3U61B

Structure of t4 bacteriophage clamp loader bound to closed clamp, dna and atp analog and adp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
305
Chain Sequence
ITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 95
structure length 305
sequence length 317
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u61B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u61B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u61B01
3NEJA 2R6DA 1E4YA 1G19A 2OCPA 3E2IA 1HYQA 4Q9IA 1Z07A 2YWGA 2ZEJA 1ETUA 1KK1A 1KJZA 2IYRA 4AYWA 1OIXA 5L3SB 1GKIA 1CKEA 2ZR9A 2P65A 1Z6GA 2GZDA 1CJMA 2WPDD 4TYPA 5CITA 2RHDA 4P4SB 5G41A 5L8VA 1S1CA 2GKSA 3OEHD 4YXWD 4KU4A 1KO8A 2JDIA 4ERNA 3W9YA 1J8YF 3CRQA 4Q9KA 2V9PA 4GBMA 4GMXA 3ONWA 2X2EA 5KU1A 4C9BA 1G8HA 4UJ3A 1J99A 4LJ4A 4NPHA 1X1SA 3A1WA 2CHQA 3SFZA 3F5FA 2GILA 1MT0A 2Q9AA 2WIAA 2Z6VA 4V03A 3PIRA 5KHOC 1SVWA 3ICQB 1BKDR 2VH5R 2WWWA 4B2LA 3K0AA 4US2R 5B57C 2XB4A 1TQ2A 3PUWA 3B2EA 4R98A 3FPAA 1TQ4A 2NO6A 2RH5A 3KFVA 4A2WA 1XJQA 4MA4A 1X8KA 3EA0A 3THOA 5KNBA 2YVUA 4MGIR 4XVRA 3VU9A 1D8TA 3PEUA 3QPVA 4LHWA 5C18A 1FX0A 4PPQA 2ONJA 4DSUA 4ZDIA 1A7JA 4NL4H 3NIBA 3E5HA 1SXJA 2G9NA 3RS7A 3W3AA 1KTVA 1Z8FA 2H16A 2JJ1D 4LV6A 1L7VC 2F3RA 2ZRPA 1GL9B 1NL3A 4M4SA 521PA 3I5XA 2UKDA 1YQTA 1U94A 2GCPA 4LY6A 1YKSA 3AVVA 4JLMA 1DAHA 2WHXA 3UG6A 3THXA 4KSCA 3EWSA 3K1JA 3KKMA 1ZC4A 3PXGA 4P4SA 4B43A 2VRWA 3UMFA 3F3YA 2DWQA 2DCUA 4JKIA 3WY9A 3A1SA 3NHAA 3TSWA 1KSGA 3IQXA 4NCKA 3T34A 2EFCB 2PBRA 2A5JA 1XRJA 2IEYA 2DZOB 4RZ2A 1G8FA 1SVSA 1XEWY 2FPMA 2GXQA 5SZIA 2FN4A 1T4GA 3AEZA 1E2EA 2P3SA 3CF6R 1JEEA 2J0QA 4DVGA 1H8HD 5AK0A 3TQCA 2Z4SA 1WRBA 5FFMA 3CX6A 3KJEA 4ZCLA 1IONA 2XX3A 3MWJA 1TPZA 2AD5A 4PHFA 4CW7A 2WKQA 4B34A 4TYWA 4W5HA 5J5CA 1J2JA 4RKFA 1W2HA 1U98A 4XTCS 3PG5A 2PCJA 2QTFA 4QNRA 1SXJE 3D3QA 4JLNA 2FFHA 3EC2A 1ZC3A 1Q0UA 5EXTA 1RW4A 2HYDA 4Z1MD 4TTQA 1U0JA 1M7GA 3U60B 1G7TA 5EXSA 4NZYA 2AFHE 1OFUX 2AK3A 1E1RA 4XWKA 1Z08A 4JKYA 4OI4A 2ZYUX 3M0EA 2OLKA 4X8LA 1P61B 2DFNA 4IVPA 4OQMA 4BLTA 4HATA 2QTVB 1HE8B 3W90A 2GA8A 4BLSA 4NKRA 4FD2A 3VFDA 2ZIAA 3OE7D 5DHFA 3AB3A 3TKLA 1K6MA 4MYCA 3UPUA 2L0XA 2ANCA 1LB1B 3A58B 2JIZD 4RD4A 3W5IA 2ZI6A 2FSFA 1ZRHA 1B0UA 4GI7A 1IY1A 1QVRA 3FHTA 1XTJA 1XEWX 1E9RA 1Q57A 1VIYA 5FPTA 1F48A 2MSCB 5B30A 1WP9A 3QF4B 4S2EA 2H5EA 3HU2A 4KVAA 2RGBA 3BGWA 4DKXA 1G9XA 5E7IA 2KRKA 1XNJA 3SJBA 3L2OB 4LJ9A 3ASZA 1NSTA 3AKCA 2ZRAA 3RYTC 1L4YA 3DZ8A 2XXAA 1UKYA 2A30A 4Q47A 4XSGA 3K0SA 1TMKA 4TZ0A 2RHMA 1KI9A 2JATA 2GVDC 4M1WA 5SZHB 3KJIA 3RANA 4FCTA 4C3ZA 5FTJA 1ZYUA 3NH6A 4PANA 3NXSA 2C99A 1RFLA 1VPLA 3QKRB 3LH5A 3LBNA 1NJFA 2IYQA 3GJ8A 4OBEA 2ZJBA 3FKSA 1J8MF 4QGFA 3T1QA 3LQRA 4M9SA 1AS2A 4OQFA 2YC2C 1YE8A 1DELA 1W44A 2IWRA 4TSFD 2J0UB 4R71A 4O2LA 5FPYA 2J46A 4YMSA 3RAPR 3AVPA 3HWSA 3TAUA 2X1VA 1W5TA 1NBMD 3B1ZA 4CEIA 4M21A 1G5PA 3BFXA 2QRNA 3EXAA 4EKDA 2ZR7A 2OE2A 5K8LA 3B85A 3C8UA 3QF4A 3FHCB 4M1MA 5FR2A 2FU5C 1QBKC 3ND8A 4OQXA 2DWOA 3SYLA 4QJ5A 2EFGA 1XX6A 2V3CC 2GBLC 4LBYA 4MKIA 2GWHA 2O0HA 4IRUB 4LRWA 3IBGA 4X8HA 3SE0A 5FTLA 2JEOA 2JJ1A 4NYJR 3BJIC 3NTUA 1HV8A 2ZYVX 1KO7A 4Q4AA 4DDTA 5GADl 3P32A 1YZGA 3TUIC 5B58C 2OM2A 2IX3A 4OHYA 3LNCA 1AIPA 2RGGA 2QNRA 4NBSA 2G1KA 4YC7A 4GOXA 2KI5A 2AXNA 4TT3D 1ZU5A 1ZBDA 4GRAA 3KQUA 3NDPA 1J90A 3T12A 4IXMA 3GJXC 2OBNA 3QKRA 5KOYA 1Q12A 4Q5IA 3OZXA 1MABB 1F5NA 3UXMA 1W36B 1KSJA 4NYIR 3RDPA 1E96A 3QUSA 1OFIA 4HB0A 5G40A 5JWRA 4HB3A 2IYYA 5C2JB 2QRZA 4PC6A 5JEEA 3NBXX 1A2KC 1VYTA 3I61A 3WBKA 4LOAA 4KFSA 1GWNA 1XFAA 1E0KA 1H8HA 4D4LA 4YLGA 4GDFA 1JNYA 5IF9A 2ONKA 1AM4D 2JLUA 3MGCA 3SEAA 2CCGA 4QJ3A 1S0UA 3T1VA 2FE4A 4BECA 2IYVA 1A4RA 1M74A 4WAUA 3HP1A 3CKLA 3RRNA 3VX3A 5EXPA 1P6XA 3B6EA 4Q9JA 1AS3A 4R2IA 4R2HA 4CEJB 1AKYA 2IT1A 5FOUA 4G5OA 2F3TA 3ZLJA 4JLJA 1PZNA 1IAQA 4CGZA 3CH5A 3A4MA 3AKDA 1M1YE 4FN5A 3TE6A 2ZETA 2QBYB 1KDTA 3GEHA 3LFUA 3HU3A 1NVVQ 2PCLA 3VR2A 2XAUA 3D7MA 1FZQA 1Z0IA 3CZPA 1MABA 1GITA 3I5YA 2Q9BA 3K0CA 3TSOA 1Z6YA 1G3RA 3FMFA 2QTHA 3O8BA 2ZRCA 1Z0AA 4DDVA 4OK6A 2D06A 3KZ1E 3OE7A 1XCMA 1BOFA 2Q3MA 4V02A 1S4QA 4QBHA 4ON9A 5JHGB 2QP3A 1T9HA 4HDOB 1NY5A 4MGKR 5AUPB 1KI8A 3P1JA 3VNUA 4CVNA 1SQ5A 2DFKB 2AK2A 2IF0A 1OB2A 3RS2A 4ZPXA 5DIFA 2FEMA 3OFND 2Z0MA 1FW6A 3SQWA 2ASEA 4TLDA 4EJSC 1OYYA 2I4IA 1KAGA 1CP2A 1R5BA 4P32A 1XCGB 1X8JA 621PA 3IEVA 1VG8A 2QL6A 4MYHA 5FOXA 5IHPA 3PQCA 1HQYE 4M9XA 4B44A 3P20A 3MAAC 2PZFA 3N2IA 4L5BA 4QHTA 1VYVA 2PLRA 3KB1A 3ND9A 1M8PA 3GJ5A 3RSLA 5IT5A 2OFXA 1SGWA 4CEJA 2ZJAA 3BFKA 1XU4A 2W00A 2ZE8A 4B48A 3L0SA 5FH9A 3HPQA 3I73A 3DL0A 4IW3B 1LVGA 3MJHA 2BJVA 4R7ZA 2IK8A 4M8NE 1M7HA 4MUBA 1KMHA 2AN9A 4TYYA 2C9OA 1ZUIA 4JLPA 1IQPA 2QBYA 2XNSA 1H8ED 2REBA 3O47A 4KJZA 2ZR0A 5B2ZA 3AH8A 4CT4B 1P2UA 3L0PA 3CR8A 1DG3A 1CJKC 1G7SA 1T3HA 3RS3A 4GFDA 4ITRC 3JZAA 4PO9A 2QEQA 3P27A 1T0HB 1G3UA 4TSFA 5LPNA 1RC8A 3C16C 3FTQA 4KLZA 2Q3FA 1PJRA 3WNCA 3PEWA 3K70D 2QE7D 1VCIA 3B1YA 2JLZA 1FNMA 1NBMA 4K81B 4DSOA 3E1SA 4F93B 4W5WA 4ARZA 5JWOA 3N70A 5KPJA 3I4LA 5FTMA 1TNDA 2NIPA 3DOFA 3ASYA 4B35A 2EYQA 2ZYTX 