3A36A 4TYWA 4AWXA 3DM5A 1Q1ZA 3W3ZB 2BMEA 4WZ6A 4B6FA 3Q3JB 3CONA 5JJKA 4TT3A 4Q9LA 2O8DB 4DBLC 1GRRA 1VHLA 5HZHA 1E2QA 2A5YB 1X6VA 1AM4D 3N2IA 5D3QA 1OF1A 3EZ9A 3WXMA 5JWOA 2V6JA 3FMIA 3BH0A 2BEKA 2FOLA 4Q1BA 4WOPA 1NN1A 3L8YA 1VECA 1HT2E 1W0KD 3RS7A 3DO6A 2ZRGA 4GL2A 4HB3A 3QXCA 4Q4AB 2OT3B 1MT0A 3T34A 2KJQA 5GJVC 5BXQC 2F7SA 2FPMA 1KOFA 5UKDA 4G5SA 3KUDA 1E1QD 1U98A 4GP7A 4M1SA 5FTMA 2ORVA 1RJ9A 3OAAA 3MWJA 3WHLA 3U44B 3QEJA 4V02A 3NTUA 4P3YA 5KSPA 4QG7A 1JI0A 1RRFA 3TQCA 4OHVA 4NCIA 1JB1A 2IA5A 3THOA 1I4TD 3WNBA 2VP4A 1P60A 3NKVA 2R9GA 2QGZA 1G8PA 2BBOA 1C4OA 1KI6B 3KJIA 2FZLA 1OB2A 2RGNA 5AJYA 2J59A 3RYTC 3VKGA 4NU0A 1SVOA 4A15A 1GKYA 4GZLA 2LWIA 4Z8XA 4M1KA 4YDSA 2QMUA 1VMAA 2O5VA 1LV7A 3BH6A 3KFVA 1ZYUA 4KVGA 4BZPA 1QBKC 1HUQA 2QZ4A 1RRGA 2Z5FA 3B82A 4M4SA 1KI2A 3AM1A 2JJ2D 4Q9HA 3BB4A 1N0WA 1IXRC 2HF8A 1G3IA 5AR1A 3C5HA 5IK2A 1S4QA 4OBEA 2B7BA 4CF7A 4WXRA 2PZFA 2JJ1D 3PCRB 4IKEA 2FV8A 3L0IB 4HZUA 5CJ2A 2Y8EA 2V9PA 221PA 5JEEA 2AXPA 2OG2A 2MSEB 1T3HA 4LHXA 4MKHA 2BIFA 3PENA 3K0AB 4XSHA 4LK2A 1A5TA 4KVAA 3QG5A 5AWFC 2GVZC 3K1JA 1ZJ6A 4TMTA 4LDJA 1UKVY 2P6NA 3VQTA 3SFVA 2Z0MA 4H9GA 1CF4A 1XZPA 1IJFA 1BMFA 1F2UB 2CXXA 2HV8A 3LFUA 3NC0C 1Z0FA 4QXAA 3GJ3A 3SS8A 2IHBA 3I92A 4Q4HB 4EPTA 4PX9A 5F9FA 2OCAA 5DYIA 2J9RA 2C9CA 1E99A 3EWSA 2JLVA 4B43A 2ZEJA 2KBEA 2F3RA 3BE4A 2BBWA 2NPFA 5DGXA 1RRCA 1E1QA 3U7EB 4OK5A 5E4FA 3SQWA 2A5FA 5EP1A 2GF9A 1E9FA 1HURA 3WBJA 4EQ6B 3N2EA 3I73A 1E2EA 2UZIR 3Q72A 3ICQB 1RZ3A 3X1YA 3IUYA 5TB5A 1ZNZA 2REXB 3V4RA 3A1TA 4A2WA 2FSIA 2RGGA 4ACAA 1T4GA 1U94A 1KGDA 2V1UA 1YZTA 4POAA 2GJAA 3BXZA 3RWMB 1EESA 1I4DD 1BMFD 3IIKA 3R7WA 3REFA 5CDFE 2VHTA 3OFND 3NBZC 3DOEA 5EZ6B 1MRSA 1W0JA 2HJGA 3ND9A 4DZZA 1KI9A 3M0EA 1WDTA 2ERYA 2GTPA 3K9HA 2AK3A 3MG9A 3AVUA 4AKGA 4URVR 3DMDA 4MKFA 4PPFA 2IX3A 2OCBA 2P0EA 4LJAA 1ZUNB 2Q21A 2WOJA 4LC1A 4D81A 1TADA 4TMZA 4CEHA 1VG8A 4Q4JA 2BMFA 4C0KA 3B1XA 1OIVA 4QHYA 4DUGA 4HDCA 5G3ZA 2A9KA 4HEJA 4Q47A 2FA9A 1WBBA 3KXLA 1NVVR 1Z0AA 1GNQA 1JBKA 1JEEA 5EZ5A 2IC5A 4KI0A 4KLNA 2ZRDA 3AVVA 1SXJA 4TN1A 5FI0B 1W5TA 2VPPA 3TSOA 3CTDA 3D8BA 5HR5A 1HH4A 4W5HA 1E9DA 3ZVMA 3TAHA 3W5JA 2R8RA 2NO7A 5GJWC 1G1MA 2DBYA 2IYSA 5JRJA 4MRSA 2Z43A 4P33A 3AKYA 4B73A 3SNHA 3HWSA 2OEPA 4PC6A 4XD7D 1NBME 1OYWA 5FOSA 4DWJA 5KPDA 2A7QA 4XWAA 4MRRA 3VNVA 5FPYA 4HZIA 1U8ZA 4G5QA 1JAHA 3I3SR 4DUGD 3KKNA 3ZS8A 5FL7D 2XSZD 3OE7D 1WCV1 4IFBA 2ZRHA 1HTWA 4ACBA 4UJ3A 4A2PA 2XGJA 3A1VA 3AKEA 3A4NA 2JLYA 3GJ7A 4FCVA 4MGIR 2XITA 5G53C 1CRPA 4BFYA 4UXIA 2QROA 2JEOA 2Q9BA 3AH8A 3UWOA 1TF2A 3ETLA 3T5GA 2AK2A 4I1UA 3AVYA 3R8FA 4Q66C 5KSZA 2VP9A 4FIDA 4QGFA 1U8AA 3TE6A 1OHHA 4OHZA 3QENA 3A4LA 2WICA 2WWXA 3K09A 2ECKA 5KTYA 4GDFA 4G0NA 5KYKA 1T0JB 3B9PA 4P0TA 1D5CA 1XB2A 2WKQA 4GSYA 1U99A 4QGGA 5DLQC 2J0QA 1OFUX 2WAYA 2O8BB 1OE0A 4QGHA 1WP9A 4V0LA 5DI3B 1NVWQ 2XX3A 2PEYA 4LHVA 1RPZA 1M7GA 1Q0UA 2ODWA 2VP0A 3NVAA 521PA 2J7KA 5EP2A 