3U61B

Structure of t4 bacteriophage clamp loader bound to closed clamp, dna and atp analog and adp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
305
Chain Sequence
ITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 95
structure length 305
sequence length 317
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u61B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u61B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u61B01
4UNRA 4PR0A 5FBVB 2AN9A 2GAOA 3GJ0A 5EXTA 5A5GA 4I4LA 3QBTA 2XZPA 4TL9A 3VHLB 1W4AA 2DWOA 4JJKA 4LYJA 1ZMXA 2XOKA 2QAGC 2JJ2A 1GL6A 4AURA 4QKQA 1W46A 2AHOA 1G64A 1KI7A 4FWIB 5FBLB 3QBVA 2UZIR 4AC9A 4C0SA 4XWOA 2DFLA 4L16A 4AKIA 421PA 2GVDC 2C9OA 3BH6A 4B32A 3TNFA 3THXA 1JEEA 3BFKA 5HZHA 2HCJB 4LJYA 1CJKC 3SJZA 4C0AC 2RGXA 2VQSA 4Q48A 2UVQA 1PLJA 1D8TA 2OE2A 3TE6A 1ZYUA 3IO5A 5KHOC 3R7WA 1VDZA 3QPVA 4TSFD 2A2ZA 1QVRA 1DPFA 2XTNA 3U7HB 1PJRA 2OAP1 5EZ6B 4DLTA 3DZ8A 4DWJA 5BYKA 3DPUA 2C5LA 1V5WA 1XXHE 4L9SA 3QSYA 3T61A 2XSZD 2Q21A 1IY0A 1W0KA 2KI5A 1KAOA 2I1VB 2D2FA 5HCNA 2NGRA 2VO1A 1E2QA 5FUXA 1ZC4A 1QHIA 3OE7D 3H0KA 3U3JA 3VAAA 2CHGA 4R71A 5G53C 2CBZA 2ZRHA 2J9RA 3K09A 2WKPA 1XP8A 4M1TA 5CJ2A 1JXMA 1C1KA 1XD9A 2CEAA 5C4GB 5FOWA 4ACBA 4B48A 4OHXA 5JBQA 4TTRA 1ZUHA 1SXJA 2C04A 5AWFC 1CR0A 1XJQA 2Q3FA 4EPYA 4DBLC 1G5PA 1HUQA 5FPHA 5TDHA 1AKEA 1IN8A 1JPJA 1CF4A 4Q21A 2IWRA 4WVFA 2D06A 4QNRA 2CJWB 5GJCA 4D0GA 1PV4A 1YR7A 1KZGB 1S4QA 1EG7A 2XEXA 3ZIAA 3EIEA 2IHYA 2BEJA 5JWOA 3K0CC 4BLOA 3LH5A 1X8KA 4YC7A 4M1KA 2P6UA 4US2R 3T12A 2R2AA 4WXPA 2HT6A 2OM2A 5FPYA 2GJ9A 1GAJA 4OHYA 3U4QB 4LJ4A 3FKSA 1E2LA 4XD7D 1QVAA 3LBHA 1Z83A 2B21A 4OK3A 2CVFA 4F91B 2I1QA 2QENA 3FB4A 1N5KA 3IBGA 4U5XA 3KTAB 1YZGA 4BFXA 3ASYA 4M21A 3KZ1E 4XH9B 1IAQA 4M1OA 2OO7A 821PA 5LD2B 1OLOA 4Z8XA 2O8EA 4MA4A 4I1OA 5AR1A 1QZMA 4DRZA 2EFHB 4ZIRB 4B3DA 4EUNA 1VYVA 3PENA 