3U61A

Structure of t4 bacteriophage clamp loader bound to closed clamp, dna and atp analog and adp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
186
structure length
178
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 41
structure length 178
sequence length 186
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u61A03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u61A02
3U61A 3U60A 3U5ZA
chains in the Genus database with same CATH superfamily
1NHGC 3DOAA 3U5ZA 2L7IA 2APLA 3GLHB 2KNVA 2LH0A 1SXJE 4MGIE 4FWHA 2KZSA 4QNMA 4JI1M 2GQFA 3THGA 2XZUA 2KXEA 2DZLA 3TE6A 2WSFF 3MHVC 2K47A 1WGNA 2OQ4A 4AZFA 1LTMA 2Z4RA 4DV3M 3GPPA 1P3QQ 2DAEA 4G4QA 2CP8A 1WJ7A 1T43A 4DV7M 1DGGA 2UUBM 5DNYA 3MJ5A 4D81A 1WXQA 1D2NA 1IN7A 3AV0A 2BNKA 2D7HA 4IBDA 5FTNA 1IXSB 3C3DA 3W67A 4LF5M 2LVNC 2C98A 3GRUA 1ZMVA 1EE8A 4LF8M 2CRUA 3GRYA 4G4NA 2HHHM 4GKKM 3HGIA 3GLFA 4X64M 4OX9M 1QAQA 2R4EA 1SXJD 2BJWA 3NWLA 3TWLA 4DUZM 5KO3A 4DR2M 2KW0A 4IJEA 1SXJA 3M0EA 3I04M 4L15A 4LZZA 2V6ZM 3SATA 2A5YB 2R0IA 4I5SA 4QOZC 2JWSA 5EXSA 3J2PB 1OAOC 4A3VB 1IBMM 1NV8A 4YY3M 4G6ZA 4XBOA 1HR0M 3GRVA 2EKFA 3R8FA 1JR3E 4OU7A 4JI3M 1L2BA 3U61B 1S3SA 1XC8A 5FTJA 2AHMA 1I4WA 2DAKA 1Z59A 3QWLA 3T6PA 3PFIA 4AQYM 4L8RC 1KYIA 1SG9A 4AKIA 3VKGA 4LF9M 3K2LA 3BGEA 1PJIA 2LVQD 2D7GA 1G59A 1AUAA 2JP7A 4JYAM 4DV0M 2Y20A 3W0LB 2JY8A 3K92A 3HHXA 1GO5A 1Q3CA 2B3TA 4WP2A 2K9DA 4M9ZA 4WURA 5LMNM 1N78A 3HJSA 3W0FA 2K6BA 4GRIA 2XF3A 1NO1A 3M6AA 4D82A 2ZM6M 3SARA 1HNXM 1IY1A 2QBYB 3B7QA 1TDHA 1JR3D 3GQ3A 4QNRA 1TH2A 1X37A 4IBGA 1QZMA 1JR3A 1OIPA 1K82A 2LVAA 1VDDA 2YNMD 2DVWB 4FW9A 1Z5AA 4GEWA 2L6OA 3RGPA 2WSEF 1EFUB 2MROB 4CIZA 2DNAA 3UK6A 5IREB 1NNJA 2V1UA 2YR0A 3B89A 2UXBM 1HT2E 1YUBA 4PCZA 1PJJA 4I8OA 3GRRA 2MJ5B 2R45A 4NRVA 4II7A 5EP3A 5IZ7D 1NJFA 1OKSA 3D8LA 1MU5A 1WHCA 3DFZA 2K0BX 4B3TM 4IBJA 5A2QS 1DO2A 3AKZA 2CUZA 2OPFA 3U6LA 3TPZA 3RC3A 2DENA 3GPYA 1OFHA 2OOAA 3FTEA 1QZEA 3C9PA 3FE3A 1PRBA 4QHSA 1R5LA 4LFCM 3GLIB 1PJTA 1N36M 1XXHE 1D0LA 2OO9A 3J81S 1N32M 3SAUA 3H4JA 1NSFA 2L4FA 2R9GA 2DWZB 1TF0B 4Z8XA 3RC8A 2CV2A 3U6EA 3AOEC 5IT9S 2JZ1A 2KRKA 1XWIA 4JI7M 1VEKA 1DGHB 1PM5A 4L6V6 2FNAA 4KHPM 1QAOA 2MR9A 2DWNA 4CHTB 1IBKM 1E32A 2FH0A 4BBAA 2UU9M 2O25A 4GITA 2EKKA 5E26A 3IG8A 2D7EA 4W5WA 5C1BA 3B74A 2J5YA 3LQQA 2JY7A 4L4UA 1ORYB 4G4OA 1TTEA 1ZAEA 3AOEA 2C5RA 2ZTDA 4KT0F 1IN8A 1OIZA 2MGWA 3FUVA 5GKNA 3ILKA 5JI2E 3T1YM 3W68A 3SHGB 2CWBA 3KOWE 1XXHA 4JI5M 2KNZA 2DAMA 2XH9A 2F5QA 2H5XA 3B7ZA 3H4MA 3KS4A 5F3WA 2DAIA 1QUTA 2V1CA 4LCBA 4OW0A 3U60B 3L25A 1MJGM 1W5TA 2DI0A 3L26A 1IQPA 1NJGA 5KPZA 1C1KA 1GABA 1D0KA 1C7YA 4XGIA 3OTOM 2XLJA 3E4RA 3HHWA 4DV4M 4NC6A 3R9XB 2XSZD 3KDSE 4R71A 2H1RA 2HCBA 4MGKE 4TUWA 2XSZA 1F4IA 4LRSA 1WR1B 1OAIA 2M5ZA 3J27B 1Q3BA 1IXZA 2ZBKB 1PGYA 2ZAOA 2G8LA 4DR5M 3VK7A 3I4YA 3FKEA 2JY5A 3AL0C 3L28A 4M0WA 3LCUA 5EXTA 2QW6A 1JB0F 4NXNM 4GH9A 3A46A 3SYLA 5FTLA 3BOSA 4MGYE 4CJ6A 2VDBB 1XHBA 3PNVA 1L2DA 2UUCM 3E9SA 4EIWA 3FTDA 1AIPC 2FS1A 4JXJA 1HQCA 1XNQM 2F5PA 4LFAM 3CTDA 1FNNA 4R7GA 4DR3M 1NHWC 2Y21A 3J7BA 2VIIA 4LJ5A 3GLGB 5FTMA 4BLCA 3M7GA 3WHKA 1MW5A 1XNRM 2R62A 4IBBA 3EIHA 5FSWA 1QANA 1N33M 1GLNA 2C99A 3HWSA 3U5ZB 1YSYA 2R44A 4B7FA 3SHFA 3U6MA 1G8PA 1QDTA 1R7RA 4OVZA 3JAMS 3RFWA 3HKPA 4LFBM 4DV5M 1NV9A 2KZUA 4HEOA 4NOOB 3JR4A 1N34M 3HU2A 4NL4H 4B7GA 4CGYB 3U6PA 2R65A 3B9PA 2L09A 3HJ8A 1I94M 1Y8GA 2LHGA 3FUUA 5L8RF 2CV1A 2FOIC 5LMUM 1K3XA 4GC9A 4X62M 2LVPC 4LF4M 1QQWA 2WSCF 4HLQA 2L2DA 3SAWA 4M9SA 2O01F 1HNZM 3GO8A 2EA0A 4IIWA 4RF0A 3PVSA 4PD2A 3SMPA 4F2LA 1VQ1A 5IWAM 3GLFB 1IN5A 7CATA 