1N6IA 5H1YA 2E1RA 4A8JA 1F48A 3HP1A 1Z6YA 3W6PA 2B8WA 3A8TA 1T6NA 1XU4A 5IF9A 3R20A 4QRHA 4BRWA 3LAWA 4C9BA 5TV2A 3I8SA 5CLLA 1OIWA 1CS4C 2RHDA 1WB9A 1P9WA 2ONJA 1KTVA 2V7QD 5FR2A 3IBGA 4TL6A 3AVXA 3RSOA 2H92A 1KSHA 2C8VA 2Q9AA 4MRNA 4LRTA 1EFRA 2ATVA 1E2PA 4RZ3A 3PUVA 5LB4A 4I1OA 5KDDA 3FB4A 2WJHA 2WSMA 1KK3A 2JJ1A 4RFSB 1BS1A 3B5JA 3WMFA 2H5EA 3GLHE 4LJ5A 3BK7A 4ILEA 2PCJA 3BS4A 3ZD6A 1DAHA 1XTIA 4A6XA 2EWWA 2VSXA 1SKYE 3OZXA 3T5DA 3RRZA 1W49A 4LGMA 1QG4A 4P31A 3SFZA 2WIBA 2R6GA 1TU3A 4EJSB 2QSYA 1KSFX 5FUYA 3DM9B 4FWHA 3SQXA 2YYZA 2GF0A 4US0R 1M6NA 5JSZB 2GXAA 1TPZA 2Z4RA 3CPHA 1GP2A 2IYRA 1JJ7A 4C4PA 5CK4A 1Q22A 4OQFA 3TKLA 3SJBA 1KDOA 1G17A 2GRJA 2GETA 2NO0A 2H17A 3QE0A 2ZYUX 3FOZA 2O52A 2RAPA 1WA5A 4KV9A 4A8JC 3I1FA 3SE0A 3BGEA 5HKKD 4A6PA 3IIJA 4PPNA 3TQFA 3THWB 3R9WA 3K70D 1VCNA 4V03A 1DVRA 4TLDA 4PAMA 3PUYA 1UBFA 1Z6XA 2IF2A 5FTJA 3E70C 3KXKA 1FX0B 4QM7A 5GJBA 1GL7A 2UVQA 1VTKA 1AJEA 3LH5A 2OFXA 2IS2A 1XPOA 2WPDD 2YJTD 4DIDA 1J99A 4HZUB 1ZNXA 4XJXA 2W6JA 1NJFA 4DLYA 4NYJQ 2QQEA 3KZ1E 4JLBA 4AKEA 2QBYA 2A30A 1GSIA 1VG1A 5TY0A 2PX3A 2WMNB 2P5SA 4B3CA 1X86B 2WIAA 1KZGB 1N6NA 4V0NA 2F6RA 1XDBA 2F55A 2XXAB 5HE8A 2O8FA 1BIFA 4RY2A 1EGAA 1FNMA 2WVJA 1OV4A 4I1SA 4U02A 4DDVA 1A1VA 3AUXA 2VQSA 5TXGA 5JHHB 4F4JA 1W0JD 2ZI7A 3MWLA 4IVPA 5DH9A 3K70B 2O8BA 1DAGA 4YQFA 1ZD8A 2F1JA 1YR7A 4S2EA 2RB4A 1IONA 5GVSA 5FL3A 2D06A 2YV5A 4FD2A 3O47A 1XMIA 4PHFA 1NIJA 4TQAA 3ZYCA 4MDFA 3W3AA 2WZQA 4GI7A 4A92A 4HATA 4DLZA 4RD2A 3GLGE 1GIAA 2C9YA 2QRZA 4NYMQ 3W8RA 4TMVA 1E4YA 1SQ5A 2VO1A 3T61A 1NMYA 3VX4A 4UXJA 2VH5R 2J87A 1U0HC 2EYQA 2H1LA 2GVDC 2BJWA 1NF3A 4IOJA 4KO8A 1E2MA 1ZRHA 4IOLA 3VR6A 3GFOA 5FPSA 5C18A 2DR3A 3K0FA 2FEMA 3UG7A 3NWJA 1CJKC 1KJZA 4F4IA 3SZRA 2CVHA 5E7IA 5BW8A 2GK6A 5JWRA 5FPHA 5BN4A 1RVDA 1Q3TA 1XEXB 2UKDA 5AUQA 3MJRA 4B33A 5IK2D 3AVPA 5EE5B 5SZKB 3WP0A 2HYDA 3X2SA 3KKPA 1HE1C 4BQSA 4L15A 4QHTA 1E9CA 1Z07A 4PZLA 4FINA 4CYMA 2J46A 1E2FA 1G291 1P72A 2IYVA 4YMUA 2NMVA 2CMKA 2AWNA 5EXPA 3PEYA 1AS3A 1M74A 1NRJB 1KMHA 4NPHA 2GJ9A 1HV8A 2WKRA 3WMEA 3GLIE 1AKEA 3U60B 4IDNA 1SVIA 5EP3A 4CEJB 3V9PA 2KSQA 1DE0A 5GJCA 2VIIA 4MKGA 4BE7B 2QL6A 1SVSA 2QAGA 4MGZR 3EG5A 1Z28A 2WTUA 2IYLD 2ZVQX 1W36D 3QKTA 2WV9A 3W6OA 1Q12A 2F43A 4ZDJA 1RE0A 2HLDD 5GADl 2VSFA 3FFAA 4BLRA 4TTRA 4AG5A 1Z0KA 3LVQE 1ZD9A 4Q4AA 2CDNA 3OEHD 3RS2A 3CR8A 1QZXA 3O8DA 3QVUA 2C77A 1G7CA 4M21A 3EZ2A 1R5NA 1YZQA 3RLFA 2QN6A 4JYCA 1M2OB 1ODFA 1AA9A 1BYIA 4AYXA 2JLXA 3RHFA 1XEXA 1RW4A 1XF9A 4HAVA 4PO9A 3IIMA 5JZVA 2HEIA 4RD6A 1TQ2A 4JVNA 3ZQJA 3A58B 4I81A 4PPGA 5DO9A 3F5FA 5BYKA 4YLGA 3LXRA 2QW6A 4FMBB 5L3QB 4AKHA 5FBWB 2DHRA 3GQBA 4PTLA 5FOUA 2F9MA 5F3WB 1G6OA 1SKQA 2QMOA 2W0MA 5HTKA 4TYQA 5KNDA 3VKHA 2C9OA 2LCFA 4WW0A 4C0LA 5EXTA 4CGZA 1W4RA 3K0EA 4N1AA 2XZOA 1Z2CA 3U61B 2FEOA 4G01B 5C46F 1M1YE 3PR1A 1LNZA 2G9NA 5D3MB 4UJ5A 3GEHA 3L0OA 5JWHA 4TZ6A 3THXA 4BUJA 5LD2C 5JI3E 1QHYA 1D2NA 1GG2A 3ZDQA 1EK0A