1S2MA 1WXQA 3O8RA 4LJAA 1X6VA 4D25A 1AA9A 1VCMA 2P0EA 2EWWA 4F4JA 3HU1A 1EXMA 1E2NA 4TZ6A 2HYIC 2YWHA 4EAQA 2C77A 1W46A 1J7KA 4RD6A 3QSYA 1NY6A 1DO2A 1OT3A 3B9QA 1ZCBA 3QXCA 2ZS9A 4FWIB 4TT3A 2NG1A 2WAXA 2GZAA 2P67A 4URYR 3SN6A 4I1OA 1OPXA 5HKKA 4FWTA 2VP9A 3A6PC 1COWD 1JBKA 4EFMA 4HAVA 3K9GA 2QN6A 4LZZA 2QMHA 3KL4A 4Q4JB 4ZI2A 2UZ3A 4A6PA 4A2PA 3W6NA 3ZJYA 2D62A 3I3SR 1NSFA 3OAAD 1NRJB 1XZQA 4DLVA 2A7QA 2FJUA 1W4RA 3NHBA 2CL0X 2HLDD 1NN1A 5CYPA 1E2JA 2ZSDA 3RNLA 3NH9A 4D0LB 4FMBB 1YU9A 3ADBA 1LNZA 1NBME 2IF2A 4LBWA 1PLLA 1OF1A 3CX7A 3MUFA 3RC8A 4TYQA 1KIMA 2AHOA 2BKUA 1I4DD 1S96A 4M1KA 1Z2AA 4RCYA 2GAAA 2ATVA 2BMDA 1GNPA 4H9GA 2YV5A 4A0HA 3WYGA 5CDFE 4LK2A 3U3MA 5TY0A 2F1HA 2FH5B 2YZ2A 3TK1A 1OH6A 2J0SA 1DE0A 3O8CA 2CL6X 3QKTA 2KBFA 2GXSA 4KXFB 3S1AB 4DLRA 3Q7QA 2H17A 3R8FA 1JQLB 4ZO4A 1XWIA 1L4UA 3RLFA 2OHFA 2WAYA 2NMVA 5JSZB 4EPTA 3CLVA 4L15A 4F4IA 2ZREA 3IHWA 5FI1B 2V6ZM 4F92B 5HZHA 4TMZA 4Q21A 1RRCA 3CBQA 4N0DA 2D2EA 2XOKD 2JDID 3GEIA 3IQWA 1D5CA 2ZI3A 1G8GA 3TLXA 1MV5A 4Q4JA 5E3HA 3KW6A 2K5UA 4Q01A 5M04A 4IEEA 3L8ZA 3N5CA 5FL7D 3RHFA 2JGNA 3K70B 1VCOA 5JCZA 2HCJB 3CPHA 1YR7A 3C41J 1F60A 2FPLA 4U02A 5CM9C 4HLCA 3Q5DA 4BLRA 3CONA 1D6JA 2C96A 2BCJQ 4Q7KA 2Z4RA 2F1RA 1KO1A 2IUTA 4IVQA 1R0WA 3OFNA 5JMTA 4IOJA 4NYMR 2YKGA 5FTNA 4JSTA 2OCAA 1BMFD 2QMOA 4JVSB 5CK4A 1E98A 1N0UA 1ZM7A 2OEPA 2VP6A 4HAZA 2OCYC 4AKGA 1EX6A 1G21E 4M9QA 5SZKB 1RE0A 1YZNA 4QG7A 4HAYA 3CH4B 3ZD6A 2A5YB 3KKOA 4RZXA 3EWAA 2JLXA 4FMCF 4M9ZA 2GCNA 3NBYC 3S1AA 2V7QA 2CVHA 4PC7A 4RKEA 1MO5A 5FI0B 2OFWA 2Z43A 1OH5A 3W6OA 4TTPA 5DYIA 4P4UA 4L9SA 2G83A 3KTAB 4MKHA 2W0MA 4M0LA 5JSZA 3WXMA 1RKBA 3PUVA 4Q19A 1H65A 2O8FB 2FPKA 2RB4A 4OK3A 3A1UA 1OFHA 3PUZA 4G3XA 4KFRA 1PLKA 1TAGA 3QVVA 3CB4A 2ZE5A 2AWNA 4A8JA 4PSVA 3SJCA 3KUCA 5TVKA 4BE7B 3ZQJA 5JI3E 2BHRA 2D2FA 4DIEA 2WICA 4E03A 1MO4A 1KJYA 3V4RA 1SXJC 3MMPA 4A1FA 1DAEA 3WRXC 4LC0A 4B2IA 2WJJA 1DOAA 3WMEA 2V1XA 4A3VB 2GCOB 1FOEB 4TLAA 2V4ZA 2HV8A 2XZOA 1XD9A 1IBRA 4HAWA 4DCNA 3VNVA 4LHXA 1DADA 4E07A 5K8UA 4LYHA 3SR0A 5E7JA 3X1WA 2PJRA 3C5CA 4JL5A 2IYWA 3B5JA 2IYTA 1FL9A 1GAJA 1UBFA 4AC9A 1QG4A 1RRFA 4PPFA 3QIAA 5J40A 2B6HA 3SJAA 4BFZA 1YR6A 2PH1A 4HDCA 1X37A 1VYUA 4POAA 5G53C 2GTPA 2XEXA 3KTAA 1N5IA 2OXCA 1NP6A 1P75A 2H92A 4US0R 3GLHB 3FMOB 4NCJA 4G5GA 2O8FA 1ONBA 1R0ZA 3GLIA 2F1IA 4OYHA 4Y0VA 2PZGA 3R8CA 1KK0A 3BXZA 1P3JA 5LB4A 2ZVQX 3EA5A 1ESMA 2ATXA 4B33A 4Q03A 4RJLA 4TL7A 3AF4A 4GNKA 4QOSA 1KNQA 1HA3A 3MRSA 4B2PA 4LUCA 3VR6A 1HTWA 2J87A 1AKEA 3EZ2A 1EG7A 4RFSA 4AG5A 3ZQ6A 1UBEA 3CTDA 2REXB 3T1TA 1OE0A 4F91B 3M1IA 5TV2A 1LF0A 3T61A 3ZVMA 4LV5B 3THYB 2O0KA 3FWYA 1KYIA 3GJ7A 2QMUA 5A4JA 1HH4A 1QHIA 3QPUA 2UVQA 5BW8A 2GCOA 5HR5A 1FUKA 5K8TA 2BCGY 2VTKA 4GITA 2ODNA 4GT1A 4II7A 4W5JA 3U2QA 2H1LA 3NEYA 2FZLA 2QORA 4Z51A 4Q4LA 4OKSA 4G1UC 5A5GA 5DN6D 1TTTA 4Y0AA 1XBTA 1E0SA 5JZVA 2G88A 1ZIOA 4EDHA 2HUPA 4GP6A 2YJTD 2ZRKA 4Z8YA 3KQHA 2ZSEA 4XD7D 3AVOA 3R20A 4FW9A 4EPYA 2P6NA 4C0BA 1P2TA 3FFBA 2ZRJA 2ZRNA 1SVIA 2XOKA 3H2YA 1E9DA 4O0MA 3GLHA 3GLIE 1F2UB 2QP4A 1ZM2A 3FKSD 2G0NA 4QRHA 4TMTA 2CLSA 1XPOA 2IA5A 1UEJA 2XTZA 3BB4A 5JJLA 4BZQA 5AR1A 1WE2A 2W58A 1N6PA 5KTYA 5EP1A 3WP1B 3EAQA 2DWZB 5FL7A 2BEKA 5CJPA 3V4FA 1VDZA 1XMSA 1CS4C 5E95A 1HQCA 2ORWA 4B47A 3GJ0A 1NNEA 2FNAA 3UK6A 4KVGA 5LD2B 2NTYC 3HR8A 2NO9A 3RRMA 4G5RA 3R9XA 3LW7A 1E0AA 4TLEA 3CM0A 3THYA 1G3QA 1Z2CA 5DH9A 1E3MA 4S35A 5AJWA 1Z06A 2WOOA 1BMFA 1D9ZA 5D3MB 5FBWB 4E22A 3RWOA 1SZPA 2IC5A 1G1MA 3ETLA 4H1VA 2ZUCA 5CB8A 4WIAA 4LJYA 1P9WA 4LYJA 1RJ9B 4PPGA 4BZXA 4NONA 4LHVA 2B8WA 4RFVA 3IEUA 3SYKA 4DB4A 3AVTA 4U7DA 4A4DA 2VHQA 4HSEA 3GQBA 2OSBA 1YVDA 1IJEA 3EX7C 5L3SA 4YDHB 3OF5A 4UNSA 1OSNA 3EZ7A 4FCWA 4KFTA 3AVQA 2QPOA 2EFHB 2J5XA 3GLHE 2W6ID 1OFTA 3IIKA 2OESA 1Q21A 1GRNA 3GP8A 4GPTA 4FMCB 2WOJA 1JR6A 2C8VA 4RD3A 3TNFA 3CNOA 1SULA 3AF0A 4JT4A 1DAKA 3BH7A 1UJ2A 4LSGA 4KITB 4M1SA 2CEAA 1G3IA 4B32A 1IN5A 2CE7A 3PUYA 2AD1A 1E0JA 4PTLA 1YR8A 4B3CA 3U4QB 1LS1A 4IXNA 3KJGA 3AF2A 5D3MA 1GTVA 3LWNA 2J45A 1OIVA 4V0NA 3TH5A 1GRQA 4QKQA 4ESVA 1A2BA 1GP2A 4L4UA 1N0VC 2HXYA 4Q1BA 1XD8A 1P62B 1NIPA 1RJ9A 2V54A 2UZIR 3UG7A 4URWR 1RPZA 4C30A 4URXR 3X1XA 5EQTA 4ASUA 4NYMQ 1ZMXA 1IHUA 3TR5A 4QBFA 4CZ2A 2A2ZA 1ZD8A 3MG9A 2RKOA 1TF2A 4IDPA 4BLOA 3AVUA 3UIEA 1W36D 2CCKA 2YOFA 4XWOA 4P31A 4QM7A 1FPMA 2QPTA 2LKDA 4MGYR 2CMKA 5GJBA 1E9SA 1Z0JA 4D4JA 2W2XA 2YHSA 3CZQA 2IS6A 2IYUA 2QY9A 2VQSA 1CBUA 2QU8A 3PEVA 2IS4A 1NKSA 2VLIA 5GJVC 3PUXA 2FDCA 4DLTA 4EPRA 1RYHA 1M34E 3ZVNA 1R5OA 1ESNA 2BEJA 1CRPA 5KO2A 1R2QA 1ZCAA 3HJNA 2RGAA 2TMKA 5TMPA 3H86A 1V5WA 3U4QA 2W6JD 3KQLA 4EPVA 1N6LA 3J81k 1Q1QA 1DS6A 5DN6A 3DKPA 3SZRA 2BBTA 4WBSA 1G5RA 1NG1A 1W36C 3K0CC 3OEEA 3FOZA 5F9FA 5UKDA 1QF9A 5F98A 5E7MA 1U9IC 3C7KA 1IN6A 2ZRDA 3VHLB 4C0JA 3C15C 4XD7A 4MITA 4CIDA 4UNQA 3QKSB 4PO8A 2CNWA 1KI3A 3KDSE 4G01B 3LY5A 3A37A 4PAQA 1F3OA 4LPSA 1K5DA 3KQNA 1HURA 3AP1A 2V55B 4MRVA 2GEDA 5DISB 1FP6A 3ZZ0A 1VG1A 3AF3A 2JA1A 1QVAA 4MUAA 4D80A 3BB1A 4GZMA 4PZZA 4TQAA 4HYYA 3BWDD 1ZM3A 3AF1A 2R6AA 1OXTA 