3AOGA 4I81A 1ZV1A 3FYCA 3NBIA 3VK8A 1IN4A 1SXJB 4NSOB 2E5LM 3I01M 4FCVA 4I4LA 2DZNB 1N75A 2KRUA 2BWEA 3GLHE 1V34A 4LG2A 1E9RA 4LRTA 1L2CA 4CHDA 2RKOA 3SBJA 2QP9X 4DR4M 2CHGA 4S12A 3UJNA 2WZJA 1Z5CA 4LJ7A 2P5TA 4X66M 4AKHA 3L27A 3E46A 3KOZE 3HX3A 1W5SA 1HJPA 3JR5A 3U6QA 1YLAA 3FRHA 3KSXA 3L29A 4LJ9A 2KEBA 2I7NA 1QDRA 4GMQA 4IBKA 2CHQA 5EXXA 2DHYA 4LGMA 3U6CA 5EP2A 2LXEA 2XGNA 3V76A 1GL7A 2LWXA 4L78A 1HT1E 2QHOB 3T15A 1XB2B 1VDLA 1TDZA 3KP0E 4FWGA 3VFDA 4B3MM 2J7NA 3BXWA 4LZJA 4QOSA 3HZJA 1QYRA 3GLHA 1R2ZA 1OTRA 1IXRC 3TWMA 2KA6B 1Q02A 1OQYA 2G5GX 4ITQA 2RGOA 4JN6A 2L4EA 2CFOA 3FYDA 2UXDM 4ZPXA 1JQJC 2QSFX 3CF2A 4NSRA 1N77A 1DO0A 2RRUA 2L7HA 3FUWA 2X49A 1WGLA 3HJQA 5ITTA 4DR1M 5DYIA 5BPVA 3KVWA 2QQ8A 4JI6M 2JZ0A 3IG5A 3KP1E 4KLNA 2W82A 2KDLA 3E21A 1J5EM 1IXSA 4AI6A 2VQFM 1Z6TA 4K0KM 2C9CA 4M0DA 3SAVA 2X4AA 4PDGA 1HNWM 3VKHA 1L1TA 3KOYE 2OOBA 2DXIA 4GIPA 2LVOC 1E94E 2JY6B 2DWMA 4LJ6A 3ZCBB 3GPUA 4GKJM 4AKGA 2Y0TA 4LGYA 2QZ4A 5ITQA 3MMPA 2F5SA 1YE9A 4MGZE 5EJCA 3ES5A 1XMOM 3LW5F 5ITXE 1GJTA 3KS8A 2ERCA 3LMMA 5KQ8A 3PNYA 1E9SA 5DFLA 4GHLA 1CUKA 4IBEA 3EIEA 4F1IA 1IN6A 3C3EA 2JXNA 3KFUG 1PJQA 1MN3A 1QAMA 1VG5A 4FCWA 4JV5M 1IM2A 2HKJA 2I7PA 4JI4M 4KODA 1TH4A 2VF7A 2YQZA 3I51A 4IBFA 3U61A 2ZANA 2XEPA 3VDUA 1A5TA 4DV6M 3K9PA 4GC5A 2QPAA 3VLFB 3UZUA 2QNJA 1G71A 2XFTA 5FLXS 2LTUA 3PXGA 3A42A 1QVRA 2LBCA 1GL6A 2X8AA 2C9OA 3FUXA 2DAGA 5EP1A 2F5OA 2HL7A 1DGBA 3CTWB 5KPTA 1L1ZA 2KNAA 4B3SM 4AW4A 2R46A 1K3WA 3Q8XA 1SXJC 2ZTCA 5ITXA 3FUTA 3C58A 1G4AE 2JA2A 4FD2A 2LNHC 4B08A 1IBLM 4WW0A 3KSJA 3NBXX 1UM8A 4B7HA 2QBYA 1Q39A 1XXHB 3HU3A 3T1HM 2R18A 1Z5BA 2Z3XA 2RGHA 2G3QA 3J80S 2FFJA 3GLIE 5KQDA 1NY5A 4B3RM 1RU3A 4MM3B 2Z4SA 3I4VA 1XMQM 4GHAA 3FTFA 4QHTA 1HQYE 5JI3E 1VEGA 4DR6M 3Q8GA 5DYGA 4RKUF 4R3DA 1H6UA 1V92A 2F4VM 4REZA 1IFYA 2DWLA 1UFZA 1G3IA 4LJAA 1R6BX 4DV2M 1ZMUA 3DZDA 2CEAA 2BJVA 3GQ4A 3GP1A 3LVWA 4LJ4A 1GKIA 4FVMA 2J7OA 3HHZA 3HHYA 4Z6YA 3F92A 4YHHM 4JI8M 2UXCM 1GVNA 3FD9A 1NY6A 4P17A 4AG6A 2UUAM 1TH3A 1R2YA 2XZFA 1BVSA 4D80A 3SASA 3U6OA 1D0MA 4DR7M 4BB9A 3GLIA 4LJ8A 4M9XA 3T38A 3GPXA 2QENA 3SYKA 3SFZA 5ITUA 4AG5A 1ZQ9A 1L8QA 4IJFA 3HY5A 3LVVA 2XFSA 4LF7M 1DGFA 3HU1A 1EIJA 3D8BA 1NNUC 1WIVA 1T3TA 2Y0QA 2R6FA 1OJLA 1DGHA 3FRIA 5ITYA 3AFHA 4FWDA 4ANRA 1IY2A 2Z7JA 4IBCA 3SMSA 2JUJA 1IY0A 1OFIA 1TR8A 4OVZB 4LY6A 2CE7A 4FCTA 1J09A 3J7AS 4JI0M 2O5RA 3SC3A 2ZAMA 2DZOB 1NVMA 2Q2EB 1J7KA 5FTKA 3CF0A 1G41A 3IECA 2YFQA 3KOXE 4L16A 2EUCA 4MB7A 3QAUA 2NQ8C 2QCUA 4X65M 3TWKA 4PDIA 2EJSA 1R4GA 2R4JA 1TGUA 4P16A 1DV0A 1LV7A 3LQRA 3DA1A 4G3OA 2Z8YM 1T6OA 4IBIA 5E6JA 5EQTA 3RGSA 3ZC7B 3ZH9B 2HWJA 3MK6A 4Y28F 3IHPA 3U60A 4LF6M 3WHLA 3UGJA 2CHVA 1ZMWA 3K1JA 4UN2B 3QYEA 5BR8M 1KFVA 2BWBA 1VEJA 3UMMA 3GLGE 5KPRA 4G4RA 4JI2M 2HAKA 3TQSA 2MH8A 4NXMM 3ZQJA 4XK8F 1FJGM 5ITRA 2JNHA 3KXEC 2N35A 1PJSA 3K9OA 4DV1M 3A98B 3CGWA 3TL4X 2VF8A 4CISA 1KSFX 5EP4A 2VQEM 2DHRA 4NRWA 5H37D 3K8ZA 3AJIB 3BBZA 3QYBA 4Q7JA 2F5NA 2M60A 4RF1A 3L2AA 2CV0A 3CF6E 5EXPA 2DKLA 3VDPA 2FE8A 4DBGB 1QUSA 8CATA 4RNAA 2C96A 3FTCA 2EO2A 2KHHA 5C18A 3U6DA 1GJSA 4HL4A 3RE8A 3GQ5A 2LHCA 4KO8A 3GLGA 3A45A 4MGHA 3B7NA 4DUYM 3KW6A 3U6SA 2GNOA 3LCVB 1MX0A 4MH0E 3GLFE 4PT5A 1V33A
chains in the Genus database with same CATH topology