chains in the Genus database with same CATH superfamily
2IHZA 1M6EX 2V5AA 4EL5A 3D3WB 5ALLA 3MMPA 2PG3A 3OMWA 4Q1CA 4J4TA 3BILA 2X7XA 4HDKA 621PA 3B7ZA 3EMBA 4EOGA 3X1MA 1Z0IA 3C3WA 3Q6NA 5A1JA 3QM1A 4ND4A 5B3JC 1QRSA 3K9QO 4MPRA 3RYFA 2JGDB 4EAQA 3RODA 4KBFA 2VCEA 4A1OA 1NXPA 5F51A 2JANA 1LXCA 1Z34A 2PA0A 3KWLA 3EC7A 4QVGA 1D2CA 3KE8A 1TYCA 4MOWA 3EQ9A 4KVZA 3VI4B 3U4QA 1DKRA 4YB8A 4BNDA 2KEBA 2V7UA 4UHHA 3QA3E 3KX2A 1EK2A 1EXDA 3HGQA 3NT5A 1XXLA 3BF8A 2G88A 2PZMA 1FDWA 2ZB3A 5K8CA 5KOYA 1XMJA 4Z9YA 2G77B 5J5VA 4M9QA 3GCXA 3IKVA 3I58A 1RYDA 2OFWA 1C4WA 3M1LA 1M34E 3O7WA 2QT9A 5J4LA 4WNAA 5IUJC 2B9EA 1NW9B 2C7QA 3E48A 2NV2B 1K75A 4R2IA 4IBBA 1ORRA 1VC2A 5A4AA 1MXFA 2GCOA 1OOEA 3I9MA 4HH3C 4UD6A 5I9IA 5KO2A 1SCIA 2ZTCA 1W94A 1Y9ZA 2XJ9A 3NGXA 1EGQA 4K1LA 1HDRA 2DY0A 3LJKA 3IQXA 1NYQA 2H52A 3HPRA 3K0CC 2RB5A 4Q4HA 4QVKA 1FLVA 1ONPA 2NP7A 4CMJA 1LI7A 1QX4A 3M6VA 3OPYI 5H70A 1LKZA 1TB4A 2PO5A 1L4FA 1RRVA 1XCBA 1O6FA 2QL9A 3GJ0A 3NG1A 3Q0EA 4L51A 4ZYLA 1JFSA 4PN7A 1J23A 4PQRA 2H4YA 5KSWB 1VXRA 1P2GA 2Q2QA 3V42A 1C9NA 2X14A 1ZHHA 2NSLA 5KYXB 3NEAA 1EQ2A 3PGA1 5FBRB 3ZIAD 4HWTA 4Q7JB 1FFYA 1RC8A 1UFOA 3DR5A 3M6WA 5EJ6A 1DC3A 2EZ8A 4N12A 4BMCA 4B4WA 3M8KA 2DZDA 3LP5A 3V2GA 1GPYA 1J8YF 2QGFA 1NR5A 5KYWA 3D2AA 4WE3A 5FWDA 4D99A 1N7GA 4LXHA 5LQMA 2IXEA 3C6QA 1F2TB 4Q3KA 4WVFA 2DFKB 4IDHA 1QR2A 3VZBA 4YLYA 1WXIA 2WD9A 4E3ZA 5JXWA 4M37A 5AKXA 2F8SA 3I4LA 4YAWA 2P5YA 2QS9A 1F2DA 3K0CA 2UXDB 3FE2A 4I3GA 4N5LA 3UBMA 5LA6F 3AO0B 2QPTA 2YNMA 3OIVA 3JWPA 4ZMBA 4QFMA 1OC4A 2AG1A 4C4RA 2E21A 3NH6A 4PLFA 4TUYA 1FTSA 4ZJPA 5A4IS 2J45A 2PUJA 1UBMS 4YROA 4UCWA 1B6SA 3VAAA 2IYXA 2QXYA 3ANMA 3PEEA 3JD0A 4YCAA 4DHEA 1E69A 4H7DA 1MU5A 1F1BA 2G28A 2WM9B 4OLFA 3HFSA 2IU6A 3FCSB 3HJTA 1KH1A 1ZBDA 2B2XA 4XRRA 3V1LA 3Q7TA 4TYNA 2ZUCA 1PNRA 1Z7BA 4TWAA 5I7WA 4WIAA 4BGVA 2AUNA 3DTYA 3TN7A 1F8YA 3OTOM 1X8LA 1H4VB 3KZOA 3Q3CA 3WLLA 1Q0SA 4OVZA 1EFLA 4J29A 4DMLA 4RK4A 1RJWA 2HMVA 2QVLA 2VJAA 3MWEB 3OZSA 5JMPA 2X8AA 5AW6A 5JJ5A 4DG5A 4H0FA 2WJZB 3NRBA 3P0RA 4EFMA 2EW2A 2YJGA 2CV0A 3I5XA 3L26A 3G89A 2AMVA 3INNA 1NP3A 3CH6A 2ERCA 1RABA 2IYFA 1M3SA 2H1RA 2NQ2C 2Q27A 3NW9A 4LZOA 3OPYA 1BJKA 1MX3A 2YY6A 5A2QA 2F5SA 1DTWA 3DO8A 1R4NB 1CETA 3KELA 4MV9A 3DAOA 3P2JA 4ENSA 5C8ZA 5DYYA 4CKEA 1Z0SA 1KQGA 2PL1A 1UT6A 4G24A 5CX4A 2P9YA 3CINA 3TX2A 4P8RA 1E60A 3AFIA 4W5JA 3IUPA 1Q77A 5B53A 3LQRA 1GZ7A 1U4NA 2R8BA 1F6BA 2ZRNA 4IAOA 4DUZM 4J90A 1BD3A 1H05A 4WKPA 1UJCA 2AR0A 3TLAA 3VAYA 4EUNA 2QENA 5JFOA 2XRYA 5H8WA 1E7QA 2ZRLA 4A5SA 4E46A 5K09A 5IPFA 3GRRA 1OGIA 1N3YA 3E1KA 2QXUA 3P32A 2C84A 3G7NA 3M3DA 4E1BA 4LPKA 4ETIA 2WYIA 5IUKC 2W7TA 2RGEA 1GILA 3LYLA 1NI3A 2WMYA 1EM8A 4P3XA 5CM9C 3RK0A 4A23A 1AKQA 4ZU1X 5IF3A 2ZI5A 5BUCA 3ITNA 3R3VA 3JZFA 4EFLA 3H19A 4TXNA 1ZK4A 4DIEA 2FSPA 3LQFA 1U8YA 2I71A 5L3SB 4RPJA 1LPSA 3TINA 3FM9A 3QLEA 4ZDIA 4J3NA 3U56A 5ETJA 4LGVA 1YR3A 