3WMFA 2FZLA 3Q9LA 2QMEA 3QF4B 1CJTC 4TTPA 2W0SA 2ZI3A 3MWJA 5FUYA 3U3OA 2AR7A 2JASA 5GJBA 1G1MA 1RZ3A 1E0KA 1COWA 1Z8FA 2AD1A 4OI0A 4LV5B 2F55A 4C0JA 1ZD9A 5DHAA 1U0LA 3KDSE 4NPHA 2SHKA 1HT2E 1Q22A 1OH6A 2XJ9A 4MUBA 2HXYA 1DAHA 5LBIA 4C30A 3V4FA 3BOSA 3VMFA 4A0RA 5CB8A 1OHHD 1Z6GA 3EARA 1KDPA 4R2IA 5JHHB 1E2GA 3RC8A 3I92A 4C2UA 2FG5A 4IKEA 4P0TA 3LXRA 3ETLA 1XTIA 4D82A 5FI0B 2JLVA 4IDHA 2VA8A 3ZJYA 2CLCX 5CK5A 5BN4A 2EYQA 1MO4A 1Z0FA 5IDVA 4RJLA 5C2JB 2ZJOA 5JCPA 4KITB 1OB5A 1IN7A 4EDHA 3A1UA 4LUCA 4B75A 3HU1A 1QHHB 2ZE6A 5E95A 3P32A 4Q7KA 5E4FA 1F2UA 4M22A 4RZ3A 4OQXA 2JATA 2O8BB 2XJ4A 1NBMD 4QGGA 4FMDB 3U3MA 3S1AA 2C9YA 1T5IA 4LHYA 4ZDWA 1DVRA 4V0ME 3GLGA 3UANA 4B3BA 3QUSA 3GLFB 2FWRA 3A58B 3LBNA 4JLVA 2PZEA 2ASEA 5LB2A 2JLSA 1VG8A 2BHRA 2NO1A 4QBIA 2W6ID 1W48A 3ONWA 3LWNA 4V0KA 4B74A 1MABB 2YNMA 5HE9A 1J2JA 4JT2A 5CB6A 3B9QA 2C99A 1N2CE 4JLDA 4LBVA 4B35A 1OXSC 3LX8A 4LRWA 1HH4A 5AJXA 2WJVA 3PUZA 4XJXA 5F2EA 2AFHE 1YRAA 2RGCA 3VR2A 3FKQA 3V4RA 2XGJA 1TNDA 3O8DA 2E9SA 2F43B 3GEHA 3CUEF 3FDIA 1Q12A 3O47A 4KXFB 3UKDA 3EXAA 3UMSA 4ARZA 3GFTA 3K0CA 4LOAA 3AJIB 1XPUA 2ZYVX 1UFQA 1TU4A 4OHVA 4Q47A 3EPHA 3I32A 3HU3A 2ZJ8A 4PC7A 2XB2A 2H7VA 1I4TD 3DL0A 3CBQA 1SHZA 3K0AB 2ZSFA 1W4BA 4LRSA 1E2FA 4DIDA 4E22A 3A1TA 4PANA 2R9VA 2ZSDA 4KFSA 1DADA 4MYHA 1AGPA 1NF3A 2WAXA 3CRVA 4US0R 3LO5A 4DJTA 2AD5A 3LQQA 5C1BA 2MSEB 3QKTA 4MRPA 3ZZTA 1W36B 1G7SA 4URWR 2V6JA 2GJKA 4URVR 2YWGA 2O0JA 2WTUA 1NMXA 1EFCA 1XD2B 1YQTA 2IYTA 2NG1A 3C5CA 1FQJA 5KSZA 1QHGA 1RFLA 2JCSA 4GNKA 4Q4HB 1YJ5A 2A5YB 2Z0MA 4YMVA 1CEEA 3CRMA 4O0MA 2VRWA 2XITA 3MWLA 1DAKA 3MD0A 1VECA 3PEYA 1SVLA 4QG7A 1UBCA 4TSFA 1XMSA 1OF1A 3CF6R 4TLAA 2QEQA 1EGAA 3OIYA 3A1WA 5K8UA 4JKIA 4WOPA 1F60A 4DCNA 3DDCA 5FTKA 4DCSA 2XSZA 3F0TA 4IEEA 4OKSA 6Q21A 5K8IA 1NY6A 2ZU0C 3PFIA 2W2TA 3LDAA 5E3HA 2QAJA 1YZUA 4F38A 1YZKA 4D6PA 1G8GA 3ADCA 