1NHGC 3DOAA 3U5ZA 2L7IA 3GLHB 2LH0A 1SXJE 4MGIE 4FWHA 2KZSA 4QNMA 4JI1M 3THGA 2XZUA 2KXEA 3TE6A 3MHVC 2K47A 2OQ4A 4AZFA 4DV3M 2Z4RA 3GPPA 4G4QA 4DV7M 1DGGA 2UUBM 5DNYA 3MJ5A 4D81A 1WXQA 1D2NA 1IN7A 3AV0A 2BNKA 2D7HA 4IBDA 5FTNA 1IXSB 4LF5M 2C98A 3GRUA 1EE8A 4LF8M 3GRYA 4G4NA 2HHHM 4GKKM 3HGIA 3GLFA 4X64M 4OX9M 1QAQA 2R4EA 1SXJD 2BJWA 3NWLA 3TWLA 4DUZM 5KO3A 4DR2M 2KW0A 4IJEA 1SXJA 3M0EA 4L15A 4LZZA 3SATA 2V6ZM 2A5YB 4I5SA 4QOZC 5EXSA 3J2PB 4A3VB 1IBMM 4YY3M 4G6ZA 4XBOA 1HR0M 3GRVA 3R8FA 4OU7A 1JR3E 4JI3M 1L2BA 3U61B 1S3SA 1XC8A 5FTJA 2AHMA 1I4WA 1Z59A 3QWLA 3PFIA 4AQYM 4L8RC 1KYIA 4AKIA 3VKGA 4LF9M 3K2LA 3BGEA 1PJIA 2D7GA 1G59A 4JYAM 4DV0M 2Y20A 3W0LB 3K92A 3HHXA 1Q3CA 4WURA 4M9ZA 5LMNM 1N78A 3HJSA 3W0FA 4GRIA 2XF3A 3M6AA 4D82A 2ZM6M 3SARA 2QBYB 1IY1A 1TDHA 1JR3D 3GQ3A 4QNRA 1TH2A 1X37A 4IBGA 1QZMA 1JR3A 1K82A 1VDDA 2YNMD 2DVWB 4FW9A 1Z5AA 2L6OA 3RGPA 1NNJA 3UK6A 5IREB 2V1UA 2YR0A 2UXBM 1HT2E 1YUBA 4PCZA 1PJJA 4I8OA 3GRRA 2R45A 4NRVA 4II7A 5EP3A 5IZ7D 1NJFA 3D8LA 1MU5A 3DFZA 4B3TM 4IBJA 5A2QS 1DO2A 3AKZA 2CUZA 2OPFA 3U6LA 3TPZA 3RC3A 3GPYA 1OFHA 3FTEA 4QHSA 4LFCM 3GLIB 1N36M 1XXHE 1N32M 3J81S 3SAUA 1NSFA 2R9GA 2DWZB 4Z8XA 3RC8A 2CV2A 3U6EA 3AOEC 5IT9S 2KRKA 1XWIA 4JI7M 1DGHB 1PM5A 2FNAA 4KHPM 1QAOA 2DWNA 4CHTB 1IBKM 1E32A 4BBAA 2UU9M 4GITA 5E26A 3IG8A 2D7EA 4W5WA 5C1BA 3LQQA 4L4UA 1ORYB 4G4OA 1ZAEA 3AOEA 2C5RA 1IN8A 3FUVA 5GKNA 3ILKA 5JI2E 3T1YM 3SHGB 3KOWE 1XXHA 4JI5M 2XH9A 2F5QA 3H4MA 3KS4A 5F3WA 2V1CA 4LCBA 4OW0A 3U60B 3L25A 1W5TA 3L26A 1IQPA 1NJGA 5KPZA 1C1KA 4XGIA 3OTOM 2XLJA 3E4RA 3HHWA 4DV4M 3R9XB 2XSZD 3KDSE 4TUWA 2H1RA 2HCBA 4MGKE 2XSZA 4LRSA 2M5ZA 3J27B 1Q3BA 1IXZA 2ZBKB 2ZAOA 2G8LA 4DR5M 3VK7A 3I4YA 3FKEA 3AL0C 3L28A 4M0WA 2QW6A 5EXTA 4NXNM 4GH9A 3A46A 3SYLA 5FTLA 3BOSA 4MGYE 1XHBA 3PNVA 1L2DA 2UUCM 3E9SA 4EIWA 3FTDA 4JXJA 1HQCA 1XNQM 2F5PA 4LFAM 3CTDA 1FNNA 4R7GA 4DR3M 1NHWC 2Y21A 3J7BA 2VIIA 4LJ5A 3GLGB 5FTMA 4BLCA 3M7GA 3WHKA 1MW5A 1XNRM 2R62A 4IBBA 3EIHA 5FSWA 1QANA 1N33M 1GLNA 2C99A 3HWSA 3U5ZB 1YSYA 4B7FA 3SHFA 3U6MA 1G8PA 1R7RA 4OVZA 3JAMS 3RFWA 3HKPA 4LFBM 4DV5M 4NOOB 2KZUA 3JR4A 1N34M 3HU2A 4NL4H 4B7GA 4CGYB 3U6PA 2R65A 3B9PA 2L09A 3HJ8A 1I94M 2CV1A 3FUUA 2FOIC 5LMUM 1K3XA 4GC9A 4X62M 4LF4M 1QQWA 4HLQA 3SAWA 4M9SA 1HNZM 3GO8A 2EA0A 4IIWA 4RF0A 3PVSA 4PD2A 3SMPA 5IWAM 3GLFB 1IN5A 7CATA 3AOGA 4I81A 3FYCA 3NBIA 3VK8A 1IN4A 1SXJB 4NSOB 2E5LM 4FCVA 4I4LA 2DZNB 1N75A 2KRUA 4LG2A 3GLHE 1E9RA 4LRTA 1L2CA 4CHDA 2RKOA 3SBJA 2QP9X 4DR4M 2CHGA 4S12A 3UJNA 4LJ7A 1Z5CA 2P5TA 4X66M 4AKHA 3L27A 3KOZE 3JR5A 1W5SA 3U6QA 3KSXA 3L29A 4LJ9A 2KEBA 2I7NA 4GMQA 4IBKA 2CHQA 5EXXA 4LGMA 3U6CA 5EP2A 2LXEA 2XGNA 1GL7A 2LWXA 4L78A 1HT1E 3T15A 1TDZA 3KP0E 4FWGA 3VFDA 4B3MM 2J7NA 4LZJA 4QOSA 1QYRA 3GLHA 1R2ZA 1IXRC 3TWMA 2KA6B 2G5GX 4ITQA 2RGOA 4JN6A 3FYDA 2CFOA 2UXDM 4ZPXA 1JQJC 3CF2A 4NSRA 1N77A 1DO0A 2L7HA 3FUWA 2X49A 3HJQA 5ITTA 4DR1M 5DYIA 5BPVA 3KVWA 4JI6M 3IG5A 3KP1E 4KLNA 2W82A 1J5EM 4AI6A 2VQFM 1Z6TA 4K0KM 2C9CA 4M0DA 3SAVA 2X4AA 4PDGA 1HNWM 3VKHA 1L1TA 3KOYE 2DXIA 4GIPA 1E94E 2DWMA 4LJ6A 3ZCBB 3GPUA 4GKJM 4AKGA 2Y0TA 4LGYA 2QZ4A 5ITQA 2F5SA 1YE9A 4MGZE 5EJCA 3ES5A 1XMOM 5ITXE 3KS8A 2ERCA 3LMMA 5KQ8A 3PNYA 1E9SA 4GHLA 4IBEA 3EIEA 1IN6A 3KFUG 1QAMA 4FCWA 4JV5M 1IM2A 2HKJA 2I7PA 4JI4M 4KODA 1TH4A 2YQZA 3I51A 4IBFA 3U61A 2ZANA 2XEPA 3VDUA 1A5TA 4DV6M 4GC5A 2QPAA 3VLFB 3UZUA 2XFTA 5FLXS 3PXGA 3A42A 1QVRA 1GL6A 2X8AA 2C9OA 3FUXA 5EP1A 2F5OA 2HL7A 1DGBA 3CTWB 5KPTA 1L1ZA 4B3SM 4AW4A 2R46A 1K3WA 3Q8XA 1SXJC 5ITXA 3FUTA 3C58A 1G4AE 2JA2A 4FD2A 2LNHC 4B08A 1IBLM 4WW0A 3KSJA 1UM8A 4B7HA 2QBYA 1Q39A 3HU3A 1XXHB 3T1HM 2R18A 1Z5BA 2Z3XA 2RGHA 3J80S 2FFJA 3GLIE 5KQDA 1NY5A 4B3RM 4MM3B 2Z4SA 3I4VA 1XMQM 4GHAA 3FTFA 4QHTA 1HQYE 5JI3E 4DR6M 5DYGA 4R3DA 1H6UA 2F4VM 4REZA 2DWLA 1G3IA 4LJAA 1R6BX 4DV2M 3DZDA 2CEAA 2BJVA 3GQ4A 3GP1A 3LVWA 4LJ4A 1GKIA 4FVMA 2J7OA 3HHZA 3HHYA 4Z6YA 4YHHM 