2MCFA 2QN8A 4PONA 2ADOA 2FX2A 2R5WA 2XUKA 3D8NA 3I05A 4IUDS 2ZB2A 4Q7LA 2XRMA 1HKHA 5IZ7D 2DKFA 3BMXA 1C0PA 2IHJA 4WACA 3UMRA 4XOIA 1LQTA 3MJSA 3MQFA 3ZVKA 1NMEA 2O1EA 3LQYA 3PYLA 1YQUA 4UAVA 1EHIA 1EVYA 5DLEA 3IEMA 3W0LB 3BEDA 3PWTA 3UW1A 4J1QA 2ZB4A 4NAUA 1GUDA 1DCKA 1O4VA 3PQ2A 4N65A 2ZTUA 1WZUA 3CW9A 2GQ0A 1BGXT 2XAUA 1FJXA 1H8ED 1EJ6A 5AXAA 1CKEA 4F8EA 2VPZA 1PT5A 2C8KA 3ZWBA 1D03A 2BY4A 4RPIA 4DCJA 1ZAKA 3L6RA 3LKBA 1GRCA 1IB6A 3M1AA 5SZIA 4D41A 1A5BB 1UMDA 2NZXA 4UD2A 4YRSA 1LDGA 2WF6A 1U3GA 3KWJA 4I50F 3X3HA 3D5EA 2CJXA 5F1PA 1KE1A 4C01A 1PFKA 4EB8A 1VPWA 1V8FA 2B1GA 3N0TA 4IJMA 2HT6A 5TVKA 3L7AA 4KR0A 1YS1X 2JHAA 4NSRA 4C04A 2JGNA 4CU2A 3GUHA 2ZUBA 3OESA 1J5PA 4O4JF 4QC2A 4GM1A 4BLSA 4GKBA 1FQJA 3VKWA 2HRZA 3D3QA 1L2TA 3PXCX 4TTAA 1NL3A 4L8GA 3M1YA 2I1VB 3QKUA 4Z8YA 1Y9DA 2OD2A 4ZPXA 1J70A 5KI6A 3PXDA 3FYUC 4RORA 3GLFA 1D4ZA 4X8MA 4EFNA 3CRMA 3AESA 3AF2A 3OIWA 3UUWA 5C53B 4NH0A 1QVVA 4KXUA 2GGSA 5I7UA 2C2BA 4OLAA 3ZBQA 2GERA 4Z3KA 2L7HA 1CP2A 1Y1RA 4OGLA 5CDFA 4C0QC 3UMJA 4E09A 3PLAE 1WJ7A 2V8OA 5KNDD 4N5IX 2V54A 2FZEA 1PFQA 1MW9X 3PQ6A 1DJMA 2OLEA 3FOBA 2QRVA 4O2AB 4RSGA 1IBLM 1V16A 1Z6GA 2G70A 3F92A 2XZFA 2KLHA 2BUAA 1IN8A 1R27A 1WEHA 2G9ZA 2KWIA 2VJMA 2X9VA 3KLOA 4L7QA 4DBLE 1AF7A 1M54A 3FBGA 2E89A 3OO0A 3KQWA 1S0UA 3HFJA 1JBEA 1G71A 4GKVA 3T7EA 1W35A 2GZAA 5CEJA 3UKJA 1HJPA 2XUFA 3DPUA 3KQTA 4PYKA 1OH6A 4LI0A 2PMKA 3QNUA 4L2IA 4CETA 4CQMD 1LPBB 4KMOA 4UZFA 1WPQA 2C5BA 1JALA 1X80A 2YZMA 3LF1A 4FKZA 3P0HA 1XKQA 3COZA 3MN1A 4ER6A 2QTVB 3BHNA 4HH1A 2PIAA 1WPRA 1ZSVA 2W00A 4ZVRA 2P5TA 2OBBA 2FXVA 5EKXA 1U04A 3A9CA 4QWWA 4O4LF 4L0QA 4YYZA 1TW3A 3MNFA 3LUKA 4MITA 4UQOA 3SYTA 3V2HA 2AFRA 3G23A 1YMQA 1Z39A 5F73A 4OIFA 2WYWA 4ZJZA 4RD4A 1DJLA 1KAEA 2DKNA 3YASA 4DCCA 3M9LA 4HJRA 4OB8A 4OK3A 4TMFA 5BQXA 3G0IA 3TZBA 2BJVA 3F6EX 5TRTA 4L9RA 1DAOA 1WGNA 1PHRA 1M2EA 2D0DA 3PJGA 3WK7A 3J7AS 4LSMA 3I62A 1B1CA 2OORA 1L5KA 2W58A 3T06B 2MSCB 4OX9M 4J4BA 3EC1A 3BORA 2WD7A 3PD0A 1L5HA 4E22A 4Y7DA 2VAXA 5EMKA 1NQ5A 1QH0A 1JAXA 2WA1A 3MYRA 2ZIXB 4LF8M 1TNDA 3L49A 4EKDA 1SHKA 4FN5A 1IXZA 1N3IA 2F2TA 2WHXA 4PSKA 4PZEA 3ROKA 5EP4A 2CK3D 3G9ZA 4F6LA 3T5AA 5CEFA 3G9QA 3UPTA 1ZCZA 4DBVO 1PQYA 4UQLA 1E98A 4LG2A 4BQRA 1E4EA 3R9IA 4RE5A 2X8JA 2ONYA 1EGMB 1ZL2A 3JR3A 3S2UA 4G8JA 5LQCA 3OPQA 4D3ZA 1TQDA 2Q2OA 4GITA 2OO7A 3QFTA 4MWGA 2BM9A 2ZJ4A 1V7CA 1Y3BE 3FN4A 2QUKA 3O91A 5GVRA 2H2WA 3KQUA 2C9BA 1KZHA 3VC7A 4CIYA 4PGMA 4ALMA 2ZQYA 1U7WA 1EP9A 3OICA 2OV2A 2EJSA 1RMTA 2D3WA 2WWGA 3EQ6A 1P0IA 5BN3A 2GCIA 2OHJA 4PCAA 6CHYA 4D25A 1RZUA 2Z1DA 3DPIA 2ZSKA 4E7OA 5KNBD 3SI7A 1AZLA 1OH7A 5D8DA 2FWPA 4P32A 1D4OA 1GT91 1Z4IA 1EIWA 4DQ0A 1N77A 1KERA 3DOIA 3LQ1A 3C5CA 1H2AS 1NURA 4BV9A 1C14A 3ELDA 4OBXA 4XCQA 4MGKE 1YQDA 4GVLA 2BR5A 4AZ3B 1P81A 4X62M 1K3TA 1V4BA 2IF0A 1V34A 1M2VA 3H8VA 2YHBA 2AG5A 1LPMA 3PP8A 3ZXUB 4CMGA 4LCBA 5K0NA 5HUJA 4QL3A 5JY6A 1Z36A 1ZUIA 2OMEA 3LM8A 