1SULA 3FVQA 2ZEJA 1Q1ZA 3QEJA 1XMVA 2GETA 1X37A 2QM8A 5J4VA 5LPNA 1K8RA 3PV0A 2LWIA 3L0PA 3ADBA 3AEZA 3BERA 3WNCA 3NWJA 1A7JA 4FW9A 2C03A 5SZKB 1G8YA 4ZCLA 4HLUA 2CK3D 2DWZB 1JEDA 4D4KA 2FSHA 2OHFA 3GFPA 1W4RA 3LAWA 1N6HA 1E2NA 3PUWA 5EJEA 3ADDA 1XZPA 4MYCA 1ZM9A 4Q01A 2GK6A 1B23P 4CEJA 3GEEA 3THOA 1G19A 2DBYA 4B3FX 3D7MA 4BLSA 1SVIA 4IXMA 2I3BA 2Q9AA 3X1ZA 3BC1A 2VF8A 5HPYB 2W6JD 1XEFA 4NCNA 5CITA 1WA5A 2IA5A 1KZ7B 3GLHB 1CJUC 1WCV1 1U0JA 1VCNA 1N0UA 1YE8A 1NN1A 2IT1A 2ZJ5A 4S35A 3T5DA 1NG1A 4FWTA 1ZU5A 3A4NA 1KKMA 4PC1A 3THYB 3QVUA 1FQKA 3KQLA 4DLSA 2QMUA 1IXZA 2OV2A 4LK2A 3AF2A 2VHTA 2DPXA 5FOUA 2BV3A 2F6RA 3GLFE 1U99A 4Q1EA 3TR0A 1DAFA 1NJFA 4D0NA 3CONA 3I62A 1RPZA 4TT3D 3RHFA 1ZD8A 1ZM2A 1VYTA 3B7GA 1E3MA 3N5CA 1M6NA 1E94E 4XD7A 2ZS7A 2CVHA 4JLMA 5DLQC 4C0HA 5CYPA 2Z4RA 1TQ4A 2GXAA 1U90A 5D3MB 5DHFA 1ZP6A 3NH9A 2W00A 4XWAA 3Q8XB 3UWOA 2FU5C 3THWB 1M7GA 2R65A 1W1WA 3N2IA 1WBBA 4CEIA 5JSZA 1HT1E 3DZDA 2GVZC 4XVQA 1OW3B 1CLUA 1F6BA 2FSFA 4ERNA 3G82C 1D2NA 2OEPA 4Q4JA 2WIAA 4ASUD 1NP6A 3LA6A 1NI3A 4DLXA 4LRTA 1FNNA 1B0UA 2RGNC 2ZE5A 3EPLA 3TSZA 2WWGA 1GKYA 5J4YA 5BQ5A 1NN0A 3B82A 4PHHA 4M1WA 1TUEA 1D2EA 1GKUB 1TEXA 1LS6A 3LBIA 4M8NE 3TVTA 2FEOA 5DSZA 3GPLA 5AUOB 2BJVA 1LVGA 4HAUA 5GJVC 1OB2A 1E96A 1IY2A 4Q4AA 4TL7A 4FWHA 1VG0B 2BBWA 3B1YA 4EJSC 1JQLB 2J3EA 3K9LA 2EWWA 4IRUB 4Y0VA 1TQDA 2YZ2A 4JBYA 4TQUS 2VHQA 3FMIA 5CYOA 4HAWA 4Q4LA 4CIDA 3HJNA 3H4MA 1OHHA 1MO6A 1E4VA 1QBKC 1KJYA 1ZNWA 3T35A 3RAPR 2QZ4A 3RABA 4D4MA 2WOOA 3L0SA 2H5EA 4HAVA 2ZM5A 2HYIC 2ZRJA 4X8OA 1R7RA 2ZRMA 4GITA 1L2TA 2J7PD 4HAXA 5AUPB 1KAGA 5L3RA 2FPKA 4IVRA 3QQ5A 1LF0A 1XB2A 4LJ5A 2WKQA 2IYWA 3TSOA 3OEEA 3RS5A 2G9NA 3BGWA 2EFCB 2A5GA 1R8SA 4ILEA 1HEIA 4R9UC 4ZKDA 2CHQA 1M74A 1CP2A 4GI7A 1G18A 1TTTA 3LX5A 5IHPA 1NBMA 2ZYTX 1OYYA 3K70B 1Z63A 4P4TA 3AV0B 4IJMA 4M1SA 4B3GA 3C7KA 3EC1A 1PLLA 3CPEA 