2WJIA 1XTSA 4MRPA 2I1QA 4UNRA 1IY2A 4AG6A 4I4LA 3QE0A 3EPHA 2QGZA 4JVLA 4A92A 2OUKA 5EZ6B 3NC0C 1ZNWA 2J41A 2HT1A 4FMDF 4UNPA 3X1YA 2ZU6A 3KUDA 2GJ8A 3HR7A 5FL3A 4IEIA 1CJUC 1GNQA 1I2MA 5LB2A 3KFXA 4ZV4A 2QENA 3TW4A 2BIFA 2GJ9A 2J1LA 1YZLA 2YNMA 4IOLA 4I99A 4CF7A 3V9PA 3ZH9B 2HJGA 4MRNA 3BIFA 3HYRA 4HEJA 1KO5A 2ZSFA 4IOMA 4PR0A 5CLLA 1IJFA 1OW3B 5BYKA 2ZAMA 1G3MA 3OIUA 2JLQA 3U61B 1M6NA 2ZAOA 5F2EA 4D2IA 4RD1A 2GJAA 5HKKD 4B3XA 5DSZA 4ZCIA 4IDHA 1ZNYA 4KSBA 3CW2A 3QKSA 4JLKA 4RCZA 3BB3A 2ZSAA 1S1MA 3L43A 5FBRB 2W6IA 4WA7A 1W4CA 3BERA 3W6PA 2W83A 1QHSA 3QKUA 2OZEA 1E2PA 5EZ5A 4PQFA 1QHGA 3Q8XB 3AUYA 2Z83A 2JLSA 4KO8A 3L0IB 1UM8A 5P21A 4A2QA 2BMJA 8OHMA 2R9GA 4URVR 4FWGA 1TEXA 5FPSA 5ANRB 3X1DA 1DAFA 2J0UA 2B7CA 3SJZA 4DLWA 1N6KA 4IDOA 1GFIA 2VYFA 2Q9CA 3WP0A 4BASA 5JJIA 2XJ4A 2GK6A 3PVSA 3LRPA 1IXZA 1YZUA 1XEFA 4IVRA 3RS5A 2F1JA 1Z5ZA 2ZVPX 1DEKA 4WXPA 2Y8EA 3SS8A 1QHNA 2A5DA 1ZNXA 1U81A 4G5QA 5JLJA 2RGEA 3H84A 5JS8A 4OJQA 1MKYA 1GZSA 1MRNA 2V6JA 2FOLA 3EC1A 4OQNA 4XVUA 1Q1EA 1KMQA 1XTKA 2D74A 2FFQA 5JBQA 3AVWA 3WYAA 1SKYB 1P9RA 5AJZA 4GSYA 4BWYA 4DUGA 2VSXA 1WQ1R 1N6HA 3H0KA 2ZM5A 2EFEB 2FEOA 5CK5A 4EFNA 3UWOA 3GLFB 3MD0A 2ZQ5A 4QHSA 2JLVA 3GFPA 4P0TA 3LA6A 2HF9A 1N6NA 4HLDA 1W0KD 2G0TA 5KYKA 1UF9A 2Q3HA 4WZBE 1X1RA 3W5JA 1GNRA 5FOSA 2BWJA 1CF4A 2PMKA 3RWMB 3H4MA 1W4BA 3EPJA 3PR1A 1BIFA 3I92A 3VR3A 1BYUA 1II9A 1SVOA 1NLZA 2IXEA 2HF8A 4IFBA 3Q85A 2IWHA 4G0NA 1OXVA 2GXUA 3U3KA 5J4YA 2VF7A 3B60A 3LV8A 4PQYA 5E4FA 2W6JA 4ZDWA 1XD2B 2G1JA 2FGJA 3TAHA 1U0LA 1UBCA 2IHBA 1R6BX 1KZ7B 2V7QD 1KI2A 1E2LA 4WXRA 4Q7LA 5TB5A 1TF5A 1GM5A 4ZDKA 1ZM9A 4MYTA 4IJMA 3MWLA 5GVRA 3RABA 4L16A 1SKQA 4QM6A 2VP0A 3SYNA 2CBZA 4Q1AA 3EPLA 2W2VA 5DYGA 1JI0A 5JFGA 3LXXA 2OFOA 3QENA 1MOZA 2ZJZA 3GLFA 2H8KA 2B21A 2GAOA 4GOJA 4Q4HB 3GLGB 4A9AA 5BYJA 4HZIA 1MR3F 5KSPA 3EPKA 3BC1A 3DOEA 5LDDC 4QGAA 1EWQA 4JBYA 2IHYA 1KHTA 3QOFA 4IDNA 2PX0A 4LDJA 2GBLA 4PX9A 4L8GA 3FGNA 3Q9LA 4C2TA 3Q72A 2QG6A 3SFVA 3SQXA 2DVWB 5J4HA 4K46A 4PHGA 2ERYA 4Q9LA 5H8WA 2CCJA 2ZYWX 4BFTA 1Z0FA 4ZCMA 3ADDA 2A9KA 2YOHA 1VHTA 2OT3B 2FX3A 3CX8A 2WWFA 1EGAA 4TMVA 2O5VA 1XMJA 4G5SA 2RCNA 3CUEF 3K8YA 5G3YA 1XD2A 1GG2A 2KWIA 2MSDB 2P5TB 3EIHA 1TU4A 4A8JC 3CRVA 1NVUQ 1NIJA 4Q00A 1AS0A 2DR3A 3ZS9A 2EYUA 2A5GA 2P2LA 1JR3D 3AP2A 4M1OA 3U7HB 2WWYA 2GNOA 1VIAA 5EUMA 5AUQA 4EIWA 1SKYE 1AZTA 3K70C 5EUQB 4DXAA 1VG9B 3VKGA 5BXQC 2AR7A 2XNDA 2AWOA 4IHQA 2ZI7A 2PLFA 2WWHA 3DHWC 4XTRA 2JJ2A 5HE8A 5DGXA 2D4HA 2VO1A 2VSFA 3WNBA 4OI2A 3CF0A 1G18A 3GLFE 1X3SA 2C9YA 2H18A 3T5GA 3BK7A 3REFA 4IFEA 4PXAA 4Q4HA 3ADCA 4V0MA 1NLFA 1KI4A 3GLGA 1CULC 5C4MA 3K09A 5D3QA 3EZ6A 2J7PD 1NF3A 4GZLA 2F43B 4JLOA 1AGPA 4UQOA 2I3BA 2IXGA 2ZI4A 3GEEA 1UKEA 1SVKA 4DLZA 3IPXA 1IOZA 1P9NA 4FIDA 1FTNA 3TR0A 1OH7A 4DRZA 3TUJC 4KBGA 2D7CA 1Q1ZA 4TL8A 2CK3D 1PVOA 3IIMA 2H57A 3MFYA 1CXZA 2O8BB 4OHZA 1I4TD 4NE2A 4DIDA 2RAPA 3ZIAD 2VF8A 4NP6A 1ZJ6A 4M1TA 2PX3A 2QQEA 1US8B 4Q66C 5FUWA 2WBLC 3SBDA 4U5XA 3B9PA 1GDDA 1P73A 3BD9A 4ACAA 4DDWA 1UAAA 1KAOA 2EVWX 2XSZA 1VMAA 3W8NA 1N25A 2KBEA 3NKVA 1W1WA 4OHXA 1KKMA 2ZTSA 1KSFX 5J4KA 1FNNA 5H68A 3RS4A 1NMYA 4A0FA 2F7SA 1XJ0A 2KJQA 1C9KA 4LJ7A 5G3ZA 2DHRA 1XDBA 4AWXA 1N3BA 2YWEA 3RC3A 1WBBA 2DPXA 1JJVA 5J4LA 4NH0A 4NYJQ 4EPXA 1VECA 4L9WA 3U3RA 3GJ6A 2LWIA 5IRCD 2XB2A 2PT7A 4V0ME 3ZDQA 1W0KA 3GLGE 4DWJA 3W34A 2O8EB 1D2MA 1C4OA 1UDWA 4HB4A 2B8TA 4BFWA 1M2OB 1G64A 1GRRA 2VHCA 3K9LA 4EUNA 2R8RA 3VKHA 2OG2A 2OV2A 4TL9A 2X8AA 2F43A 3AVYA 2QMEA 4B3BA 2IS2A 5HCIA 4URZR 1NVWQ 5HTKA 1P7CA 4HLUA 3BORA 1W0JA 2MMCA 3LX8A 4WVFA 5EE3A 1R8QA 3L8YA 4NYIQ 1ZD9A 4ZKDA 4A6XA 4DC9A 2AX4A 4ZI3A 1KGDA 3KKPA 4JYBA 2O8BA 3AKYA 3EZFA 3UKDA 1XPRA 1P5ZB 4JIMA 1US8A 4MKFA 3Q5EA 2G6BA 2RGCA 3B1WA 4DZZA 5KUTA 2BOVA 2AFIE 1R5NA 2N42A 4HAUA 4Q1FA 1CLUA 2QM8A 2DZNB 5CIWA 4CT5A 1Q3TA 2OLJA 2N1BA 4BQSA 4ESHA 4RY2A 1GUAA 3SHWA 4LWZA 4BGDA 2AXPA 2ZS7A 1Z6TA 4QC2A 3I1FA 3HPRA 2CLCX 4X8OA 4DCUA 2ERXA 1FFHA 4HUTA 3FHOA 2QROA 5EP4A 4C0KA 3UWKA 4LRTA 2EW1A 2F6RA 2CJWB 4OI1A 5A0FA 1JECA 1KI1A 5JRJA 2FV8A 2X77A 4FWHA 4DJTA 2ECKA 1GKYA 1S3SA 2E1RA 4BRWA 4Q1DA 1G6OA 3WMFA 2O8EA 1EESA 2C5LA 1E9EA 2FF7A 1W48A 4QHYA 1TEVA 1EK0A 1OXSC 5F9HA 2DFLA 2IXFA 3FFAA 4LBVA 2QZ4A 4I81A 2B7BA 3IO3A 3WMGA 2J7KA 2KB0A 3ZVLA 2W2TA 5EE1A 3TGPA 3X1ZA 1G6HA 1PUIA 2ZU0C 4ZIRB 4OK5A 1C1YA 1N5LA 3CRW1 3HDTA 2RGNA 4XH9B 1UKZA 1N5JA 2NO0A 3OIVA 4PC1A 721PA 1VKJA 1WBDA 1KDPA 5J4VA 2R9VA 1BH2A 1IXSB 5L3VA 1JR3A 1K8RA 4TTRA 1OXXK 1ZW6A 4ASUD 3T5DA 1R10A 2WM9B 1XB2A 3B1XA 1EX7A 1MO6A 3BE4A 1W49A 1N0WA 1ZD1A 2WVJA 4JBXA 4UJ5A 4HDQB 3K9HA 1P2VA 1YHNA 4NMMA 1GILA 1ZVQA 1P60A 2WZQA 3FDIA 3RVBA 4B71A 3ZD7A 1E4VA 2QGNA 4J0QA 4LHZA 2IYZA 2PEYA 2BBSA 2Q0HA 3IBYA 2HEIA 2CJWA 3VTKA 4NCIA 1Y63A 2ODBA 2CE2X 5AWFC 4D81A 3V00A 2J7PA 3LDAA 3QBTA 3NVAA 1S8FA 1RRPA 1ZUHA 4B74A 1JQJC 3VR5A 2WMNB 5BN4A 2RGXA 1FMJA 4B6EA 5SZJA 3U7GA 2KSQA 1EFUA 3DEFA 3JZMA 2D3WA 2CK3A 4ZDJA 1SHZA 4JL6A 1CR1A 3IPYA 4Q7JB 1Z0KA 2A5FA 3ZIAA 2ZXUA 3U7FB 4UKDA 4MKGA 3P4YA 4O3MA 3KXIA 2VP5A 3RS0A 