4JI8M 2UXCM 1GVNA 3FD9A 1NY6A 4AG6A 2UUAM 1TH3A 1R2YA 2XZFA 3SASA 4D80A 3U6OA 4DR7M 4BB9A 3GLIA 4LJ8A 4M9XA 3T38A 3GPXA 2QENA 3SYKA 3SFZA 5ITUA 4AG5A 1ZQ9A 1L8QA 4IJFA 3LVVA 2XFSA 4LF7M 1DGFA 3HU1A 3D8BA 1NNUC 1T3TA 2Y0QA 1OJLA 1DGHA 5ITYA 3AFHA 4FWDA 1IY2A 2Z7JA 4IBCA 3SMSA 1IY0A 1OFIA 4OVZB 4LY6A 2CE7A 4FCTA 1J09A 3J7AS 4JI0M 2O5RA 3SC3A 2ZAMA 2DZOB 1NVMA 2Q2EB 1J7KA 5FTKA 3CF0A 1G41A 2YFQA 3KOXE 4L16A 2EUCA 4MB7A 3QAUA 2NQ8C 2QCUA 4X65M 3TWKA 4PDIA 2R4JA 1TGUA 4P16A 1LV7A 3LQRA 3DA1A 3RGSA 4IBIA 3ZC7B 3ZH9B 5E6JA 5EQTA 1HNXM 4LF6M 3MK6A 3U60A 3WHLA 3UGJA 2CHVA 3K1JA 5BR8M 1KFVA 3UMMA 4JI2M 5KPRA 4G4RA 3GLGE 3TQSA 4NXMM 1FJGM 5ITRA 3KXEC 4DV1M 3A98B 3TL4X 4CISA 1KSFX 5EP4A 2VQEM 2DHRA 4NRWA 5H37D 3K8ZA 3AJIB 2F5NA 2M60A 4RF1A 3L2AA 2CV0A 3CF6E 5EXPA 3VDPA 2FE8A 8CATA 4RNAA 2C96A 3FTCA 2EO2A 3U6DA 5C18A 4HL4A 3RE8A 3GQ5A 4KO8A 3GLGA 3A45A 4MGHA 4DUYM 3U6SA 3KW6A 2GNOA 1MX0A 4MH0E 3GLFE 4PT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U60 A;  3U5Z A; 
#chains in the Genus database with same CATH topology
 1NHG C;  3DOA A;  3U5Z A;  2L7I A;  2APL A;  3GLH B;  2KNV A;  2LH0 A;  1SXJ E;  4MGI E;  4FWH A;  2KZS A;  4QNM A;  4JI1 M;  2GQF A;  3THG A;  2XZU A;  2KXE A;  2DZL A;  3TE6 A;  2WSF F;  3MHV C;  2K47 A;  1WGN A;  2OQ4 A;  4AZF A;  1LTM A;  2Z4R A;  4DV3 M;  3GPP A;  1P3Q Q;  2DAE A;  4G4Q A;  2CP8 A;  1WJ7 A;  1T43 A;  4DV7 M;  1DGG A;  2UUB M;  5DNY A;  3MJ5 A;  4D81 A;  1WXQ A;  1D2N A;  1IN7 A;  3AV0 A;  2BNK A;  2D7H A;  4IBD A;  5FTN A;  1IXS B;  3C3D A;  3W67 A;  4LF5 M;  2LVN C;  2C98 A;  3GRU A;  1ZMV A;  1EE8 A;  4LF8 M;  2CRU A;  3GRY A;  4G4N A;  2HHH M;  4GKK M;  3HGI A;  3GLF A;  4X64 M;  4OX9 M;  1QAQ A;  2R4E A;  1SXJ D;  2BJW A;  3NWL A;  3TWL A;  4DUZ M;  5KO3 A;  4DR2 M;  2KW0 A;  4IJE A;  1SXJ A;  3M0E A;  3I04 M;  4L15 A;  4LZZ A;  2V6Z M;  3SAT A;  2A5Y B;  2R0I A;  4I5S A;  4QOZ C;  2JWS A;  5EXS A;  3J2P B;  1OAO C;  4A3V B;  1IBM M;  1NV8 A;  4YY3 M;  4G6Z A;  4XBO A;  1HR0 M;  3GRV A;  2EKF A;  3R8F A;  1JR3 E;  4OU7 A;  4JI3 M;  1L2B A;  3U61 B;  1S3S A;  1XC8 A;  5FTJ A;  2AHM A;  1I4W A;  2DAK A;  1Z59 A;  3QWL A;  3T6P A;  3PFI A;  4AQY M;  4L8R C;  1KYI A;  1SG9 A;  4AKI A;  3VKG A;  4LF9 M;  3K2L A;  3BGE A;  1PJI A;  2LVQ D;  2D7G A;  1G59 A;  1AUA A;  2JP7 A;  4JYA M;  4DV0 M;  2Y20 A;  3W0L B;  2JY8 A;  3K92 A;  3HHX A;  1GO5 A;  1Q3C A;  2B3T A;  4WP2 A;  2K9D A;  4M9Z A;  4WUR A;  5LMN M;  1N78 A;  3HJS A;  3W0F A;  2K6B A;  4GRI A;  2XF3 A;  1NO1 A;  3M6A A;  4D82 A;  2ZM6 M;  3SAR A;  1HNX M;  1IY1 A;  2QBY B;  3B7Q A;  1TDH A;  1JR3 D;  3GQ3 A;  4QNR A;  1TH2 A;  1X37 A;  4IBG A;  1QZM A;  1JR3 A;  1OIP A;  1K82 A;  2LVA A;  1VDD A;  2YNM D;  2DVW B;  4FW9 A;  1Z5A A;  4GEW A;  2L6O A;  3RGP A;  2WSE F;  1EFU B;  2MRO B;  4CIZ A;  2DNA A;  3UK6 A;  5IRE B;  1NNJ A;  2V1U A;  2YR0 A;  3B89 A;  2UXB M;  1HT2 E;  1YUB A;  4PCZ A;  1PJJ A;  4I8O A;  3GRR A;  2MJ5 B;  2R45 A;  4NRV A;  4II7 A;  5EP3 A;  5IZ7 D;  1NJF A;  1OKS A;  3D8L A;  1MU5 A;  1WHC A;  3DFZ A;  2K0B X;  4B3T M;  4IBJ A;  5A2Q S;  1DO2 A;  3AKZ A;  2CUZ A;  2OPF A;  3U6L A;  3TPZ A;  3RC3 A;  2DEN A;  3GPY A;  1OFH A;  2OOA A;  3FTE A;  1QZE A;  3C9P A;  3FE3 A;  1PRB A;  4QHS A;  1R5L A;  4LFC M;  3GLI B;  1PJT A;  1N36 M;  1XXH E;  1D0L A;  2OO9 A;  3J81 S;  1N32 M;  3SAU A;  3H4J A;  1NSF A;  2L4F A;  2R9G A;  2DWZ B;  1TF0 B;  4Z8X A;  3RC8 A;  2CV2 A;  3U6E A;  3AOE C;  5IT9 S;  2JZ1 A;  2KRK A;  1XWI A;  4JI7 M;  1VEK A;  1DGH B;  1PM5 A;  