3N74A 2P6RA 1JL3A 1G4HA 1G5QA 1KMHB 1LWNA 1PJZA 1T26A 2AFIA 2HPHA 1DIRA 3GD7A 5HFJA 1IN1A 3N7UA 3OQIB 2DAPA 3KPVA 3TJZA 5LBUA 3PITA 4IXDA 1T1IA 3L05A 1X8JA 3EISA 2R00C 4FGWA 4A2QA 2I8LA 2WSFF 3K4QA 3NGLA 1U7XA 4JKIA 2MHCA 4FUTA 4DCGA 4KFTA 1PL8A 2BR3A 4JGIA 1IN5A 4KWEA 4HQNA 4MW0A 1BG6A 4U7DA 3DONA 1CNEA 4JVLA 5JQGA 1MG5A 2UUAB 3U6CA 2A1UA 1RIFA 4WXPA 3P9NA 4CCYA 1JEJA 3K5WA 2OECA 1CULC 3SYMA 3OQPA 1PX2A 1LI5A 3W34A 2PV7A 4BMZA 2OO9A 2ZYAA 3GNTA 3L7YA 1JHOA 2XVXA 3JR5A 4LVOA 1UKEA 5DMHA 1I7QB 4O4HA 3KXPA 4LUCA 3SEFA 3UUFA 3WWEA 4D0RA 2R00A 3TBHA 2BE7A 4ZRNA 3MLAA 3X0DA 5B7GA 5JXGA 5LLTA 1L5WA 3WK4A 1UPXA 3DGEC 3Q6MA 2O06A 5E1OA 4GVPA 1GDDA 1II9A 1E2NA 2IBMA 3I9FA 1CR6A 3KVVA 2AL7A 5TDHA 1L3CA 3GT3A 1PYGA 2HADA 3BSFA 2R62A 3GJ5A 2P69A 2W83A 4FWBA 3DCYA 4KO4S 4MZXA 4W9NC 3WWDA 1E79A 3R24A 3LXMA 4IHQA 1T8SA 1W19A 3SIPA 4D4IA 3KJQA 3A9RA 1DWOA 2DQ4A 3KTAB 2XUIA 2UV8A 3A9SA 2XLBA 4GXNA 4JVOA 2BBSA 4WFKA 5FFMA 5C52B 5K8UA 2IYEA 3HYNA 3JWIA 2RGOA 2PQ0A 3L43A 4M54A 3CCCA 5DTJA 4AQDA 4OYRA 3ON5A 3NDRA 5CH3A 1SHZA 3NAQA 4PLTA 3EAQA 1TM4E 1Z73A 4GMXA 1G5FA 3UY4A 5CFOA 2A1UB 3IP6A 5ALUA 1YZHA 5LZ7A 3TZKA 1JMVA 3DHEA 2B25A 4GMFA 3AG6A 2EKLA 3ETCA 1RSZA 5FORA 1UDWA 2P65A 4URFA 3S3TA 3B1YA 1PTKA 5HZKA 1YR6A 3TUIC 2RHGB 2GAIA 3W6NA 3GRAA 1AKMA 4U5QA 1NUHA 1Q0RA 3OP4A 3D7SA 3SZLA 3REQB 3KOYE 2ZDQA 1V3VA 2A86A 2AXQA 4UBLA 1L5OA 3BGWA 4CCSA 4Q7KA 3EXHA 4DF3A 4X84A 3V7NA 1XZFA 4NOOB 2FS1A 1GGNA 2OC9A 1QF6A 3ZKAA 4HLQA 1Z3CA 3RKSA 5HMLA 3CN9A 4YHHB 2EXXA 3SGLA 5GIPE 3FHOA 1WDMA 3LX8A 1O87A 4JYZA 1B43A 1YFZA 2WTAA 2AC4A 2GA9A 3MHTA 3UG6A 2IUSA 5ESWA 5CCEA 3HM2A 5I6DA 4RMIA 5BRAA 3VZDA 2I3BA 3EY9A 3OECA 4IIEA 4ZAZA 2I9KA 5D1HA 4O2RA 5FTKA 4D8VA 4AZFA 3LPCA 2QJOA 4ESVA 3EJWA 1TO1E 5CNKA 4RVHA 4H1TA 2C5GA 5A71A 2IU0A 2P9TA 4JUBA 4EF5A 1QC5B 1ES9A 4ZCLA 5COBA 1MPXA 1WS6A 4G56A 4XSVA 4Q1DA 3Q12A 4OO3A 4DT1B 4ZC1A 3HJAA 5D85A 4R7GA 1J21A 3VR1A 3N39C 2OXIA 2PVPA 4ZVLA 4DYHA 1SCDA 4MYHA 2WT8A 3IAUA 4P35A 2QE6A 5KWSA 1SCKA 4FFOA 3PR2B 1P9LA 1MEJA 1VPEA 2ID8A 3EEFA 4YCNA 1TZCA 4AMUA 1OZ0A 4GXTA 1HYGA 1G6HA 3IERA 4G3XA 4YC7A 3IE2A 2JI8A 3IJPA 1I10A 1F60A 3KPYA 4LVUA 3WK5A 4CM7A 1LF5A 1NNUA 4MWCA 1B0AA 4WLEA 3AETB 4RU1A 3IUNA 1IUOA 4XAQA 4PV7A 3WYBA 3B2NA 2DWZB 1VRWA 1Z62A 2O7SA 3OUZA 3HH8A 3NHJA 2DFPA 3V1NA 4PRLA 3RAGA 3HJGA 3N86A 2G0NA 4Q93A 4NMWA 3GP3A 3C8HA 4O4LA 4B9AA 5BQPA 1X7WA 2ID7A 3CW2A 2LTAA 2ZTSA 1ETUA 4BO3A 4NBUA 1U0RA 3HU2A 1YGPA 2EBHX 4EPWA 5CYOA 1K4MA 1PJRA 2B4RO 4X00A 1PFGA 2OC4A 3IP7A 3S40A 2BRUC 4YEDA 2KB0A 2WWFA 1GGVA 3RV4A 2C1EA 2ZSJA 4QLBA 1H9CA 4R69A 4R98A 2BOVA 3QVJA 3JYQA 3SK0A 4ZEMA 2C98A 3M49A 3TOSA 5SYMA 2PLRA 4L72A 2LCIA 2BFCB 3RAPR 3PQCA 3EARA 4GEWA 1JNYA 3F4BA 4XUGB 4AM8A 5HVNA 5JRDS 5EJ7A 4F2LA 4C87A 1WHCA 2SKEA 4PHHA 5DTQA 4DRZA 1K3XA 2ZSUA 3D0OA 1G3UA 4YFVA 2E5LM 1IIRA 3ADDA 2DVMA 4JI0B 3DA1A 5HRAA 3OIFA 5DM1A 2WYVA 1FA9A 1W9HA 2AB0A 