4ZIRA 3ZVRA 1NN0A 3L0OA 3ECCA 1XP8A 1Z22A 3ADKA 4D0GA 3LO5A 2VSOA 3OEED 3BGEA 3MCAA 4KAXA 1F2TB 3Q3JB 4I1UA 4AKIA 4B6FA 4XWAA 3OHMA 3VU9B 2JAQA 5KNDA 1JR3E 1CJVC 1IN4A 3LAWA 4CDGA 5HE9A 2R6CA 3BOSA 4QBIA 4URUR 2CNWD 3TBKA 2VIIA 1X8LA 1NVXQ 1PV4A 3I8XA 1Z83A 3VX4A 4C0AC 3QXJA 4RSGA 2HJVA 2IYSA 2OAP1 4JLVA 4YMTA 5BN5A 1G16A 2PMDA 3ZS8A 1GOTA 3CNNA 1E69A 1KJWA 4JYCA 3VR1A 1HUQA 4QBGB 4JS0A 2ZJ2A 3T15A 4DCTA 2BMEA 4LCBA 3IIJA 3THXB 4DCVA 1A5TA 2NO1A 2IL1A 4UXJA 2BJWA 5EP3A 4R9UC 3GJ4A 1YZKA 2BM0A 2FMXA 4YMUA 5EE0A 1W5SA 2ORIA 3U6BA 2YWFA 5FOVA 3UMRA 2VL7A 1PUJA 1TQ6A 4ZKEA 1GSIA 1T8TA 3GCGA 1ZIPA 1UDXA 2CDNA 1YRAA 4NTZA 2BDTA 3REGA 4Q48A 2Q6TA 4I1VA 2DFTA 2I1VB 2PZEA 4DDUA 2OBLA 5H1YA 4HAXA 4OJKA 2X2FA 1IM2A 2P5SA 4LV8B 1E2KA 1FMLA 1R0XA 4C7OB 1HE1C 1WMSA 5IK2D 2C78A 2J3EA 4F38A 2GDJA 2GHIA 3VR4A 3FMIA 4KI0A 3AV0B 4NHOA 2V1UA 4C0SA 3TIFA 1F2TA 1LTQA 3GFOA 3NC1C 2CL7X 1D2EA 3FYHA 1EFRA 1NVVR 3TMKA 4A15A 1Q1BA 5FUXA 4OQLA 1AQUA 3NDBB 1F2UA 1WDTA 4JJKA 3JVVA 2QAGB 3QXHA 1A82A 4GMDA 4Q02A 2ZRIA 1D9XA 1P2SA 1UEIA 2VPPA 2O8CB 4BEJA 2F9LA 4MRRA 4H1UA 3SHFA 1UKVY 3GFTA 3MWYW 1XEXB 4BUJA 1HY3A 1XTIA 1JXOA 1DTSA 2AKAB 4WZAE 1B23P 1HT1E 3UMSA 1JPNA 1CEEA 1NMZA 2FSGA 2MMGA 3W3ZB 3CR7A 2FFBA 1KOFA 3WHKA 3I8SA 4JBWA 4IOKA 4BRUA 2BVNA 1JXMA 5FPKA 5FOWA 2WTUA 5CM8B 1Q20A 1FUUA 4TQUS 2PEZA 4D6PA 3R7WB 5DE3A 1Z47A 3KJHA 4Q7MB 4ABYA 4V0LA 2C95A 3UATA 5FUVA 1MO3A 1E2GA 2C04A 2IEZA 3WNDA 3DKVA 4JSYA 1ELOA 1QHHB 4PPNA 4DSTA 3CWQA 3OIYA 1BYIA 4C7OA 1MH1A 1IN8A 4V0KA 3LW8A 5KSOA 1E94E 1OH8A 1FQJA 4QXAA 4JL8A 1CTQA 1FTSA 1XZPA 4U00A 4LRSA 1JJ7A 1E2HA 1R7RA 4JJZA 4P33A 3VKWA 3B13B 4M2LA 4DUGD 1ODFA 3LXRA 1CR2A 4A36A 2YC4C 1NKTA 1OIWA 1J70A 2REOA 2XXAB 3IKJA 4LJ8A 3MLEA 4N1AA 3DMNA 4WOPA 1HEIA 2QSYA 2XITA 1RRGA 2FZ4A 2F55A 5JJKA 1Z29A 2QAGA 5CB6A 4JLAA 1QRAA 1E2DA 2RMKA 2IBMA 3IILA 2O8CA 1QHXA 4DLXA 5DHAA 3L82B 1XEXA 2CHVA 2WJVA 1Z63A 2ZE7A 2V8OA 3U3OA 2PJZA 2R6FA 2ZI9A 1T5IA 2GF0A 3BFVA 4UXHA 4X8MA 2OBMA 2YOGA 4HUQB 2J0VA 3KB2A 3PV0A 2CXXA 4TYNA 1SVMA 4P4TA 2D7DA 1NJGA 3R7WA 4XOIA 4PO1A 1Q44A 1TUEA 1W7AA 1TL7C 4LYAA 4CEIB 3MWKA 4O25A 1SVLA 4LYFA 2X19A 5JECA 1QHHA 2WIBA 1KDRA 3AJIB 2OCBA 4V0OA 1D2NA 3KX2A 1W4AA 2WKRA 1ZUNB 4RZUA 3SC3A 1XXHB 5GJWC 1N5KA 3SI7A 3AVXA 1UADA 4MRSA 3T1OA 1HT2E 1E1QD 1I2DA 2RGDA 1Z6XA 4B73A 1NG9A 2JLRA 2WJHA 4Q4AB 5CJ2A 3ZGXA 4QFMA 1JB1A 4DCSA 1YZTA 2JASA 1TF7A 4DB2A 3VAAA 3K0EA 3P26A 4FI3C 5BQ5A 3B78A 3AQ4A 5AJYA 2BMFA 3F0TA 1W47A 2FFAA 1T5LA 5K8IA 4DLYA 1U8YA 2WPDA 2ZI5A 5KDDA 4MDEA 4N0EA 4BFUA 1E79D 2G77B 2VEDA 1Y3AA 5KPDA 3ZYCA 2EU8A 4NCNA 5B64A 1DBSA 1XCPA 3CRRA 3OEHA 4K8OA 2DBYA 4YXWA 2ZUBA 3IGFA 4BPBA 2JLWA 3B8HA 4XIGS 4JT2A 4YONB 1DARA 1XTRA 1W2GA 2ZS8A 4DLUA 4HUQA 2A3RA 5DLQC 1Q3HA 5HZKA 2QP9X 1KNXA 5IK2A 4CEHB 3TUZC 1R4AA 1KDOA 1EFHA 3AP3A 1NLYA 1QZMA 4C2UA 2JCSA 221PA 2V6IA 3KKNA 5DI9A 5AUNB 3RSOA 2FSHA 3KXKA 3EZ9A 1RVDA 2ZANA 4A0GA 3WRYC 1XXHA 2ODEA 4B3DA 2XNDD 1E2QA 2JJ2D 3LLUA 1DAIA 3U6KA 3U3JA 3CRMA 1XF9A 1WCV1 3TQFA 3D6TB 2NGRA 2IW3A 4LBZA 1NMXA 2GXAA 4OHVA 1AK2A 2ZSBA 3VQTA 3HYTA 2GJKA 2CVFA 3T35A 1YRBA 1G41A 4FXPA 2AKYA 3EW9A 4BLPA 1KI6B 1X86B 3B1VA 4FINA 4TN1A 2WJGA 3A4LA 2WJYA 4QGHA 5JWHA 4A0RA 1LF5A 4PAOA 3DZDA 1VHLA 4DLSA 4OL0A 3QEJA 2A78A 2IYXA 1VG0B 3FVQA 2ZUDA 1M7BA 1N2CE 1ZP6A 1WB9A 2VP2A 3CO5A 2XSZD 3CWZA 3IO5A 4AY2A 4RD2A 4CEHA 2H7VA 3SU8A 2ANBA 2OXRA 5IDVA 3UANA 4EPWA 5EJEA 2QAJA 4PHTA 1YZQA 3WBJA 3K09C 4AYTA 3TRFA 3EIQA 3K0FB 4IKEA 2E9SA 3QG1A 3LLMA 1XXHE 4PC3A 3TSZA 1UPTA 5JRZA 2FA9A 1SHKA 1Z3IX 2IYLD 4Q1CA 1U8AA 3PENA 2OILA 1E2MA 2GEVA 2NZ8A 2OAQ1 121PA 4JLDA 5FTKA 1DG1G 4KYIB 4Z1MA 2WSMA 4F7WA 1S9DA 4TMXA 3PITA 1O87A 5TXGA 4NDZA 1OHHD 2YYZA 1JALA 1DAGA 3QPWA 3VMFA 1E9CA 1L8QA 1G17A 4E5UA 1KMHB 3A1TA 4RD0A 5F3WB 2XTMA 3TW8B 2NO7A 2P6UA 1QHYA 1EFCA 1W0JD 2Z5FA 3DDCA 5FPHA 5DNYB 2R2AA 2NPFA 1KI6A 1II0A 4AK9A 3LX5A 1KKLA 2OO7A 5JHHB 4YMVA 1R0YA 1R8SA 3SOPA 4Z54A 3G0HA 2ZROA 4B75A 4M1YA 4GL2A 1U9IA 2NOAA 4PZYA 1CRQA 2VHTA 2JIZA 3DO6A 3KXLA 3RRZA 3N2EA 2BBOA 4E09A 3BBPA 1U2RA 4ARZB 1K5GA 3FE2A 4PAMA 4BZPA 1OJLA 2GRJA 2VHJA 2LCFA 2CHGA 3NBZC 4B3GA 3VLFB 3DVLA 4WW0A 3CIOA 1NVMA 1GKUB 4KODA 1DAMA 1II8B 3CF2A 2HDNB 1EFTA 3A8TA 3DM5A 1E1QA 1T6NA 2ODWA 3K0FA 1VTKA 4HZUB 2LKCA 3AGPA 3R9IA 2QI9C 4O2RA 2WWIA 4C4PA 4HLUC 4US1R 2C2HA 4QNMA 1FQKA 1OV4A 4KCGA 4PSAA 4DEYA 1QDEA 1JEDA 1G291 1C1KA 3QJYA 5H70A 1G4UR 5JCPA 2GF9A 421PA 4TMKA 2XTNA 4RVCA 5C1BA 3H1TA 2GK7A 1E79A 2ORVA 1JAHA 2WV9A 3B7GA 4YQFA 3GMTA 1ANKA 5JS7A 3NBFA 4MQBA 1L2TA 1RIFA 4NU0A 5EE9A 1YR9A 4BFXA 4GOKA 4DBLC 3BAFA 4TLBA 5EP2A 5DI3B 1T3SA 2GVZC 2GESA 3W8RA 4FCVA 5LBIA 4C0HA 4BEBA 1I4LD 3PJRA 2EQBA 2C03A 3THWB 4KBFA 3SBEA 5BWMA 5FR1A 4D82A 1OKKD 3CNLA 2ZRLA 2GJSA 4QGGA 3TJZA 3TVTA 4AD8A 4DT1B 5ELXA 4LJ6A 3P4XA 4EFLA 1MRSA 1ZNZA 2ZRBA 1LV7A 2FG5A 2XZPA 2J9RA 4CYMA 1Z0DA 1AZSC 3SNHA 1E9FA 5CDFA 3RRYA 4FMDB 1O3YA 4AYXA 3QBVA 1ZM4A 1FP7A 4PQRA 5AJXA 1GVNB 2JJ8A 4W7SA 1II8A 1LS6A 4D26A 3IUYA 2PT5A 1EWRA 4HZUA 3DM9B 4I1SA 4AI6A 1P4SA 2NPIA 