4L6V 6;  2FNA A;  4KHP M;  1QAO A;  2MR9 A;  2DWN A;  4CHT B;  1IBK M;  1E32 A;  2FH0 A;  4BBA A;  2UU9 M;  2O25 A;  4GIT A;  2EKK A;  5E26 A;  3IG8 A;  2D7E A;  4W5W A;  5C1B A;  3B74 A;  2J5Y A;  3LQQ A;  2JY7 A;  4L4U A;  1ORY B;  4G4O A;  1TTE A;  1ZAE A;  3AOE A;  2C5R A;  2ZTD A;  4KT0 F;  1IN8 A;  1OIZ A;  2MGW A;  3FUV A;  5GKN A;  3ILK A;  5JI2 E;  3T1Y M;  3W68 A;  3SHG B;  2CWB A;  3KOW E;  1XXH A;  4JI5 M;  2KNZ A;  2DAM A;  2XH9 A;  2F5Q A;  2H5X A;  3B7Z A;  3H4M A;  3KS4 A;  5F3W A;  2DAI A;  1QUT A;  2V1C A;  4LCB A;  4OW0 A;  3U60 B;  3L25 A;  1MJG M;  1W5T A;  2DI0 A;  3L26 A;  1IQP A;  1NJG A;  5KPZ A;  1C1K A;  1GAB A;  1D0K A;  1C7Y A;  4XGI A;  3OTO M;  2XLJ A;  3E4R A;  3HHW A;  4DV4 M;  4NC6 A;  3R9X B;  2XSZ D;  3KDS E;  4R71 A;  2H1R A;  2HCB A;  4MGK E;  4TUW A;  2XSZ A;  1F4I A;  4LRS A;  1WR1 B;  1OAI A;  2M5Z A;  3J27 B;  1Q3B A;  1IXZ A;  2ZBK B;  1PGY A;  2ZAO A;  2G8L A;  4DR5 M;  3VK7 A;  3I4Y A;  3FKE A;  2JY5 A;  3AL0 C;  3L28 A;  4M0W A;  3LCU A;  5EXT A;  2QW6 A;  1JB0 F;  4NXN M;  4GH9 A;  3A46 A;  3SYL A;  5FTL A;  3BOS A;  4MGY E;  4CJ6 A;  2VDB B;  1XHB A;  3PNV A;  1L2D A;  2UUC M;  3E9S A;  4EIW A;  3FTD A;  1AIP C;  2FS1 A;  4JXJ A;  1HQC A;  1XNQ M;  2F5P A;  4LFA M;  3CTD A;  1FNN A;  4R7G A;  4DR3 M;  1NHW C;  2Y21 A;  3J7B A;  2VII A;  4LJ5 A;  3GLG B;  5FTM A;  4BLC A;  3M7G A;  3WHK A;  1MW5 A;  1XNR M;  2R62 A;  4IBB A;  3EIH A;  5FSW A;  1QAN A;  1N33 M;  1GLN A;  2C99 A;  3HWS A;  3U5Z B;  1YSY A;  2R44 A;  4B7F A;  3SHF A;  3U6M A;  1G8P A;  1QDT A;  1R7R A;  4OVZ A;  3JAM S;  3RFW A;  3HKP A;  4LFB M;  4DV5 M;  1NV9 A;  2KZU A;  4HEO A;  4NOO B;  3JR4 A;  1N34 M;  3HU2 A;  4NL4 H;  4B7G A;  4CGY B;  3U6P A;  2R65 A;  3B9P A;  2L09 A;  3HJ8 A;  1I94 M;  1Y8G A;  2LHG A;  3FUU A;  5L8R F;  2CV1 A;  2FOI C;  5LMU M;  1K3X A;  4GC9 A;  4X62 M;  2LVP C;  4LF4 M;  1QQW A;  2WSC F;  4HLQ A;  2L2D A;  3SAW A;  4M9S A;  2O01 F;  1HNZ M;  3GO8 A;  2EA0 A;  4IIW A;  4RF0 A;  3PVS A;  4PD2 A;  3SMP A;  4F2L A;  1VQ1 A;  5IWA M;  3GLF B;  1IN5 A;  7CAT A;  3AOG A;  4I81 A;  1ZV1 A;  3FYC A;  3NBI A;  3VK8 A;  1IN4 A;  1SXJ B;  4NSO B;  2E5L M;  3I01 M;  4FCV A;  4I4L A;  2DZN B;  1N75 A;  2KRU A;  2BWE A;  3GLH E;  1V34 A;  4LG2 A;  1E9R A;  4LRT A;  1L2C A;  4CHD A;  2RKO A;  3SBJ A;  2QP9 X;  4DR4 M;  2CHG A;  4S12 A;  3UJN A;  2WZJ A;  1Z5C A;  4LJ7 A;  2P5T A;  4X66 M;  4AKH A;  3L27 A;  3E46 A;  3KOZ E;  3HX3 A;  1W5S A;  1HJP A;  3JR5 A;  3U6Q A;  1YLA A;  3FRH A;  3KSX A;  3L29 A;  4LJ9 A;  2KEB A;  2I7N A;  1QDR A;  4GMQ A;  4IBK A;  2CHQ A;  5EXX A;  2DHY A;  4LGM A;  3U6C A;  5EP2 A;  2LXE A;  2XGN A;  3V76 A;  1GL7 A;  2LWX A;  4L78 A;  1HT1 E;  2QHO B;  3T15 A;  1XB2 B;  1VDL A;  1TDZ A;  3KP0 E;  4FWG A;  3VFD A;  4B3M M;  2J7N A;  3BXW A;  4LZJ A;  4QOS A;  3HZJ A;  1QYR A;  3GLH A;  1R2Z A;  1OTR A;  1IXR C;  3TWM A;  2KA6 B;  1Q02 A;  1OQY A;  2G5G X;  4ITQ A;  2RGO A;  4JN6 A;  2L4E A;  2CFO A;  3FYD A;  2UXD M;  4ZPX A;  1JQJ C;  2QSF X;  3CF2 A;  4NSR A;  1N77 A;  1DO0 A;  2RRU A;  2L7H A;  3FUW A;  2X49 A;  1WGL A;  3HJQ A;  5ITT A;  4DR1 M;  5DYI A;  5BPV A;  3KVW A;  2QQ8 A;  4JI6 M;  2JZ0 A;  3IG5 A;  3KP1 E;  4KLN A;  2W82 A;  2KDL A;  3E21 A;  1J5E M;  1IXS A;  4AI6 A;  2VQF M;  1Z6T A;  4K0K M;  2C9C A;  4M0D A;  3SAV A;  2X4A A;  4PDG A;  1HNW M;  3VKH A;  1L1T A;  3KOY E;  2OOB A;  2DXI A;  4GIP A;  2LVO C;  1E94 E;  2JY6 B;  2DWM A;  4LJ6 A;  3ZCB B;  3GPU A;  4GKJ M;  4AKG A;  2Y0T A;  