2D7CA 2PGNA 4DLLA 1KFEB 5LR6A 3GEMA 5GZ3A 2Q8NA 4Q4JB 4BMVA 4CN8A 2PTHA 1S8OA 1Y8AA 5DJ5A 2B5WA 2VHVA 4NC6A 1TKRA 4GFDA 4N7JA 4OQXA 1OI2A 4JYAB 3GLIB 2AQ8A 2DY1A 1CHNA 4G4QA 4Y2XA 2BSQA 1UBGA 1CYDA 1X1EA 5DXAA 3HG7A 4NBVA 4NXNB 1S2MA 4ZAWA 2CXHA 4G4NA 5AI8A 3TSYA 4L6V6 5KSYA 4I19A 2DAMA 2HA7A 5CNMA 4M0WA 5LDGA 2VJLA 2EVWX 3F3MA 1ZFNA 4EATA 4A0SA 3FYHA 2FMIA 2ZG6A 4C3ZA 5G4KA 2HR1A 2OV4A 2FDRA 2XCLA 4YQYA 3VTKA 1NSYA 2EV9A 1QZ3A 2IIBA 5EHNA 3SC6A 1CD5A 1M7BA 2MJ5B 1N2EA 1TQHA 2D1SA 4DOMA 4EGSA 4HG2A 1M2GA 3HNOA 2NT3A 3BB1A 1PBNA 2OCLA 3GLRA 3FF1A 3C4VA 1XD8A 3EXHB 2YH2A 4NCBA 1AS0A 3N0XA 5EJMA 4I46A 3SIRA 4W5NA 3I6YA 2B7CA 2R2AA 4Q1VA 3ROZA 3SX4A 3O7MA 2A1IA 2ZYTX 3OU7A 4JSTA 3F2VA 4BP1A 5TMPA 3CRNA 1V35A 5P8WA 4LXUA 4IZOA 4ZN6A 1RYHA 4G8CA 2VZLA 3NKFA 1UJNA 5CXXA 3OQNA 2GZRA 3CLTD 4NJMB 1H93A 1CUDA 2TMYA 3PUWA 4QUEA 2BGWA 3LQQA 1QHEA 1GUZA 1BCRB 1CJVC 2XMRA 1SPBS 3QI2A 3IUQA 4WXHA 4XIGS 4DLVA 4EEXA 4YV1A 1EDZA 1KH3A 1IOVA 3OCXA 1R8JA 4XJTA 1XQ6A 2GJSA 3FJOA 3BXGA 2PZJA 3HR8A 3OCCA 2IU4A 1W36C 4PY2A 1IYZA 1ST2A 3EVCA 3NHRA 1PJQA 1VA4A 4P93A 1UEIA 3HZZA 3HKCA 3JTEA 5ALGA 3WNQA 1YF3A 1OYYA 2ZJ2A 4PXYA 4RIIA 3FI9A 3K5IA 2HRBA 4PGAA 4WHMA 1WXGA 1HY3A 2Q1TA 3W4KA 3U6BA 4TLMB 1JN0A 1C9DB 3ZTYA 3TUZC 4E33A 3QYPA 5IWCA 4CKWA 1AF4A 4ZQBA 1R0RE 4OQNA 3FCOA 2DFLA 1KDZA 2JFNA 3V6MA 1C7EA 4M1MA 3SHQA 3MCUA 1IEVA 1QLHA 4G0YA 3RT9A 4I8DA 2ASVA 1XCPA 5AKIA 1E7SA 3WGOA 4B2IA 3QUSA 1U2TA 1X7DA 3ECCA 1RXUA 2QV0A 3F6SA 4QU5A 3VR4A 4EJ6A 3EVBA 2V7XA 3LLCA 3PRJA 3JW8A 4A2CA 1Y98A 1YDHA 3WGJA 3HJNA 3ADOA 3M33A 4MW5A 3X1JA 3PCTA 3FWYA 3R5JA 4WQMA 3DL4A 3RYHA 5K05A 5KJFA 1NVTA 3DYVA 4P7KA 1NJ8A 1LSUA 5KNCA 1DKOA 1E3EA 4M9SA 4QPPA 4YPFA 2I80A 3KU4A 3JR4A 1MH1A 5KCZA 1E8MA 1RKUA 3LY5A 5IDYA 4N47A 4P17A 2OLKA 4R3UC 4UNRA 4RFSA 5KOJA 5EWMB 1UCFA 2ACVA 5LQKA 2JHFA 3GR6A 3ZE0B 1XG5A 2K0BX 1ISRA 1Z17A 2ZGVA 2AI1A 5FPQA 1DO0A 1I0LA 2H3EA 4NZNA 1R9JA 5E4JA 1BKDR 1M8JA 4NIMA 5LB2A 1RI4A 1KYQA 4RWZA 4MDEA 3WTBA 1WMSA 1LPNA 1PFVA 3SEZA 5FWNA 5K0ZA 3WLQA 2QM7A 2Y68A 3IDQA 1SULA 2R79A 4YJ2B 3UH1A 3V32A 4BJ1A 3CF4A 1Z33A 1TJNA 1DCMA 2BGMA 2JEZA 2A4MA 1AQUA 3D8UA 3LW8A 4MQUA 3B1FA 5E8JA 4HUQB 1OWPA 1RLTA 2QUHA 2PFSA 4LRUA 4XCXA 3SR3A 3NXKA 1KJ8A 2PUFA 1KY3A 1OROA 3CUYA 3EXIB 3HJCA 4BNTA 4LYAA 1VFNA 1YOVB 4E12A 5DE3A 2OQ4A 4O2LA 3OTHA 3MAAC 5AW9A 5KZMB 1NNSA 3HVRA 1M75A 2ZFUA 3L5KA 1CUEA 2XTJA 4WH0A 3T1TA 4I1IA 1VSUA 1ISPA 5C3UA 2GQFA 4DLNA 2ZDHA 4L5CA 1EDEA 3R7FA 2ZREA 3W8DA 1SA0B 4TXMA 4R9VA 1KDRA 4BRUA 3N75A 3V33A 2FQXA 3Q9SA 5ISMA 2IQ5A 5C8VA 3TBFA 1EP2B 4IOKA 1MD9A 2MH8A 1JGTA 5DHSA 1CNFA 1ODSA 1RKBA 4BLOA 3URMA 5IS2A 1T5SA 3WSVA 2WJGA 1UBKS 3C97A 1XX6A 3EWIA 4NRVA 4MR7A 4J75A 1JHDA 5EJEA 3DHVA 3E5RA 1PCXA 1W93A 2BFDA 3BMQA 1CR1A 1KQ3A 3HLKA 4K2AA 4Y2HA 4DQDA 5AXDA 1ZJ5A 1L6RA 1VYVA 2VK8A 4S0XA 2DULA 3MBIA 4HTAA 1CQJB 1L7QA 1MU0A 4M76B 2XQVA 4ZOAA 3PT5A 2QPAA 3IX7A 3FTQA 