3QEOA 2XJ9A 4EJSB 3GPLA 4AIIA 4B76A 1KO4A 3EASA 5HCNA 2AL7A 4Q9HA 5J47A 2C9CA 4ACBA 5BN3A 4TWZA 3EARA 1TQDA 4HB2A 4M22A 5CIQA 5EE5B 1G7RA 1T91A 1PLJA 3OIWA 4PFSA 3TVDA 1Q22A 2RGNC 2ZRGA 3QY0A 5CYOA 2HT6A 3U5ZB 4A82A 4D4MA 1G5TA 3R9WA 1KZGB 4AKEA 1XMVA 3I32A 3GJ3A 1E32A 3ZZTA 4DSNA 1OB5A 1OYWA 1U90A 2VHUA 2J59A 3D31A 5FBQB 5DI3A 5AJVB 3FB4A 1GL6A 4C0LA 3PEYA 2ZRFA 1TX4B 1AQYA 5FUYA 3THWA 4DT1A 5GVSA 3BH6A 1E99A 4BLQA 2WSSD 1XPUA 4DHEA 3MJRA 1GIAA 3FKQA 1TADA 2R44A 2IUSA 1V43A 4RZ3A 3U44B 1A1VA 4LC1A 1KK2A 3B82A 2QW6A 2BBWA 2F9MA 4W9MC 4OHWA 2Q21A 1JPJA 1KY3A 2ZPTX 4PZLA 3QNUA 2VA8A 4KHZA 4QJ4A 1G20E 4EJSA 4MGZR 3LQQA 3U7EB 1OHHA 2XGJA 1CJTC 1NI3A 4LJ5A 1YJ5A 3T06B 4N3NA 2NQ2C 4B3FX 2BM1A 4PHHA 1E9AA 1Z6AA 1N6IA 3FMPB 1KI7A 4A8JB 1QG2A 2DYKA 3LBIA 4PC2A 5KSZA 2P6RA 4Q1EA 1E6CA 1OLOA 1OXUA 1F6BA 2VP4A 3G5UA 2E87A 4AURA 1AN0A 2XZLA 4LI0A 3EG5A 5KNCA 1RYFA 2PL3A 3VHXA 2R6GA 4YMWA 3I62A 5C4GB 1ZAKA 2CLDX 4YDSA 5KSYA 4BFSA 2ZRHA 3JVUA 4TLCA 2BC9A 3CPEA 4KV9A 1G8YA 4UNNA 2FSIA 1QZXA 1WF3A 5L3RA 2FWRA 4KYUA 6Q21A 1BO6A 1LW7A 1XTQA 1E9BA 2O52A 3WYFA 5FBVB 1G4AE 3AUXA 3PFIA 1T0JB 4QL3A 2BKEA 4TL6A 5L3QB 1EFRD 2GZHA 4JN6A 1CU1A 2B92A 2G3YA 1SXJD 2EFDB 1XJCA 3Q7PA 4TQ9A 3AGQA 3U44A 4HLQB 1DVRA 1VCNA 5JI2E 4LHYA 4XJXA 4Q18A 2FGKA 5KDOA 3E70C 3NWJA 3M6AA 2ZRMA 1UFQA 4MYUA 4XVQA 5FBLB 2WWGA 1U99A 5DO9A 4C0QC 1CIPA 3A1VA 4UXIA 2QPAA 3MSXA 4JLBA 3F8TA 1E2FA 5TDHA 3K9NA 3GLIB 3C4JA 1LY1A 2C98A 4WZ6A 3G82C 1H8EA 1AGRA 3PCRB 3SDZA 4NCHA 3EIEA 3QXSA 3KQKA 1TU3A 2ZITA 3BH0A 4XSHA 2O0JA 2KE5A 1XMIA 2YINC 3LBHA 3QQ5A 4RFSB 4D4KA 3ICEA 3AKEA 4EQ6B 3AM1A 1N6RA 2ZE6A 3CPJB 2NZJA 3LD9A 1OKKA 2QE7A 3I72A 1JAIA 5KDLA 2O8DB 2DB3A 1KSHA 2WMOB 3D8BA 3A4NA 3M4YA 2DY1A 2HXSA 3QI2A 2QQ0A 2MSEB 4JVNA 5TARA 4AKHA 4P3YA 2R65A 1IY0A 1P72A 2SHKA 1IN7A 1Z28A 3C5HA 5FOTA 5AUOB 2ZJOA 4CRWB 2QA5A 3LVRE 1NN5A 2QUZA 3BS4A 2ZJ8A 2QSZA 1TUIA 5L3QA 2EWVA 2BV3A 2IS1A 5LD2C 4PSKA 3O8DA 3QG5A 2ZJ5A 4MDFA 3WHLA 5CLQA 1KK3A 5JEDA 3ZZUA 1BS1A 1G8PA 2ZJYA 1WA5A 1S9HA 3KKQA 4F4CA 3QXXA 2W0SA 1ZU4A 1E1RD 1CR0A 2GEUA 4DEXA 1LFDB 2GETA 3C14C 3BRWD 4D0NA 4TMWA 1U8ZA 2JLYA 1DPFA 3LVQE 1COWA 5HPYB 5GJCA 2QM7A 3K53A 3MHVC 1E2IA 1ZINA 4JVMA 4MH0R 3IHLA 4LGMA 2HCBA 3GD7A 4HI0E 4OI0A 3DPUA 3OAAA 4IDQA 1IXRC 2QT0A 1T3LA 2WKPA 5EXXA 4Z8XA 3IDQA 2HLDA 4EQ6A 1DO0A 3OESA 3K0AB 2WWXA 2VBCA 1UBGA 4M53A 1NN3A 5C46F 2O8DA 821PA 4GP7A 1CR4A 3A36A 3DMDA 1AJEA 4KFUA 4BFYA 2QAGC 2WSSA 1FX0B 4LX0A 1T8UA 4LPKA 3X2SA 3QVUA 4ILEA 1S3GA 1SXJB 1KY2A 1G7CA 1N6OA 1RZ3A 2R62A 4JZKA 4KLNA 4FWDA 2DWPA 1U0HC 3NG1A 4BFVA 1GL7A 4JMPA 2IUUA 3QF7A 2QT1A 2N46A
chains in the Genus database with same CATH superfamily
5H7XA 1NYQA 2AFHB 4D9IA 2J6BA 1GKIA 1Z6GA 2PZLA 2Q4TA 2V5VA 2E1PA 4L2IA 3OEHD 2Q7XA 4IJVA 4O5AA 1A9ZA 4FKZA 5TLSA 2HO4A 4JOQA 3G9QA 1P17A 3MW8A 1SCAA 1IZYA 4R98A 1D6SA 1XJQA 1ZK0A 2BFEA 4BB0A 4CXMA 4B3IA 2IJGX 4O2AA 3E5HA 4A23A 1FSPA 5EYPB 3W04A 3LPLA 4YALA 4PFKA 3KSZO 4Z99A 1UMBA 4UBLA 4PCAA 4NCKA 1E2EA 4ZODA 5LNK1 3FCOA 3LBAA 4B34A 4HN2A 2V03A 2FZ5A 3BMQB 3RUIA 5J1SB 1U98A 1JLMA 1H0KA 4QNRA 1PYDA 3QU9A 4I5SA 3ESDA 2JI9A 1U0JA 3TE7A 1IQRA 4G65A 1E8DA 1SHJA 5JZ9A 1ZWKA 1Q0ZA 5EJMA 4GD3Q 2IOFK 3TM4A 2O06A 4AUKA 4RDXA 1R9MA 3U4IA 3SSNA 2ANCA 1K27A 3AY6A 1XEWX 2HC9A 1WP9A 4KVAA 4X9XA 4FW8A 3C6YA 2JFYA 1UJ5A 2QW0X 1BW9A 1CR6A 4UZSA 2F8SA 5EHIA 2ZB3A 4M7OA 3UH1A 2QJWA 1RPJA 1G59A 1NJFA 3WNVA 4DA0A 4Q3BA 4OU5A 5DB4A 4Z7QB 4M9SA 2P9FA 4MB6A 1KWGA 4E2YA 3HWSA 1NBMD 2Y9PB 3PUHA 4H60A 1TVCA 3F3SA 3QF4A 3DNPA 3SYLA 1XX6A 3Q0IA 2A9OA 2WQZA 5FTLA 1KO7A 5GADl 1B41A 5DBGA 3TFQA 4XQ0A 1ZU5A 2QI9F 4RBNA 3KQUA 1LC0A 3WGQA 4D57A 4NSRA 4DG5A 1VL5A 1VSBA 1LVHA 3PHBE 2WIJA 3RC9A 3LOPA 4ZVLA 2PMWB 4R2LA 4GDFA 4PRKA 3A6HA 4QJ3A 3PFKA 1DGGA 3K9FC 5JAOA 1IYZA 4J03A 3L7IA 1HXHA 3S5JA 1I3NA 1ES9A 1ISPA 4QOHA 3NVMB 2EW8A 1EVZA 4FGZA 2YHBA 2ZETA 4GI3A 2H54A 3RVSA 1RT9A 2Q9BA 3HKPA 2D06A 4V02A 3NVKI 3DXYA 2A9VA 2NTNA 4MGKR 1Z3CA 1MNAA 3AB8A 3ZTYA 1Y34E 4TSRA 2X9VA 5EUCA 4QDUA 4MWGA 3CH7A 4KEAA 2KDLA 3CG0A 3VZBA 1BXGB 4E31A 1RYZA 3FYCA 1VDDA 3OKAA 2A0FA 4RHTA 4XX1A 2EARA 4ECEA 2PRJA 2BFDA 5FKJA 2NO5A 4ZRNA 4EUHA 1TLFA 3CR8A 5LC1A 4YT2A 4RTJA 1G7SA 3HB5X 2DUUA 5JYDA 4FHCA 3BWEA 3WNCA 2AX3A 5CFLA 4BXOA 3E1SA 2R60A 4GZ6A 3I4LA 5KX5A 1ULTA 1EXMA 2P0AA 2HYIC 1C7RA 2IXTA 5I9NA 2DSTA 2HREA 4KPFC 3U6EA 1Y82A 4C89A 5DCYA 2BEUB 1XLVA 2AE2A 4CM8A 4KQJA 4JHXA 2BP7A 4E5PA 3A6PC 1OPXA 4MCAA 1ZR2A 4B9AA 2QMHA 3UJ9A 3PXEA 4URFA 1DOZA 4YT5A 3WA7A 4CM9A 1NRJB 2HLDD 1YS9A 4DR5B 1NN1A 1JYEA 3GT3A 1NBME 3ETGA 2YBDA 3P9XA 4KXNA 3PX3A 3HEBA 3GLQA 5AESA 3M8KA 2R46A 4RAOA 1G21A 1TDZA 5LA6A 3KU4A 2NU6A 4L9RA 1U7PA 4Z7OB 3CLVA 1NQXA 4Q12A 4KV7A 3U56A 2XOKD 3TLXA 5E3HA 1MC1A 4IEEA 1L9KA 2B2CA 5JCZA 1L7EA 4U02A 1YVEI 1KO1A 1VMKA 4J1TC 1U0RA 4IV8A 4OQYA 3E4RA 4MUNA 3F5SA 4UM5A 3GC6A 3EWAA 4TTPA 5DYIA 4M0LA 3KBBA 4RM2A 5DPMA 4JVOA 2RB4A 1QFXA 2Q50A 2FOXA 3T9CA 2DY0A 3F7TA 2QOEA 1WXDA 3M89A 4LXTA 1RBZA 2WICA 1SXJC 2AJTA 3KV3O 4CDRA 1Q7BA 4TQGA 1OI4A 1Z6QA 5D5PA 