4LGY A;  2QZ4 A;  5ITQ A;  3MMP A;  2F5S A;  1YE9 A;  4MGZ E;  5EJC A;  3ES5 A;  1XMO M;  3LW5 F;  5ITX E;  1GJT A;  3KS8 A;  2ERC A;  3LMM A;  5KQ8 A;  3PNY A;  1E9S A;  5DFL A;  4GHL A;  1CUK A;  4IBE A;  3EIE A;  4F1I A;  1IN6 A;  3C3E A;  2JXN A;  3KFU G;  1PJQ A;  1MN3 A;  1QAM A;  1VG5 A;  4FCW A;  4JV5 M;  1IM2 A;  2HKJ A;  2I7P A;  4JI4 M;  4KOD A;  1TH4 A;  2VF7 A;  2YQZ A;  3I51 A;  4IBF A;  3U61 A;  2ZAN A;  2XEP A;  3VDU A;  1A5T A;  4DV6 M;  3K9P A;  4GC5 A;  2QPA A;  3VLF B;  3UZU A;  2QNJ A;  1G71 A;  2XFT A;  5FLX S;  2LTU A;  3PXG A;  3A42 A;  1QVR A;  2LBC A;  1GL6 A;  2X8A A;  2C9O A;  3FUX A;  2DAG A;  5EP1 A;  2F5O A;  2HL7 A;  1DGB A;  3CTW B;  5KPT A;  1L1Z A;  2KNA A;  4B3S M;  4AW4 A;  2R46 A;  1K3W A;  3Q8X A;  1SXJ C;  2ZTC A;  5ITX A;  3FUT A;  3C58 A;  1G4A E;  2JA2 A;  4FD2 A;  2LNH C;  4B08 A;  1IBL M;  4WW0 A;  3KSJ A;  3NBX X;  1UM8 A;  4B7H A;  2QBY A;  1Q39 A;  1XXH B;  3HU3 A;  3T1H M;  2R18 A;  1Z5B A;  2Z3X A;  2RGH A;  2G3Q A;  3J80 S;  2FFJ A;  3GLI E;  5KQD A;  1NY5 A;  4B3R M;  1RU3 A;  4MM3 B;  2Z4S A;  3I4V A;  1XMQ M;  4GHA A;  3FTF A;  4QHT A;  1HQY E;  5JI3 E;  1VEG A;  4DR6 M;  3Q8G A;  5DYG A;  4RKU F;  4R3D A;  1H6U A;  1V92 A;  2F4V M;  4REZ A;  1IFY A;  2DWL A;  1UFZ A;  1G3I A;  4LJA A;  1R6B X;  4DV2 M;  1ZMU A;  3DZD A;  2CEA A;  2BJV A;  3GQ4 A;  3GP1 A;  3LVW A;  4LJ4 A;  1GKI A;  4FVM A;  2J7O A;  3HHZ A;  3HHY A;  4Z6Y A;  3F92 A;  4YHH M;  4JI8 M;  2UXC M;  1GVN A;  3FD9 A;  1NY6 A;  4P17 A;  4AG6 A;  2UUA M;  1TH3 A;  1R2Y A;  2XZF A;  1BVS A;  4D80 A;  3SAS A;  3U6O A;  1D0M A;  4DR7 M;  4BB9 A;  3GLI A;  4LJ8 A;  4M9X A;  3T38 A;  3GPX A;  2QEN A;  3SYK A;  3SFZ A;  5ITU A;  4AG5 A;  1ZQ9 A;  1L8Q A;  4IJF A;  3HY5 A;  3LVV A;  2XFS A;  4LF7 M;  1DGF A;  3HU1 A;  1EIJ A;  3D8B A;  1NNU C;  1WIV A;  1T3T A;  2Y0Q A;  2R6F A;  1OJL A;  1DGH A;  3FRI A;  5ITY A;  3AFH A;  4FWD A;  4ANR A;  1IY2 A;  2Z7J A;  4IBC A;  3SMS A;  2JUJ A;  1IY0 A;  1OFI A;  1TR8 A;  4OVZ B;  4LY6 A;  2CE7 A;  4FCT A;  1J09 A;  3J7A S;  4JI0 M;  2O5R A;  3SC3 A;  2ZAM A;  2DZO B;  1NVM A;  2Q2E B;  1J7K A;  5FTK A;  3CF0 A;  1G41 A;  3IEC A;  2YFQ A;  3KOX E;  4L16 A;  2EUC A;  4MB7 A;  3QAU A;  2NQ8 C;  2QCU A;  4X65 M;  3TWK A;  4PDI A;  2EJS A;  1R4G A;  2R4J A;  1TGU A;  4P16 A;  1DV0 A;  1LV7 A;  3LQR A;  3DA1 A;  4G3O A;  2Z8Y M;  1T6O A;  4IBI A;  5E6J A;  5EQT A;  3RGS A;  3ZC7 B;  3ZH9 B;  2HWJ A;  3MK6 A;  4Y28 F;  3IHP A;  3U60 A;  4LF6 M;  3WHL A;  3UGJ A;  2CHV A;  1ZMW A;  3K1J A;  4UN2 B;  3QYE A;  5BR8 M;  1KFV A;  2BWB A;  1VEJ A;  3UMM A;  3GLG E;  5KPR A;  4G4R A;  4JI2 M;  2HAK A;  3TQS A;  2MH8 A;  4NXM M;  3ZQJ A;  4XK8 F;  1FJG M;  5ITR A;  2JNH A;  3KXE C;  2N35 A;  1PJS A;  3K9O A;  4DV1 M;  3A98 B;  3CGW A;  3TL4 X;  2VF8 A;  4CIS A;  1KSF X;  5EP4 A;  2VQE M;  2DHR A;  4NRW A;  5H37 D;  3K8Z A;  3AJI B;  3BBZ A;  3QYB A;  4Q7J A;  2F5N A;  2M60 A;  4RF1 A;  3L2A A;  2CV0 A;  3CF6 E;  5EXP A;  2DKL A;  3VDP A;  2FE8 A;  4DBG B;  1QUS A;  8CAT A;  4RNA A;  2C96 A;  3FTC A;  2EO2 A;  2KHH A;  5C18 A;  3U6D A;  1GJS A;  4HL4 A;  3RE8 A;  3GQ5 A;  2LHC A;  4KO8 A;  3GLG A;  3A45 A;  4MGH A;  3B7N A;  4DUY M;  3KW6 A;  3U6S A;  2GNO A;  3LCV B;  1MX0 A;  4MH0 E;  3GLF E;  4PT5 A;  1V33 A; 
#chains in the Genus database with same CATH homology