3D4NA 2C03A 1TU4A 5B7NA 4H15A 4OJKA 5IAEA 4ZMRA 4KWIA 7YASA 3AEXA 3I2YX 1M2HA 3GRPA 4RVGA 2ZTVA 3G7UA 3DA8A 2ZWIA 2QVGA 3GN1A 4M2LA 4D2IA 5LMCA 1VE5A 4NMXB 1N75A 4ZXFA 1Z5WA 1UEXC 4PG5A 2QBYB 4LZAA 5LQSA 5LU9A 2W11A 3UOWA 4B6JA 5EJ4A 1JX6A 1URPA 2BF4A 4KRXA 3QVVA 3PD7A 1JF8A 1L3IA 3PNBA 5HBRA 1DBVO 3G1WA 4UN2B 4LF6B 4LY9A 4DT1A 3U3JA 1DTSA 1ZOOA 2R97A 5ICGA 1GZVA 2IXBA 2EU8A 2IV2X 1P19A 2XB9A 1OI7A 1T9GR 3Q8KA 2LDBA 4I36A 4Y9DA 1NW5A 3OIDA 2P3OA 1PQPA 2DSNA 1AUQA 1Q11A 3I2KA 4UCQA 4D8XA 3EZGA 4KIFA 1BVSA 1YJBA 4LF5M 4LE2A 5ED0A 2OM6A 5EUQB 1LK7A 4DTIA 2VZ0A 1G1AA 4FFBA 3AZPA 1H3EA 2UZ1A 1KVRA 2VYFA 2GHRA 4Q19A 4YT2A 4E13A 1QG0A 1XQ9A 2HZBA 1JKMA 4KQ6A 1YB4A 2HPAA 3D0KA 5H9VA 1RBQA 2RJ3A 1JVSA 2IYWA 4AC9A 4DA8A 3ZHQA 5JMOA 5IARA 2X2PA 4F3TA 4GHWA 1D0IA 2FFAA 3TTTA 1E6EA 1DIHA 1HFJA 2MJLA 1YAHA 4WGFA 4ZKDA 5L3QB 3JD1A 3W6ZA 5L40A 2DH6A 2PA3A 2XWQA 1XMVA 1Y1SA 1E2LA 4TN5A 5F1YA 4G1MB 2IXDA 5EIBD 3ZDFA 5C81A 1TTPB 3IILA 3WYFA 3EFBA 3BJEA 3UK6A 1QBGA 4EYSA 3HKDA 1WXHA 4G26A 1MT3A 1NR1A 4F3KA 2UYCA 1CS0A 2HSEA 4R1NA 5HX7A 4N40A 3TH5A 2C31A 4WESA 1Y5RA 4ZVKA 4J3JA 4RF1A 4PR3A 3SOPA 3SVTA 3R9XA 2FE8A 1H1TA 1C3JA 1R4GA 4RTRA 2BVNA 1S2GA 2QX7A 1RQPA 3TIGA 1YUBA 2ZBPA 3P7MA 4KIUA 1TLTA 1ATIA 3SMSA 2DTDA 4J76A 3GRFA 5D00A 1ZD5A 4MCHA 3K1AA 1FMTA 1NRIA 9LDBA 3V1MA 3RF7A 4HS4A 4DMKA 3KTAA 5LU8A 2DZOB 2IY7A 4X7BA 1LTKA 1G8GA 1R8SA 2CLHB 2G1JA 3VPSA 1MQ8B 5H81A 3ZHSA 1JHRA 2X0NA 5CYGA 3I1IA 1QOQB 3SHTA 2QY9A 2WUFA 4OI1A 4R16A 4OYHA 4YMIA 5AW5A 1IUNA 3RABA 3KS4A 3IA7A 2RG1A 1KBOA 2R68A 1POXA 5LM3A 1NLUA 4DR6M 4JLDA 5CB4A 3K92A 2L42A 3F73A 5ALRA 4R6XA 4HDRB 3BVPA 2W93A 1SEVA 2OBNA 3U7IA 3HCDA 4GWLA 1E2KA 5ELLA 3V2UA 2F3TA 2I4RA 4C4AA 3KJEA 5CBPA 2IOYA 4DCOA 1UT8A 1V41E 2EG5A 3H1BA 1PYOA 1RP7A 4WKCA 3QWIA 4JI6B 3S29A 1X8XA 4NL4H 3ILSA 3FZQA 3VBEA 3ZXYA 4B7CA 1GUAA 2F4VM 2ODQA 3LPAA 1QDUA 1CK4A 1DC8A 4XXHA 1OAAA 3ZEAA 4MQFA 3ZV5A 1QNFA 4M53A 1RYFA 1A2BA 2QP3A 1NF2A 1KHTA 3E1SA 3PUKA 1R4AA 4MEJA 3ZR4B 3S1LA 3I2FA 1SK8A 4U2DA 4Q15A 5A7GA 4BJHB 4BNIA 1VE1A 1WHSB 4UTXA 5IHXA 1LTMA 1MV5A 3EMVA 3GVHA 1JIKA 3WWOA 5CURA 2ZRCA 2IEBA 3C2QA 3RVSA 4N6OA 2J7PD 2B1JA 4ZJUA 3AEKB 1L8AA 3R3XA 2X2EA 1G8HA 2X86A 4Z1MA 4YMSA 1GQQA 2FP4A 2QRPA 3K2EA 3L6DA 4R83A 4KL8S 4OI4A 3F8WA 1DBSA 3V4LA 2JH3A 5KTNA 2FPXA 2DUUA 2VHCA 4J49A 4JQOA 5IJAA 5EINA 2VWGA 4DG8A 1OVGA 2VHZA 3A6PC 2ZIXA 1JKFA 1RM0A 1P3JA 2H4JA 3RS4A 3QKSA 4ZTUB 4JL8A 3HHWA 1N3LA 1JIIA 2G5PA 1YBFA 3M5DA 4KFSA 2P2LA 1U9IC 3TVYA 2R8OA 1UMKA 4FNGA 4AMZA 5JDCC 1PZHA 2JCYA 4A27A 5ITQA 2VHJA 4YRLA 4P4SB 1TIBA 3VR5H 1R0LA 4KGVA 2F5QA 4DJTA 3GLHB 2QZSA 4B47A 5DNDA 1BGWA 1D1PA 5IJZA 1R4NA 1GPAA 1WCXA 3D4IA 1EDOA 3DGFC 3ZCTA 3FLBA 4XGQA 1GTJ1 1R88A 4LWPA 4M1OA 4HT3B 5YASA 3CVYA 1HMPA 1JSCA 5ES4B 2I2FA 1M6VA 2QR5A 3E2IA 4F56A 2BFFA 4RLFA 4TRRA 4MJXA 4ZZ0A 3U6EA 1ZITA 1DRVA 3MA0A 4B44A 1W1UA 4DJEC 3I9KA 4TV9F 1VDMA 1ODKA 4N3GA 3RVNA 