3SR0A 1A76A 3LKVA 4P9NA 1I6KA 4HH0A 2FYTA 2NNWB 3GEGA 4RPHA 3ZK7A 1SBCA 2XEXA 3KTAA 2O8FA 3R8CA 4MQLA 5LYJB 4QOSA 4LUCA 1OYOA 3C3JA 4Q6BA 1ZLYA 3OZTA 2REXB 1I3MA 2WYHA 4GQAA 2O0KA 4CGYA 1WR1B 1GUDA 5K0EA 3VAZA 2XCQA 4HCJA 5FV4A 4Y0AA 4XDZA 4LF9M 2LIVA 2EF0A 2YY7A 4EHAA 1T8PA 3ZCUA 4EG7A 3OE1A 4TKLA 3HB7A 5GIOE 3NU1A 4HVAA 2L7HA 5E95A 3GJ0A 1NNEA 5HFNA 3PS9A 1ORWA 4IJKA 1A9XA 3LW7A 3SZUA 4S35A 4RGYA 5BSMA 4BE9A 1VI5A 5HP4A 1B00A 1J1UA 3LDHA 1JH9A 4ZQGA 1Z6ZA 5F5LA 4RJ2A 2B8WA 3SYKA 4LFCB 2Z7JA 4U7DA 2UDPA 5D85A 3QV2A 2P90A 3IIKA 4FLEA 1O95A 4M0CA 4MW4A 3AB7A 4JT4A 4D4IA 1M2VA 3GNQA 3K2QA 4K86A 3KVYA 4B3CA 2Y0EA 2ZTVA 3BZBA 2HLHA 3O3NB 1GTVA 4UCXA 2BKXA 2QLFA 5DFLA 4KNVA 3GHYA 2P4QA 2JVJA 5C5IA 1S7CA 3ABZA 5E6RB 3KETA 1C7JA 4CZ2A 5LDHA 3OX1A 3HSYA 3NI2A 1C7IA 3V80A 1LRJA 3RVLA 4QXQA 1ZIDA 5JSQA 3WV5A 4R6WA 5GJVC 4BMSA 4JI6M 3R0XA 1JG3A 3HJNA 5AOBA 4GI1A 4X1IB 4L8RC 1TFRA 4YI3A 4LGVA 5G1OA 3I6QA 2GRUA 3FUXA 2W2LA 5FYDA 3ST7A 3DHYA 5DNCA 4PAQA 1PX2A 4IDGA 3BB1A 3UWDA 2PJUA 4BDSA 2A57A 4RY8A 1X1QA 4OU4A 4UNRA 4EY3A 4EYEA 4P4NA 4DR7B 2X5NA 4A6DA 4HEJA 2ZAMA 2X8BA 5F2EA 3UHPA 1FJ2A 1H0SA 2D59A 1W4CA 2IOHA 4EDFA 4MIYA 2OZEA 1E2PA 1QHGA 4KO8A 2BMJA 2R9GA 2MU1A 4DLWA 3O84A 2HA6A 4BASA 3PVSA 1YZUA 4U2GA 5A0VA 4IVRA 4G23A 2A5DA 4OKIA 3V4OA 5AI9A 4JYMA 2P30A 2UZ4A 4ZAZA 1LDGA 3JD3A 3AVWA 3WZLA 4IXDA 1WQ1R 2ZM5A 1DGHB 2FEOA 5K0BA 2OORC 3MD0A 2PGAA 3QPAA 4TS3A 3V1UA 4AJ4A 4QTZA 3IT3A 5IVIA 5KYKA 3D5EA 1XQVA 4LDZA 5FOSA 2H1CA 3VR3A 2P2YA 4DNXA 4QIHA 4W5OA 1TK3A 2W6JA 4PFQA 4DNOA 2G1JA 4NJOA 1L3CA 3LI2A 4IIJF 3FOCA 2BMWA 4ML3A 3R76A 1ZQ1A 1C4WA 2VP0A 1PCXA 2WD9A 1QQAA 4I6EA 3LE8A 5D01A 5CPBA 4A9AA 2FAXA 3ZV7A 2P5YA 4XRGA 3QLUC 1VM6A 3L7AA 3KSDO 4JI2B 5HDBB 3N74A 4LWPA 1J9GA 2HFKA 4OFZA 1RHMA 2ZYWX 3E3AA 1BDMA 4MEJA 3MPUA 1L5WA 2H1WA 4M1OA 4IZ6A 3ZV6A 3PPXA 2WWYA 4DXAA 4BX9A 2ZFUA 2JJ2A 3L6CA 1G18A 2QYOA 1QCYA 2JI7A 1K63A 3D64A 5KQRA 3BULA 1NLUA 3TQSA 5TVGA 2RAPA 4KQGA 4NFHA 4FYXA 3ORHA 2HAKA 2FR0A 2J3HA 3BXHA 2H1SA 4MGEA 3O3MB 4NOMA 4PAGA 4EG3A 4XEHA 5JQWA 1DX6A 3U3RA 4HAOA 4GXNA 2Z58A 5GWXA 4BFWA 4EUNA 2IIVA 2OG2A 2PBFA 1LDBA 1C0IA 2OOSA 4FK8A 4URZR 3NPMA 1H9AA 3L8YA 4NYIQ 3WYEA 4ZKDA 4OCZA 2AX4A 4OMCA 1YOBA 3DKIA 5CA1A 3AKYA 3K1AA 1IBKB 4NK4A 3Q5EA 4KR7A 2J9YB 4EHHA 4CT5A 4NJMB 2FQ1A 1Z6TA 3I1FA 2WB4A 3H87A 5BSEA 1RR6A 1EP9A 2JRLA 2C07A 3PDJA 2OB1A 4S1OA 1EESA 1PT5A 1E9EA 4XQCA 3WGKA 3OHPA 1I0LA 4D5EA 1U2EA 5CXSA 3ISVA 2EQ5A 3G1WA 1X9GA 3T41A 4OXRA 4OK5A 1VJRA 3VNQA 3HP4A 5ALYA 1NVAA 4K2HA 3GUZA 2HF2A 2O48X 4ER7A 2WVJA 5EKXA 1UZMA 4KQ6A 5AVYA 1EVLA 4CMIB 5KTNA 3VTKA 2C8KA 1UFKA 2D0IA 1ZUHA 3QWIA 4OHMA 3G8YA 1NLMA 5T8KC 2CL5A 1V16A 2DC1A 3FAKA 3MTBA 5K6AA 3U7FB 4MKGA 2ZBDA 1XVVA 1N2HA 3LO5A 4TOIA 2F67A 4AKIA 2XTAA 3HO1A 5HE9A 4DMGA 1CZUA 1PR3A 1R0CA 1MBZA 2TMGA 1FS4A 4WBXC 4UXJA 4Z9BA 3T3EA 4BLWA 4IG4A 1QDLB 2RARA 4QU5A 3LOUA 5HJ7A 3T1YB 2O3RA 4RVGA 3DL7A 4RH3A 2H2GA 4KRYA 3G2KA 1HDOA 1FW8A 3A1NA 2HZBA 2BRUC 4EGSA 1NR1A 2QSJA 1SQSA 4KX3A 1J24A 3GWZA 5AM4A 1K0FA 2OO9A 4M99A 5CFRA 3IA2A 4GMDA 1A82A 3ILXA 5I9TA 4JUDX 4C29A 2F9LA 4QOIA 2O01F 1POXA 2GZ3A 1OWLA 2FN9A 4DWOA 3AI1A 3HA5A 4J91A 4JBWA 7YASA 3IUQA 3IOYA 1JXMA 5CM8B 1FUUA 5NULA 1GGNA 5G2OA 4P34A 3KXEC 5DTIA 3QEKA 2NZ2A 1L2BA 1NMSA 1MH1A 4M8KA 1JG6A 3SNKA 1WM1A 4R2MA 3N3AC 5KJCA 1H6CA 5JXGA 4MV7A 4YACA 1Z29A 5B2EA 1THGA 1WDKA 1BXRB 3DFZA 4O0LA 3WLRA 2YYYA 4ZARA 1YAHA 3MTJA 2YOGA 3F2IA 3FSEA 1MENA 1GPNA 4JA0A 2AYXA 5EINA 3VDMA 5BSUA 4TYNA 2YIMA 4RANA 5ITUA 1D2NA 1M6EX 2QTNA 2UV8A 4XM0A 1BQEA 4TUYA 1Z6XA 1IBSA 1CQJA 1TF7A 3HKEA 2HU8A 2B4YA 1JEYB 2BMFA 3U3XA 2FFAA 4UFOA 2R8ZA 4NCNA 2P9EA 1BRTA 3GVCA 5IK2A 1T2EA 3EZ9A 5FO1A 3K9BA 2WA1A 5FEMA 4M7PA 1LZLA 2NGRA 1NMXA 1UWKA 4O02B 3VQTA 3C3WA 2IVZA 4YAEA 4E51A 3LVWA 4BO1A 4QGHA 5C31A 2W2KB 4DLSA 4OL0A 3PFFA 1OLUA 2ZUDA 1WB9A 2VP2A 1BN6A 4F4DA 2P2NA 2ILTA 3LL7A 3VPBA 3ET5A 2GJ4A 4UHFA 1UPTA 2I65A 1R2ZA 2IYLD 2AYYA 3F96A 5HWSA 2D6FA 2NZ8A 4RVNA 121PA 3PITA 3K5HA 1JALA 3GFGA 3M9LA 1MORA 4RD0A 4DJFC 1D1QA 3H5NA 1NBAA 2IZZA 2YFHA 4M1YA 4JYAB 2X23A 1CRQA 2VHTA 4OW0A 2DNAA 3BD7A 2YN0A 4FX2A 4LS3A 1JW9B 3N53A 5SV2A 1RWMA 2G5PA 3I05A 4PSAA 4C4RA 1G4UR 4R8RA 1MG5A 3T9BA 1QQBA 5KHAA 4LZOA 2EBWA 3CNBA 5F64A 4GOKA 5HUJA 4R8MA 1T3SA 3N6XA 2V5AA 1Q74A 5IUJC 2M2IA 2C03A 4MW0A 1G2PA 2ZRLA 4GIPA 4DV3M 3EGEA 2GZSA 4UCQA 1IBMM 5IDXA 3ZE2B 1SZCA 2ZCVA 5COBA 4AJPA 2PPLA 3T7SA 2BR5A 2W2QA 1RCFA 3DM9B 3WKEA 1P4SA 4LVOA 1PS8A 4O8CA 1I8TA 2RGUA 3TOZA 2B1RA 5A1JA 1JDUA 1A95A 3U1VA 3TVDA 1S2IA 3KLNA 2I9PA 3EPRA 1OA1A 1ENZA 3MT8A 4B7XA 5TS2A 3VDUA 1J09A 4KZKA 1JSCA 1R16A 1ZMWA 3KSJA 5GVSA 3BH6A 4DMFA 4XWTA 4GYYA 2QAIA 1R3UA 3DBHA 1AQLA 2QX9A 1ECLA 2R68A 4ER3A 3ABRB 4R5HA 1TMGE 3LK7A 3ZU5A 1G20E 4EJSA 3ES5A 2X86A 3LPNA 3WYCA 3RTBA 4K0KM 3RAFC 2NSLA 1RQNA 3C3AA 2HZ7A 3JR4A 4YJHB 4UNNA 1Y0BA 1X13A 5DULA 1BO6A 2CF6A 1SCUB 2FZVA 3ABIA 2II6A 5KKAA 1T29A 4TXJA 3HNOA 5EIFA 3GARA 3V1KA 3FYUC 3M6AA 4WXMA 4IHJF 3UHOA 2GASA 2DG2A 2C98A 2WU0A 5IXJA 4NCHA 5AXBA 3KQKA 2VDRB 