 1NHG C;  3DOA A;  3U5Z A;  2L7I A;  3GLH B;  2LH0 A;  1SXJ E;  4MGI E;  4FWH A;  2KZS A;  4QNM A;  4JI1 M;  3THG A;  2XZU A;  2KXE A;  3TE6 A;  3MHV C;  2K47 A;  2OQ4 A;  4AZF A;  4DV3 M;  2Z4R A;  3GPP A;  4G4Q A;  4DV7 M;  1DGG A;  2UUB M;  5DNY A;  3MJ5 A;  4D81 A;  1WXQ A;  1D2N A;  1IN7 A;  3AV0 A;  2BNK A;  2D7H A;  4IBD A;  5FTN A;  1IXS B;  4LF5 M;  2C98 A;  3GRU A;  1EE8 A;  4LF8 M;  3GRY A;  4G4N A;  2HHH M;  4GKK M;  3HGI A;  3GLF A;  4X64 M;  4OX9 M;  1QAQ A;  2R4E A;  1SXJ D;  2BJW A;  3NWL A;  3TWL A;  4DUZ M;  5KO3 A;  4DR2 M;  2KW0 A;  4IJE A;  1SXJ A;  3M0E A;  4L15 A;  4LZZ A;  3SAT A;  2V6Z M;  2A5Y B;  4I5S A;  4QOZ C;  5EXS A;  3J2P B;  4A3V B;  1IBM M;  4YY3 M;  4G6Z A;  4XBO A;  1HR0 M;  3GRV A;  3R8F A;  4OU7 A;  1JR3 E;  4JI3 M;  1L2B A;  3U61 B;  1S3S A;  1XC8 A;  5FTJ A;  2AHM A;  1I4W A;  1Z59 A;  3QWL A;  3PFI A;  4AQY M;  4L8R C;  1KYI A;  4AKI A;  3VKG A;  4LF9 M;  3K2L A;  3BGE A;  1PJI A;  2D7G A;  1G59 A;  4JYA M;  4DV0 M;  2Y20 A;  3W0L B;  3K92 A;  3HHX A;  1Q3C A;  4WUR A;  4M9Z A;  5LMN M;  1N78 A;  3HJS A;  3W0F A;  4GRI A;  2XF3 A;  3M6A A;  4D82 A;  2ZM6 M;  3SAR A;  2QBY B;  1IY1 A;  1TDH A;  1JR3 D;  3GQ3 A;  4QNR A;  1TH2 A;  1X37 A;  4IBG A;  1QZM A;  1JR3 A;  1K82 A;  1VDD A;  2YNM D;  2DVW B;  4FW9 A;  1Z5A A;  2L6O A;  3RGP A;  1NNJ A;  3UK6 A;  5IRE B;  2V1U A;  2YR0 A;  2UXB M;  1HT2 E;  1YUB A;  4PCZ A;  1PJJ A;  4I8O A;  3GRR A;  2R45 A;  4NRV A;  4II7 A;  5EP3 A;  5IZ7 D;  1NJF A;  3D8L A;  1MU5 A;  3DFZ A;  4B3T M;  4IBJ A;  5A2Q S;  1DO2 A;  3AKZ A;  2CUZ A;  2OPF A;  3U6L A;  3TPZ A;  3RC3 A;  3GPY A;  1OFH A;  3FTE A;  4QHS A;  4LFC M;  3GLI B;  1N36 M;  1XXH E;  1N32 M;  3J81 S;  3SAU A;  1NSF A;  2R9G A;  2DWZ B;  4Z8X A;  3RC8 A;  2CV2 A;  3U6E A;  3AOE C;  5IT9 S;  2KRK A;  1XWI A;  4JI7 M;  1DGH B;  1PM5 A;  2FNA A;  4KHP M;  1QAO A;  2DWN A;  4CHT B;  1IBK M;  1E32 A;  4BBA A;  2UU9 M;  4GIT A;  5E26 A;  3IG8 A;  2D7E A;  4W5W A;  5C1B A;  3LQQ A;  4L4U A;  1ORY B;  4G4O A;  1ZAE A;  3AOE A;  2C5R A;  1IN8 A;  3FUV A;  5GKN A;  3ILK A;  5JI2 E;  3T1Y M;  3SHG B;  3KOW E;  1XXH A;  4JI5 M;  2XH9 A;  2F5Q A;  3H4M A;  3KS4 A;  5F3W A;  2V1C A;  4LCB A;  4OW0 A;  3U60 B;  3L25 A;  1W5T A;  3L26 A;  1IQP A;  1NJG A;  5KPZ A;  1C1K A;  4XGI A;  3OTO M;  2XLJ A;  3E4R A;  3HHW A;  4DV4 M;  3R9X B;  2XSZ D;  3KDS E;  4TUW A;  2H1R A;  2HCB A;  4MGK E;  2XSZ A;  4LRS A;  2M5Z A;  3J27 B;  1Q3B A;  1IXZ A;  2ZBK B;  2ZAO A;  2G8L A;  4DR5 M;  3VK7 A;  3I4Y A;  3FKE A;  3AL0 C;  3L28 A;  4M0W A;  2QW6 A;  5EXT A;  4NXN M;  4GH9 A;  3A46 A;  3SYL A;  5FTL A;  3BOS A;  4MGY E;  1XHB A;  3PNV A;  1L2D A;  2UUC M;  3E9S A;  4EIW A;  3FTD A;  4JXJ A;  1HQC A;  1XNQ M;  2F5P A;  4LFA M;  3CTD A;  1FNN A;  4R7G A;  4DR3 M;  1NHW C;  2Y21 A;  3J7B A;  2VII A;  4LJ5 A;  3GLG B;  5FTM A;  4BLC A;  3M7G A;  3WHK A;  1MW5 A;  1XNR M;  2R62 A;  4IBB A;  3EIH A;  5FSW A;  1QAN A;  1N33 M;  1GLN A;  2C99 A;  3HWS A;  3U5Z B;  1YSY A;  4B7F A;  3SHF A;  3U6M A;  1G8P A;  1R7R A;  4OVZ A;  3JAM S;  3RFW A;  3HKP A;  4LFB M;  4DV5 M;  4NOO B;  2KZU A;  3JR4 A;  1N34 M;  3HU2 A;  4NL4 H;  4B7G A;  4CGY B;  3U6P A;  2R65 A;  3B9P A;  2L09 A;  3HJ8 A;  1I94 M;  2CV1 A;  3FUU A;  2FOI C;  5LMU M;  1K3X A;  4GC9 A;  4X62 M;  4LF4 M;  1QQW A;  4HLQ A;  3SAW A;  4M9S A;  1HNZ M;  3GO8 A;  2EA0 A;  4IIW A;  4RF0 A;  3PVS A;  4PD2 A;  3SMP A;  5IWA M;  3GLF B;  1IN5 A;  7CAT A;  3AOG A;  4I81 A;  3FYC A;  3NBI A;  3VK8 A;  1IN4 A;  1SXJ B;  4NSO B;  2E5L M;  4FCV A;  4I4L A;  2DZN B;  1N75 A;  2KRU A;  4LG2 A;  3GLH E;  1E9R A;  4LRT A;  1L2C A;  4CHD A;  2RKO A;  3SBJ A;  2QP9 X;  4DR4 M;  2CHG