4B44A 4BE7B 3D3QA 3U3KA 5KNBA 3WYAA 3SYKA 4DSTA 1Z6YA 1NSFA 4BUJA 5J47A 5KDOA 3QENA 5CM8B 3EC2A 1UEIA 5DI3B 2OT3B 2ZRCA 3O8BA 1G7CA 4A0FA 1YRBA 121PA 4WW0A 5M04A 2IS4A 4LSGA 2QQ0A 5TY0A 5DO9A 1Q3TA 2ZJZA 4QOSA 3TGPA 5L3QB 3IPXA 4GOXA 4URUR 4PAQA 4FINA 2GA8A 2WIBA 4LHZA 2ZR9A 2FSIA 1CS4C 2O8DB 3TMKA 4JS0A 1YR6A 5K8LA 5AJVB 1IOZA 5G41A 3ZVRA 3GLHE 3KXKA 2QU8A 3MJHA 1E0SA 1NVXQ 3L8YA 4P4SB 1DAMA 4M53A 3PUVA 3PUXA 4ZV4A 3QXXA 3NEJA 2ERYA 2FV8A 5LB4A 1YZTA 2QA5A 4NCKA 4EKDA 1E9EA 4QNMA 3AVYA 4JL5A 2J41A 3GJ6A 2FPMA 3TW8B 2G88A 1XXHA 3K9NA 4IHQA 1P3JA 2ZSBA 4MRNA 1J7KA 1BH2A 2LCFA 1WDTA 2G83A 3BB1A 3DVLA 3F8TA 2JDIA 2ZETA 1XDBA 5B2ZA 4EPVA 3K8YA 1WP9A 4E07A 4DEYA 2WHXA 5DYIA 4Z51A 2ZVPX 3EAQA 4LWZA 3NHBA 1KGDA 2ZS9A 1E2EA 2GXQA 2G3YA 2A3RA 1VIAA 3IGFA 1KI8A 4MQBA 3L0OA 3CTDA 1CXZA 3JZAA 3BGEA 2NO0A 3A36A 1SKQA 1E98A 2RGNA 2QN6A 3DHWC 4GRAA 5TARA 3MSXA 5FUVA 1XD8A 4M4SA 4DLZA 2VP9A 1W7AA 5HR5A 2J0UA 2VH5R 2PJRA 1W2GA 3CH5A 2DWPA 5IK2D 2RGBA 2D7DA 1BIFA 2RGAA 2ZREA 4IOKA 3C14C 4TLDA 4DVGA 2P5SA 4YXWD 2WICA 4MUAA 4I1VA 2IUSA 3BAFA 5TVKA 2G1KA 3RS0A 2A9KA 3CZQA 1GILA 3K53A 4EJSA 1ZNXA 4Q1DA 1M1YE 3UG6A 3B13B 4MKIA 3R20A 3U7FB 2XTZA 3B2EA 1P61B 3OF5A 4HAYA 2REOA 4PHTA 3C5HA 4CRWB 1J99A 2CE7A 3VHXA 1K6MA 2CK3A 3T34A 2ODNA 1WQ1R 3VR5A 3ZZ0A 1N3BA 2N46A 1KK0A 3DEFA 4EPRA 3L0IB 1TPZA 3T5GA 3AUXA 4DDVA 2GILA 3SZRA 3W8NA 2MSCB 2JIZD 2HF9A 2OXCA 3I8XA 5CLQA 3VU9A 4LC0A 4Z1MD 2FZ4A 1ETUA 1VG9B 3D8BA 1R0WA 1OXTA 3A4LA 4TL8A 4UNSA 2ZE8A 4Q9JA 2GKSA 1E2PA 3AVTA 4IDNA 3LQRA 4DCUA 3BH0A 1X6VA 1Z29A 3CZPA 5FBWB 3W6PA 3SN6A 1HV8A 3FHCB 4P33A 3U44A 2YYZA 4QGHA 1S96A 4JL6A 4HZUB 4A4DA 1G9XA 3BORA 4LHWA 1K5GA 2GCOA 4NDZA 2J7KA 1XTKA 5LD2C 2YINC 2OCAA 1E9AA 1R5OA 4LCBA 4DT1B 2IYZA 3QVVA 4IFBA 4Q5IA 3C8UA 3QXJA 1V43A 4KV9A 4C9BA 4TT3A 3BD9A 1VTKA 1ZINA 4BEJA 3LLMA 1L4UA 4QC2A 2IW3A 2GF0A 4W9MC 2EWVA 