1LH0A 2EKKA 1L5NA 1KEEA 3JCZA 4YH1A 4KUEA 1LLCA 4OX9M 1OKKA 1JAIA 5A1TA 2O8DB 3W2GA 3PTZA 3P0IA 4PF1A 2QQ0A 5SY9A 1D2GA 4YMHA 1Z28A 3TG2A 1NN5A 4X7PA 3O8DA 3N3BC 5EZQA 5JZOA 3OJWA 4GICA 4F4CA 2W0SA 4WLOA 3R3ZA 4JYPA 4C6HA 5IT4A 3OI7A 1BMQA 1COWA 3FPBA 5GJCA 4JVMA 4HI0E 4BNLA 5HX7A 5I9SA 4C5BA 1ADYA 1L4EA 4OSPA 4G36A 1FUYB 4CMEA 3OF3A 5KKCA 1KY2A 4A0QA 2XW6A 4YQZA 1KETA 3QF7A 4Y6SA 2N46A 3V1NA 3SAJA 1K7EB 1JKJB 3A1EA 1HNXB 3FLEA 4RLSA 4DLPA 4PX3A 1O4WA 2GKOA 1Z5NA 5TRTA 3AM5A 3SFZA 2IHTA 1EGMB 4HHEA 3PUWA 1TQ4A 3EA0A 4DSUA 1V9SA 1CZHA 1PFUA 5K0FA 1L5GB 4MROA 1Z5VA 2UKDA 2PX8A 1AQIA 1DAHA 3ZW8A 1GN8A 1IRXA 3KKMA 4X62B 3OBIA 4JKIA 3WY9A 8ADHA 1G8JA 3T34A 4BC0A 2GPYA 2Y3IA 5SICE 1P18A 2YZKA 3MOSA 3ONVA 2WTEA 4WKCA 4PHFA 2APJA 1QQ6A 1GTL1 3X44A 4DA6A 2X1LA 1AU9A 3LHDA 1AO0A 3F1KA 4R01A 3M0EA 5ECWA 5ALXA 4BLTA 3LWBA 2ZLBA 2QTVB 1ZMOA 2PE5A 2GA8A 1X9HA 3UPUA 2ZUWA 4RGBA 2XBUA 1IY1A 2J3IA 3ZJTA 3KLMX 3VZQA 2C1XA 4CV1A 3GX1A 5DNUA 4Q47A 3WWEA 2GVDC 3VOTA 5CXUA 1G8AA 4XYMA 2OENG 3LBNA 3CWCA 4EVIA 2H1RA 5BMOA 1R9JA 1Q50A 2J0UB 2WF7A 5C9ZA 2E0IA 3B1ZA 1K7CA 4EO7A 5EIOA 5FR2A 4AMYA 3FSGD 4GLOA 4F46A 1F8XA 4LRWA 1IPFA 4RM3A 2ZYRA 3N2KA 3ISTA 3VTZA 2ONZA 3P32A 3SWWA 3EDQA 3IL2A 4KACA 4M7WA 2OBNA 4DXHA 2FMUA 3PNPA 2VSNA 4MO2A 1E96A 4C0WA 5JWRA 2QRZA 3WBKA 3JYNA 4PXYA 4QUEA 4YLGA 4JB8A 4K9LA 4BECA 5E4YA 3ORYA 3RBVA 3VX3A 1HL7A 2AS0A 2X9NA 1XNRB 3OZVA 4PGFA 1KDTA 2HY7A 3MT7A 3D7MA 1Z0IA 2AQIA 4KP7A 5B7NA 3I5YA 2ZUTA 3GMSA 5BWLA 4WP2A 1XCMA 4EB0A 4W6ZA 3O8QA 4HDOB 2F4VB 4HWTA 3NGMA 1PJ3A 4CVNA 4BMZA 1SQ5A 2XEDA 4FR5A 3WK9A 5DYWA 3UC5A 4LRXA 2VAVA 4OX9Y 2CSUA 1M8PA 1I4OA 2H4WA 1JS1X 5M5BA 4B48A 3L0SA 3NRBA 2NXCA 5LJIA 1QO0D 2XMSA 1ZUIA 2QBYA 1EVEA 1GCOA 4NENA 1ZOOA 3PQFA 3L0PA 2WAAA 1KZ4A 2DHYA 3T9AA 4ITRC 4YJ3A 2PS1A 2Q3FA 4OBWA 1RQLA 2YW2A 4F9TA 2DI0A 4OUDB 4B35A 5KU7A 5LYJF 3U1BA 3LHKA 2I71A 2C7RA 1EYZA 2SKDA 1XZBA 1K6JA 2XE8A 2WQ6A 4DRXB 1YR2A 3Q6MA 5HKKA 2J3LA 4RMIA 3UAOA 5ESDA 2A7QA 5LMUB 4KREA 2JBHA 3CX7A 2BKUA 4H9GA 2YV5A 2R47A 5FWYB 2C9MA 3ROGA 3HZJA 1T9KA 3TK1A 1IUNA 3FFXA 3QKTA 1L8AA 4BBAA 2Z08A 4KDFA 4B3TB 3TF5A 4F92B 5CT8A 5GP1A 3CBQA 2FN7A 1DTWA 3DC7A 2D7HA 5A7HA 1ZN8A 1PGQA 2ECQA 2FWIA 2JGNA 5A4DA 3QBEA 4EMSA 2UYCA 4INJA 1XZCA 3A11A 3HA3A 2HBZA 4WERA 4IVQA 1O97D 3SXPA 5G1PA 4JVSB 3WLSA 4M0EA 3ZHCA 1DJQA 1Y3DE 1HPLA 3CH4B 1JDBB 4GPEA 1ZEMA 3FCCA 4L9SA 4CQNA 3UMBA 4Q19A 5EGSA 4C6TB 5ECYA 1KYVA 4BE7B 2G67A 2QXUA 2VJAA 2VSYA 4X65B 3D3EA 2P9TA 1BNCA 2IPOA 4ZYUA 4LC0A 2JGIA 1EBBA 4DHWA 4EH1A 2H9IA 2JFNA 1RAGA 1XD9A 1CC1S 4G84A 3W1EA 1PL0A 5G0TA 1ZRMA 1QG4A 3F67A 3P45A 4J29A 1RRFA 5BR8B 1G8KA 5EVCA 1GZDA 4NG5A 3M49A 3D1VA 1GEGA 3HUEA 3HHWA 4NRWA 1IOWA 3M2TA 3BXZA 4YO7A 3EDMA 1ESMA 1XQWA 5HQ3B 2KLBA 1UT6A 4MV9A 3COZA 4BP3A 5BUSA 2VNIA 4HG2A 3DV0A 1IG0A 3HZZA 1QFJA 3TBFA 5CIYA 1QHIA 3SKVA 4TWRA 2X4LA 5KO3A 2QORA 5H5JA 1M66A 4QOEA 1UDRA 1ABBA 3E9EA 4LJKA 1E0SA 2VZEA 4B7ZA 4BDTA 1SOUA 1ILEA 1MN3A 4IDBA 2C2KA 1JIVA 3FTEA 3QGMA 4CKWA 2IA5A 3EZNA 2W58A 4G0WA 5I4KA 3TJMA 1GO2A 4V39A 3HR8A 3THYA 2G06A 4DPMA 5AJWA 2WOOA 1DBVO 4E22A 5CB8A 1SXPA 5BNWA 3EGCA 2VJPA 1Q15A 3IEUA 4XVHA 1VBKA 2Y92A 3OPMA 3GGCA 1L7BA 2I99A 3ZU4A 1XU9A 1WUTA 3G23A 3FCUB 3DWIA 3CNOA 3HN7A 4K1XA 1M34A 2J9ZB 2AD1A 4MMXB 4JT8A 5HF9A 4MR9B 4TROA 3TLKA 3N6RA 4Q1BA 4GKAA 1JE0A 4M0UA 4YIKA 1KJQA 1RE1A 2B25A 4E2FA 1NUUA 1TF2A 4Q3LA 3F98A 3ROKA 4P31A 3ZHYA 2LXNA 1E3QA 2QVBA 1GLGA 3RUFA 1RYHA 3NANA 2BEJA 4YP7A 3OU6A 4RENA 2WFZA 3L93A 3KQLA 1DS6A 5DN6A 1BDBA 3HADA 3UGTA 4QGBA 5JIBA 3HDYA 5F98A 2JGFA 3CLRD 3HCWA 3C15C 3V7NA 4PO8A 3LIPA 5HOQA 1QDTA 2UXBM 1U5AA 3JPYA 2J0EA 3OCVA 5BP7A 3JAMA 2WJIA 1XTSA 4G0UA 2UYHA 1IY2A 3V76A 4JVLA 1YFLA 1GN9A 4ZQFA 1J2TA 5DM2A 4QO7A 4IUDS 4P0QB 1NVEA 4CG0A 5CLLA 1IJFA 2H5XA 4W6QA 3BL6A 4D2IA 1K3TA 2PQ0A 1HDGO 5DSZA 4O33A 3OQ1A 2YFYA 3CVXA 3W6PA 3THGA 1F17A 4R1MA 4PQFA 2ZYSA 4ENSA 2OHOA 4XUDA 4NV1A 3DDUA 4G0OA 3A9UA 2LCQA 4ENQA 1GFIA 4C2AA 3UJ7A 2HCRA 4FVTA 3CZ9A 3LECA 4M0WA 2F3QA 2OXEA 4IGEA 1Y89A 1TKBA 1F20A 2QNIA 3H04A 1DEKA 2SCUA 4DY4A 4G5QA 4F72A 4QYIA 4QVGA 4NEGA 3AJEA 2VT3A 1GAEO 4UM9D 3COPA 3GLFB 5LN1A 3LA6A 1YJ8A 1N6NA 3BKWA 1ZI8A 4P8RA 1CF4A 1MP0A 4YJDA 2DFVA 3I92A 3ZQKA 2X2PA 4D8TA 1NVBA 4G0NA 2WE8A 3B60A 1MPXA 5E4FA 2C7VA 1QUEA 1IIBA 5HOEA 2WTNA 1JR2A 1I5EA 1FU8A 2E5LB 4HTFB 2I8CA 2XGGA 4KWHA 3DYVA 4Q1AA 3KP1A 4I2NA 1Y8ZA 2DRIA 2F9FA 2FF5A 3QMVA 2MR5A 1MR3F 3GAMA 1L2CA 4JBYA 3F9RA 1GGEA 1MAAA 2PX0A 1AKWA 4Y9SA 1OASA 3FGNA 4O2BF 4F11A 4GXRA 1N92A 3IEMA 2BUCA 4B7AA 1ACJA 1EWYA 4C20A 2H1OA 1PSDA 2O5VA 5ADUS 3C1AA 2QVYX 2PYIA 4TLLB 3LY8A 1GZ7A 1DMSA 3N76A 3OJOA 2XVYA 3TEJA 4I55F 1GY8A 1KQNA 4BNXA 4OI2A 1X3SA 3T5GA 2PUAA 1CULC 3K09A 4CWAA 7CATA 2F43B 4HYQA 5IC6A 4E94A 3PJFA 3VHXB 1M33A 3P5SA 1UAAA 1EK1A 2EP7A 1S2GA 3ANSA 4NAUA 3NKVA 3VNBA 4AZWA 1PWZA 2HIHA 3FSRA 5H68A 1XMOB 3LP6A 4AWXA 5AJTA 1LLUA 1XT6A 4NH0A 4NYJQ 3GPPA 5A7FA 1QFMA 1R4NA 3Q6IA 3K9LA 1NR5A 1U3FA 3QLJA 4P3PA 2UZ0A 5HTKA 4Y2VA 5AJHA 4FYMA 5IN5A 3GRCA 4TRMA 3SZGA 1HDRA 