1ZPDA 1OSNA 3TRJA 1KI1A 1NDQA 3CZRA 1ESNA 3OZAA 4IUBS 4JNKA 4WASA 4BVGA 1X7WB 2X4DA 2WR8A 1SOVA 3AR4A 1P77A 3ID6C 1PWHA 2ISQA 2FEAA 4CT4B 2EKPA 3U40A 3FIUA 5ITSA 1AIPA 2J07A 2CYBA 5DSTA 2ZSAA 4AZ0B 1L1QA 2XECA 4CMEC 3HY6A 3R0IA 4HEHA 3LL4A 5EIEA 3OF3A 4QLOA 3SCZA 1SEPA 5KOHB 3MRTA 2RMKA 1Y9EA 3LWNA 3Q85A 2H2DA 1WF6A 1O1YA 1MC1A 1P39A 3D2CA 4EKNB 5KU1A 1VJDA 4NAVA 5DIFA 5SY4A 4MVCA 1H8HD 4KQMA 5CFZA 4JHLA 5E9WA 1OV6A 2FJPA 4FHCA 4RKEA 4CV0A 4TYYA 2R48A 3BBLA 2FVYA 1XZEA 2NO1A 3OJEA 4AY2A 3R40A 5CU7A 4CHTB 3M81A 3ZZ1A 5DHQA 2J0EA 4BB6A 2C5HA 1FP2A 3D3EA 1YZYA 1OX6A 3JQ8A 3T3NA 2FWJA 2COEA 1E5TA 1SUWA 2C5LA 3JASB 4H4DA 4YGYA 3RK4A 3WLIA 4BCBA 4LDPA 1F0YA 2V6ZM 1DBIA 2B4KA 3DOFA 2Q5LA 1UZLA 2P1DA 4LXGA 4ZVOA 5B1YA 4P7BA 1FDIA 4RMHA 2G3QA 1V1MA 2AOTB 1JYSA 3QLTA 3A1WA 4W5RA 2ST1A 3IRUA 2I7VA 2R1TA 2HU2A 2JZ0A 2YV4A 3M6XA 5B30A 5EAIA 4H31A 5DPMA 4Q9KA 4OFZA 1ESMA 2O1SA 3SU8A 1U1EA 4LZPA 3VSCA 3VU9B 4NBTA 2OTCA 3O2NA 3GN2A 3L41A 3IULA 4UNSA 1PNTA 1CPYA 2HM7A 2LHCA 1PLJA 2QPLA 4NFYA 2BZGA 4YMLA 2WTMA 2KBFA 1Z6QA 4JB0A 4LQ4A 1ISIA 5KBYA 5JARA 3GGCA 4ASUA 2OBXA 2JA1A 4ZGBA 2XGSA 4F11A 1C9YA 2ZT5A 5KAPA 4I5DA 5LL6P 2GFHA 2J6IA 1E1YA 3SS9X 2DMRA 2VYQA 1UWKA 2OFOA 2V9ZA 3LDFA 1DNPA 3Q1LA 1Z2AA 4RTPA 4OHRA 1JA9A 4MR8B 3KVRA 3IBTA 4B4UA 3UT6A 2BFPA 2PRIA 5A4JA 1BAPA 4MWEA 3LW7A 1NW3A 5IJWA 2GKSA 4RZ2A 1SCQA 3CF6R 4D4JA 1PT9A 3I2HA 4GX0A 4B3DA 1GQYA 2QGNA 4ID3A 3G2MA 4M22A 1Z8DA 3DMTC 3T3PB 2RI6A 3ZIDA 4BVHA 2E4AA 4L8LA 3TYXA 4HDRA 4W1PA 3WZ2A 1P3QQ 3ZGZA 1WL8A 3E7DA 1GO2A 2WT4A 4K9MA 4MP6A 1ZR4A 1DDGA 3BIOA 4YFYA 3LK7A 4NYIR 2O2XA 2IT1A 3PVZA 4ZU3A 2BZSA 3H42B 4PZDA 1ECBA 3G68A 2PGJA 5G2OA 1TJPB 4HPWA 1F4PA 1XEAA 1D07A 3HDTA 3DFUA 5EE1A 5KPJA 3HJRA 3UIEA 4BO1A 1JPUA 2PYIA 2C7OA 1P2SA 4KN8A 1R8QA 2VN8A 3IAXA 4OL0A 1M5TA 2IXGA 1QYVA 2MYNA 3PCXA 2XGMA 2HCTA 1XMSA 3PNPA 4XYEA 5TMEA 1NQOA 2LPMA 3CT6A 2HF7A 4MR9A 5EIHA 2J6BA 2R4EA 1V1JA 3LT1A 4HMPA 1NN3A 2LHGA 2Z30A 4L6CA 2ZULA 1A69A 4DUYM 3CZ9A 3D0RA 3KXIA 5JCZA 2RGRA 1XTSA 3ZDXB 1XMXA 1X2EA 2BWBA 3ND7A 1ZH4A 2R5FA 4G5XA 4K28A 5BWMA 1UFZA 2PR7A 1TAQA 3FUCA 5K51A 4IHJA 4J1TA 5FBKA 4HNUA 2CVZA 2DFTA 2RGBA 2Y0TA 2FUNB 1AUOA 2I62A 3OC0A 4B7HA 1YFJA 2DI0A 4DSNA 3P9PA 3ZX4A 1CJSA 4CM9A 3H84A 1FYFA 1LTQA 2J5KA 1FY2A 2PH3A 3WLPA 2GF2A 1OTXA 3AF1A 4E4YA 2IYTA 4X65M 3QSYA 2BHSA 4S12A 1RQGA 3W5DA 3KLNA 2IZ6A 4NK4A 3IP3A 2DT8A 3PICA 1T15A 2VC2B 4ND2A 4C1BA 3KHSA 5LLSA 4QOSA 1GSAA 4HGRA 1JR3E 1J56A 3UC5A 3TQOA 3U2QA 4LOIA 3UMBA 1OKSA 1XDWA 3LX4A 3W5CA 2OQ2A 4DR2M 1OQAA 3JU3A 1XJWA 4FFLA 1FNNA 1YACA 4JP3A 2EGHA 2BUCA 2A5DA 2GPSA 2NU9A 3DOUA 2VJPA 4M9CA 2GJKA 3RSSA 3EA4A 5DU2A 4FKBA 4US1R 1MB0A 4LQCA 5G0UA 4DV1B 2CVQA 3QEMA 4ND1A 1T1EA 5J3JA 2JDID 4KRGA 5CM8B 4F2HA 2NTYC 5IYZB 2XD9A 3O4RA 5CMLA 3AMVA 4MEAA 3Q8MA 2LW7A 3JVEA 4HX5A 3HQ4O 1VKZA 3QEAZ 1XLVA 2M60A 3OZEA 2EJBA 3T6KA 4YPVA 1XKLA 5KUTA 1EJBA 1JZQA 4IRUB 1OFIA