1Q57A 1M8PA 2PEZA 2ZRNA 3OHMA 4TWZA 2PZGA 2Z6VA 4TTQA 4PZLA 4OHWA 3CH4B 1JR3A 1CKEA 2YWHA 4Q00A 2QGZA 4H9GA 4MDEA 2QMHA 3WY9A 4HAZA 2FFAA 1AM4D 1H8HA 3PG5A 1FZQA 1Q1QA 3A1VA 1Z5ZA 2H18A 3PITA 2GESA 4UJ3A 2GEDA 4KFUA 4ASUA 3RLFA 1VCMA 3KL4A 3NTUA 2VIIA 2J0QA 3AUYA 4YDSA 4LJ7A 3SNHA 1G6HA 5FTMA 2RMKA 3EASA 3DOEA 1MKYA 4QL3A 1Y63A 3IEUA 5HKKD 2C77A 2QTFA 4LC1A 5KPDA 1N25A 1CTQA 1U2RA 1NN5A 2ZAOA 4B2IA 4FMCF 1RJ9B 3AM1A 2AK2A 1XTRA 4Q66C 4Q9HA 3IQXA 1OIVA 1E9DA 1C4OA 4MITA 1ZRHA 4EAQA 3BRWD 3KB1A 4UQOA 4HB2A 1AS3A 1MO5A 4O2RA 1NLYA 4PPNA 2ZI4A 1UKZA 4CEHB 4OL0A 2IC5A 2YJTD 2ZIAA 3CW2A 1DAIA 1GTVA 1NIJA 3OFND 2V1XA 5CJPA 3PEVA 5IF9A 4OQLA 2PT5A 4HB3A 1VG1A 2J7PA 1BMFD 2FEMA 1KSJA 4AKGA 4PO1A 4MGIR 3ZQJA 4YMWA 3EX7C 4RCZA 1KMHA 3QF7A 5E7JA 4JT4A 4JLKA 1ZIPA 2V7QD 4MRVA 3UIEA 1QRAA 2H17A 5C4MA 4QM6A 3GLIB 1ZJ6A 4IVQA 1N5JA 4PHGA 2PX3A 1SVWA 3N70A 4TMVA 4Q7MB 4AK9A 3MUFA 2N1BA 4POAA 2ONJA 1RYHA 1JJVA 1OT3A 4G5GA 1GZSA 2B6HA 4RFSB 1NNEA 2AX4A 2NMVA 1JPNA 4RZ2A 2PLFA 4XWKA 2WBLC 5EQTA 4NBSA 2B7CA 2Z4SA 2FX3A 4A9AA 2QW6A 4LJAA 2WJYA 3P4YA 2YC4C 4Q7LA 3RNLA 2C2HA 5FL3A 3U4QA 3THXB 3UXMA 1GNRA 4KO8A 4HUTA 2IF2A 2PX0A 4ZI3A 5FR2A 2XXAA 5J5CA 3SHWA 3KTAA 1CU1A 1W49A 4RD4A 4ZDJA 1UEJA 1NVVR 1KKLA 3R7WB 1MV5A 2ANCA 1CJVC 4KFRA 4JLNA 2FNAA 3EA0A 4C7OA 3W9YA 4A92A 1VCOA 2B7BA 4QBHA 1Q1EA 1E4YA 3BS4A 1CR2A 2JAQA 4XSGA 1OXUA 2VEDA 4TQAA 5IT5A 2O8FB 1TQ2A 2JLYA 2JGNA 1XNJA 1F48A 3QF4A 4EPXA 4L5BA 2VHCA 1XCGB 5EXPA 5CM9C 1EX7A 3J81k 1KSHA 4K46A 4O2LA 3I72A 1OFUX 2ZE7A 3WMGA 1UKVY 2XZLA 4OQMA 1T8UA 3QPWA 1S3SA 4JLPA 1YZNA 2F3RA 2QRNA 3PEWA 2R44A 3TAUA 1Q21A 3HU2A 5DI9A 2WWIA 1IXSB 4Q7JB 1RVDA 4PO9A 5C18A 1BYUA 2EFGA 1SXJB 3VQTA 3QXSA 1M7HA 3AQ4A 1LY1A 3QG1A 3QOFA 4MKFA 2JEOA 2FFBA 4E03A 2DCUA 4RCYA 5AJZA 5IK2A 4MYTA 4YONB 1EESA 2PMDA 3FTQA 1DTSA 4IXNA 2AXNA 2A78A 2QAGA 521PA 4OJQA 4PFSA 3BFXA 