A;  4S12 A;  3UJN A;  4LJ7 A;  1Z5C A;  2P5T A;  4X66 M;  4AKH A;  3L27 A;  3KOZ E;  3JR5 A;  1W5S A;  3U6Q A;  3KSX A;  3L29 A;  4LJ9 A;  2KEB A;  2I7N A;  4GMQ A;  4IBK A;  2CHQ A;  5EXX A;  4LGM A;  3U6C A;  5EP2 A;  2LXE A;  2XGN A;  1GL7 A;  2LWX A;  4L78 A;  1HT1 E;  3T15 A;  1TDZ A;  3KP0 E;  4FWG A;  3VFD A;  4B3M M;  2J7N A;  4LZJ A;  4QOS A;  1QYR A;  3GLH A;  1R2Z A;  1IXR C;  3TWM A;  2KA6 B;  2G5G X;  4ITQ A;  2RGO A;  4JN6 A;  3FYD A;  2CFO A;  2UXD M;  4ZPX A;  1JQJ C;  3CF2 A;  4NSR A;  1N77 A;  1DO0 A;  2L7H A;  3FUW A;  2X49 A;  3HJQ A;  5ITT A;  4DR1 M;  5DYI A;  5BPV A;  3KVW A;  4JI6 M;  3IG5 A;  3KP1 E;  4KLN A;  2W82 A;  1J5E M;  4AI6 A;  2VQF M;  1Z6T A;  4K0K M;  2C9C A;  4M0D A;  3SAV A;  2X4A A;  4PDG A;  1HNW M;  3VKH A;  1L1T A;  3KOY E;  2DXI A;  4GIP A;  1E94 E;  2DWM A;  4LJ6 A;  3ZCB B;  3GPU A;  4GKJ M;  4AKG A;  2Y0T A;  4LGY A;  2QZ4 A;  5ITQ A;  2F5S A;  1YE9 A;  4MGZ E;  5EJC A;  3ES5 A;  1XMO M;  5ITX E;  3KS8 A;  2ERC A;  3LMM A;  5KQ8 A;  3PNY A;  1E9S A;  4GHL A;  4IBE A;  3EIE A;  1IN6 A;  3KFU G;  1QAM A;  4FCW A;  4JV5 M;  1IM2 A;  2HKJ A;  2I7P A;  4JI4 M;  4KOD A;  1TH4 A;  2YQZ A;  3I51 A;  4IBF A;  3U61 A;  2ZAN A;  2XEP A;  3VDU A;  1A5T A;  4DV6 M;  4GC5 A;  2QPA A;  3VLF B;  3UZU A;  2XFT A;  5FLX S;  3PXG A;  3A42 A;  1QVR A;  1GL6 A;  2X8A A;  2C9O A;  3FUX A;  5EP1 A;  2F5O A;  2HL7 A;  1DGB A;  3CTW B;  5KPT A;  1L1Z A;  4B3S M;  4AW4 A;  2R46 A;  1K3W A;  3Q8X A;  1SXJ C;  5ITX A;  3FUT A;  3C58 A;  1G4A E;  2JA2 A;  4FD2 A;  2LNH C;  4B08 A;  1IBL M;  4WW0 A;  3KSJ A;  1UM8 A;  4B7H A;  2QBY A;  1Q39 A;  3HU3 A;  1XXH B;  3T1H M;  2R18 A;  1Z5B A;  2Z3X A;  2RGH A;  3J80 S;  2FFJ A;  3GLI E;  5KQD A;  1NY5 A;  4B3R M;  4MM3 B;  2Z4S A;  3I4V A;  1XMQ M;  4GHA A;  3FTF A;  4QHT A;  1HQY E;  5JI3 E;  4DR6 M;  5DYG A;  4R3D A;  1H6U A;  2F4V M;  4REZ A;  2DWL A;  1G3I A;  4LJA A;  1R6B X;  4DV2 M;  3DZD A;  2CEA A;  2BJV A;  3GQ4 A;  3GP1 A;  3LVW A;  4LJ4 A;  1GKI A;  4FVM A;  2J7O A;  3HHZ A;  3HHY A;  4Z6Y A;  4YHH M;  4JI8 M;  2UXC M;  1GVN A;  3FD9 A;  1NY6 A;  4AG6 A;  2UUA M;  1TH3 A;  1R2Y A;  2XZF A;  3SAS A;  4D80 A;  3U6O A;  4DR7 M;  4BB9 A;  3GLI A;  4LJ8 A;  4M9X A;  3T38 A;  3GPX A;  2QEN A;  3SYK A;  3SFZ A;  5ITU A;  4AG5 A;  1ZQ9 A;  1L8Q A;  4IJF A;  3LVV A;  2XFS A;  4LF7 M;  1DGF A;  3HU1 A;  3D8B A;  1NNU C;  1T3T A;  2Y0Q A;  1OJL A;  1DGH A;  5ITY A;  3AFH A;  4FWD A;  1IY2 A;  2Z7J A;  4IBC A;  3SMS A;  1IY0 A;  1OFI A;  4OVZ B;  4LY6 A;  2CE7 A;  4FCT A;  1J09 A;  3J7A S;  4JI0 M;  2O5R A;  3SC3 A;  2ZAM A;  2DZO B;  1NVM A;  2Q2E B;  1J7K A;  5FTK A;  3CF0 A;  1G41 A;  2YFQ A;  3KOX E;  4L16 A;  2EUC A;  4MB7 A;  3QAU A;  2NQ8 C;  2QCU A;  4X65 M;  3TWK A;  4PDI A;  2R4J A;  1TGU A;  4P16 A;  1LV7 A;  3LQR A;  3DA1 A;  3RGS A;  4IBI A;  3ZC7 B;  3ZH9 B;  5E6J A;  5EQT A;  1HNX M;  4LF6 M;  3MK6 A;  3U60 A;  3WHL A;  3UGJ A;  2CHV A;  3K1J A;  5BR8 M;  1KFV A;  3UMM A;  4JI2 M;  5KPR A;  4G4R A;  3GLG E;  3TQS A;  4NXM M;  1FJG M;  5ITR A;  3KXE C;  4DV1 M;  3A98 B;  3TL4 X;  4CIS A;  1KSF X;  5EP4 A;  2VQE M;  2DHR A;  4NRW A;  5H37 D;  3K8Z A;  3AJI B;  2F5N A;  2M60 A;  4RF1 A;  3L2A A;  2CV0 A;  3CF6 E;  5EXP A;  3VDP A;  2FE8 A;  8CAT A;  4RNA A;  2C96 A;  3FTC A;  2EO2 A;  3U6D A;  5C18 A;  4HL4 A;  3RE8 A;  3GQ5 A;  4KO8 A;  3GLG A;  3A45 A;  4MGH A;  4DUY M;  3U6S A;  3KW6 A;  2GNO A;  1MX0 A;  4MH0 E;  3GLF E;  4PT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...