4KWCA 1WHSB 4YT8A 4WJKB 4CN8A 2YYAA 3CVYA 1FP4B 1XHEA 1I1QB 1LK5A 3KEMA 4B3RM 3HO6A 2BFOA 2WUVA 3R5SA 3TX2A 3D02A 5EE1A 1NW9B 4BC1A 3HDTA 3CRW1 4CI9A 1UKZA 3V46A 1VKJA 1HF3A 3ZEAA 2GBPA 3R2JA 1EX7A 1RPNA 1T5SA 5HEKA 1ZWLA 1P2VA 2PWBA 3KKEA 2WZQA 1P60A 1UK8A 4CL8A 4MVWA 2BBSA 2O50A 3U4GA 3NTLA 3GLUA 4CJXA 1J06A 3TOSA 1KJJA 4GOLD 1DDGA 1SHZA 4JL6A 1E1CB 3OUZA 3ZIAA 1JIKA 3RF7A 1U5BB 2Q3BA 3OHSX 4XGQA 1Z22A 2JC3A 1WSWA 3ADKA 5IANA 1I36A 3ZY2A 1AUOA 1PR0A 3VU9B 1FJGB 4FYWA 1NURA 3PRYA 2OAP1 5BN5A 4DV7B 1KJWA 1JH8A 1SA0B 2PQMA 2PUDA 4IP0A 4P36A 2AEMA 2HRBA 1AKTA 4ZKEA 2VTBA 3DO8A 5KPZA 3RJZA 1U0EA 3HCBA 2Q3JA 3FWKA 3RVQA 2GAIA 4C7OB 1HE1C 2XRMA 3NUZA 3T9FA 1LTQA 1DC6A 2BGGA 4OLAA 2QR3A 3WRXA 1PT6A 1TZJA 3UTDA 5IKOA 1R2YA 1RLUA 3ADPA 2AI1A 1O77A 1QV7A 4JV5B 3CUVA 3LC7O 3LP5A 4RNDB 4O5OA 4A8TA 1JEJA 3DDNA 3JASA 4XEUA 3R7LA 2N0SA 2PV7A 3KQSA 5ESWA 5H82A 3TLJA 3PGKA 5JNVA 4V0QA 4TKUB 3D6UA 1WXGA 2GDZA 2VJNA 3VJRA 1NR7A 2XE7A 4U00A 2VK2A 4GPBA 2YC4C 4P98A 1TVKB 1HEIA 3W9SA 4JZYA 3WC4A 5EZYF 1FDOA 3TW6A 2F4NA 2GS9A 2MR6A 3UJ8A 2CHVA 4F4UA 2ZB8A 3VPHA 1P2BA 3FPHA 1T5IA 3WGVA 3KB2A 1LJLA 2WZJA 4FD3A 2VDNB 4V1CI 4LYFA 3UZUA 2UXCB 4L74A 1DFIA 2OCBA 4V0OA 3HXPA 5J23A 1N34M 5TEWA 3UW3A 4TKVB 4B73A 4JC0A 1RJFA 2MSNA 5KQLA 1W47A 3OURA 5KDDA 3BTUA 4BFUA 1CB7A 1Y3AA 1U3UA 5B64A 5I7WA 5F77A 5KB3A 4K6KA 3NTRA 5DLQC 4FFPA 4HRYA 1KNXA 4GRIA 4IGFA 5DI9A 2CJFA 5GKNA 1QZUA 2RE8A 4BEVA 3EVZA 3FTNA 1VEKA 2G76A 1MPTA 5HCUA 5IG2A 1DAIA 1OVGA 2WUWE 2B2XA 3PD7A 1X1EA 3HYTA 3O95A 1YRBA 4FXPA 5KREA 1C3VA 2GN4A 5ED0A 3F6RA 2GZRA 3KQQA 1N2CE 4C07A 5ARBA 3D4NA 3WWOA 3KAPA 4JCOA 2ANBA 1R9NA 4BU0A 5CBPB 4KO1S 4BX2A 3PENA 2ZB2A 1THTA 4GR5A 4BAUA 4RQUA 3CLTD 3QPWA 3ZLVA 4KC0A 3HC7A 4D42A 1U0FA 3OPYI 4J07A 5BVHA 3KSMA 1C81A 1RP7A 1HBJA 1SUIA 3JAWB 2I7TA 3F73A 1PAUA 2VJMB 3QLVC 5L8RF 3A4IA 4Q7QA 2X7XA 4KE7A 1BVHA 4HLUC 4US1R 2ZBEA 1JEDA 1AE1A 4EYGA 4XCVA 5THQA 5CB4A 2IP2A 2GPSA 1JAHA 1XKTA 3GMTA 4FPXA 4NU0A 5DNYA 1RBYA 3GDHA 5EEHA 1YBAA 4BP9A 1ADFA 5TMDA 5LBIA 2WYWA 4K5QA 3PJRA 5BWMA 4EJFA 3Q7TA 5DHSA 4E88A 3GLRA 4ZOLA 4MGKE 2R11A 4YAOA 2VXOA 1XNGA 3TCNA 4J3NA 1KR2A 4J4BA 4OIFA 3WYDA 1PJSA 2ZK7A 1DFHA 3GPLA 1I0IA 2FPIA 3JV7A 2EJWA 2R6R1 2DUWA 1N2BA 3BXPA 1OB5A 4KPEC 1IOLA 4DIOA 1QYWA 3EVCA 4DT1A 1PJ4A 5KNDD 1RYMA 2JBWA 2WSSD 4UHKA 3HHPA 3B74A 5KOIA 3FKQA 1TADA 1FVOA 3W1WA 1YDWA 4XAQA 1T2UA 2XXJA 4N3CA 4EMBA 2Q21A 1G5IA 4H1WA 2W43A 2GEKA 3KKKA 2XF2A 2NQ2C 3GDOA 1YI0A 2XT0A 1EXNA 1QQ7A 5C4GB 1BFUA 2Q0QA 5C8ZA 2JNWA 4CR6A 4J7CA 1Q11A 2CKMA 3EDCA 2DETA 4KYUA 6Q21A 5MFZA 3CVVA 3AUXA 3TLZA 3QMPA 1EFRD 2ZPAA 2L4FA 1XSEA 4LG1A 1YC5A 2FLKA 3CY6A 1YRHA 2ZAIA 3RK0A 4XVQA 1QVZA 4KO4S 2WAMA 4C0QC 1RXYA 1QYRA 5FHQA 3O8NA 3EIEA 3GOHA 4XSHA 4ZO7A 4IMJB 1SNYA 2P2DA 4E13A 3ZGLA 2HXSA 4CRWB 4HRAA 2OMKA 2YJNA 3BREA 5JYEA 5LKRA 3RRXA 3LTEA 4TYMA 4CCWA 1I5RA 4H7HA 3OE5A 5I9IA 1U8ZA 4KOAA 4IXTA 1FLNA 4QJBA 2CXNA 2WWVD 3HJAA 5D87A 2VQEB 1KZ6A 3KOUA 1C1HA 3UOAB 5JVDA 2G9QA 2WMYA 4FJ0A 3AHDA 3QVUA 2I1WA 1V8DA 5K01A 3I28A 4QT0A 5MFPA 4MB7A 2QT1A 5JUWA 1MXFA 4MLZA 4Q9IA 2X4IA 2PUBA 1PTJA 3UH0A 5KOJA 2IE8A 4F2WA 2Z6VA 5C5CA 1BKDR 2I6QA 4J6FA 5B57C 3B2EA 2ORYA 2ZR8A 5L6LB 1D8TA 3PEUA 3QHAA 2OZLB 4PPQA 1MOSA 1J1ZA 2QRVB 1KDYA 1GL9B 4QTUB 1B73A 4PQEA 1V1RB 3C45A 4K9KA 3LRXA 3DF7A 3K1JA 2ACKA 3GLSA 3GQ4A 1KSGA 3SYRA 1WNFA 1EGVB 4RZ2A 3O9MA 2FPMA 1YIDA 5ALHA 4L85A 4K6MA 1YUMA 2XX3A 3DV9A 5KMGA 1RWXA 1XDZA 2FFRA 4NRVA 2QTFA 3EC2A 1B2LA 2HU7A 4Z1MD 2RAFA 3R74A 1U0NA 2AK3A 3GDWA 4XWGA 4CODB 2OLKA 3TWLA 4X8LA 1MTOA 5JSYA 3W90A 3ETHA 3RHTA 3LKBA 2QQGA 2P41A 2ZWMA 2ZCJA 4ZA2A 3G13A 4RD4A 2AMFA 1VLMA 4YRBA 4DKXA 3BGWA 2WYIA 3WTBA 3L2OB 3PYLA 5AKLA 2VLBA 2H3HA 3K0SA 4NBKA 2HM7A 4IICA 7ADHA 1Q0HA 3R8XA 3QKRB 1NULA 3H5IA 1P3Y1 2CY0A 1QE3A 2A0UA 3C87A 3OZEA 4Y6GB 4D9HA 4RAQA 1TJNA 5T67A 1DELA 2QL5A 4RHFA 3TAUA 4H7KA 1REQB 4M21A 3NOOA 4EKDA 1EZZA 2OE2A 4EYOA 1V3VA 3FHCB 1QBKC 1ZUNA 5H0IA 4B82A 2YWRA 4AZ3A 2JAHA 4GZ3A 2ZYVX 2AEJA 1KH1A 2AN1A 2AXNA 5AW4A 5AQEA 2AOWA 1VLJA 2D0DA 1I4EB 4G1EB 4RF4A 1HLFA 3QUSA 3MOIA 4BV2A 4UTZA 2FJPA 3LZ6A 4HFMA 1XFAA 2I34A 5CHYA 4F3RA 3L92A 3REQB 5JD4A 3MD9A 2ZM6M 3R1IA 3P9PA 4G5OA 2F3TA 3ZLJA 4OHCA 3WLEA 3L4JA 1JDVA 3O38A 3MCUA 4KQ9A 1P4GA 4ZT5A 3SXUB 3DT6A 4IDAA 3G2NA 5A5DA 2ASEA 5H80A 2I4IA 2PGOA 1CP2A 1RYNA 3HVRA 3O4HA 1T3TA 1SIUA 5KJ6A 1NWHA 3P20A 3RS8A 1L4GA 2NXNA 1VYVA 1RBQA 4G09A 3G7UA 4GXTA 4IW3B 1ETHA 3OEWA 4HT3B 4DV5B 1P91A 4Z3OA 4ZTBA 4ECAA 1VCIA 4UUAA 3T95A 4K81B 5IVDA 3KO8A 3TGWA 2QX4A 2FG6C 2VFAA 5A3JA 3Q4GA 4DR3M 3TZBA 3GJTA 5K8JB 3WDSA 2AFIB 3OQMA 4MI9A 4NFYA 2H1IA 2FMHA 3SN6A 5H83A 4GC5A 3JAKB 4A2PA 3I3SR 1NSFA 1LBQA 3NHBA 4WOCA 1RZUA 6AT1A 3L4SO 2O4UX 2QXYA 3LUJA 4BVJA 3PL5A 3O0TA 4AJ9A 3X2EA 5CCXA 2Q6IA 1NP7A 2KBFA 3VYUB 2H17A 3PQ5A 4F4IA 3IHWA 5FI1B 1NBOA 1MV5A 3HY4A 3R24A 4Q4JA 4DLKA 1YQEA 1N77A 4X94A 3K70B 4EY8A 3F6SA 4CMAA 3GQ3A 3FCSB 2EFYA 1HZZA 3SVTA 1CT9A 3MBKA 4PLVA 3VTAA 3RK4A 1NUSA 1WLYA 3KKOA 3TL4X 2MTBA 4EHBA 2ZT5A 2DFPA 4V38A 4HK4A 1ODIA