3CB4A 4P3YA 3RYTC 1OFHA 3O8CA 5FH9A 4DLYA 1LV7A 4UXJA 1GIAA 2A30A 4LI0A 1L8QA 4LX0A 1KYIA 3LNCA 1MRSA 4TLCA 5EE1A 1G8FA 1DOAA 3ND8A 3CO5A 1K5DA 1CR1A 3RRMA 2BIFA 2IF0A 4GPTA 1M7BA 1XTSA 3QKUA 1JXOA 3I1FA 4RD2A 3W6NA 5TV2A 3K70D 2VL7A 4FCTA 2YWEA 4F4IA 1CR4A 2ZITA 1GKIA 5JECA 3NC0C 1RIFA 2VP2A 4DUGA 4RD3A 5CDFE 1R0ZA 2JLWA 2JIZA 4FI3C 2J59A 5LDDC 3D6TB 2IXFA 4PSVA 4Z1MA 3TBKA 3CF0A 2DWQA 4IVPA 2ODEA 4LHVA 2NO9A 4PPFA 1KK3A 3PEUA 1NJGA 1KJWA 3LV8A 2ZANA 1PUJA 3AF1A 4QGFA 2OBNA 4BASA 4I1UA 4AI6A 2VHJA 3AKDA 4PQFA 2OILA 4DLWA 3GLIE 2VP5A 5JCZA 2O8EB 3EWSA 1IONA 2QP9X 4P31A 4G5SA 3GJ7A 1OKKA 4KYUA 4PZYA 2Q6TA 3B1WA 1US8A 4G5OA 1KI9A 3ZS8A 2HLDD 5JJIA 1DAEA 4WXRA 3OIVA 4YMSA 1NKSA 4XOIA 5JI3E 2P3SA 4E5UA 3O8RA 1A5TA 1E9CA 1W5SA 1XEWY 3X1DA 2VSXA 4ABYA 4D0LB 5EXXA 4DCVA 5JJKA 4B33A 3B78A 5JEEA 2X2FA 1LFDB 3TK1A 4W7SA 4PAOA 4B2PA 3ND9A 1W0JD 3X1WA 4YMTA 3BWDD 1DO2A 3WXMA 4BPBA 1Z22A 2ZRDA 1DARA 2R62A 2HT1A 4B6FA 1OJLA 2ZRAA 1XD2A 2IUUA 4C0QC 1RE0A 5ANRB 1ESMA 1VCIA 4G01B 2IBMA 2F1JA 1P4SA 1S1MA 3AGQA 2CNWD 5F9HA 4JBXA 1G7RA 5FBRB 2V3CC 4QHTA 1II8B 1LB1B 4W5HA 1Y3AA 1JJ7A 1FW6A 4A2PA 3U61B 4LBYA 3KXLA 1JBKA 1NVWQ 2ZJ2A 3CWQA 3U2QA 5HKKA 2YOHA 3RANA 4EQ6B 2Q0HA 4G5RA 2X1VA 4NL4H 1MOZA 2LKDA 5B58C 3JZMA 3MHVC 2OFWA 3L82B 3L8ZA 5GADl 1HQYE 1ZM4A 3S1AB 1NG9A 1E1QD 2CCGA 4NU0A 2OLKA 2PH1A 3QIAA 2REXB 1DG3A 3GLGB 2VP0A 3H86A 3K70C 4A0GA 1KI6A 2H57A 3AVOA 2ZRFA 4OK5A 2ZI9A 1ZUIA 4QGAA 2HYDA 4GSYA 3VX4A 1SXJE 3BB4A 3FMPB 4CT5A 1M2OB 4XSHA 5DYGA 2V6IA 4CGZA 3HYRA 2GZHA 3NEYA 4QXAA 5KOYA 5CK4A 5J40A 3BE4A 1KO1A 4W5JA 4FCVA 2CL0X 1AQUA 2G6BA 2IEYA 2CHVA 2WSSD 2KE5A 1OIWA 3DM9B 2XNSA 2Q9BA 5KNCA 2KRKA 1EFTA 5KSYA 3K0FA 3EIHA 2OZEA 4GOKA 4UKDA 1GNPA 1KHTA 1OH8A 4HB4A 3OE7A 4DSOA 4ARZB 3NBFA 1LW7A 3KUDA 2IS1A 1ESNA 3SDZA 2BJWA 4WBSA 1UDWA 4G5QA 1RW4A 2Z83A 4DLVA 3SC3A 1Q0UA 1QF9A 4OHZA 1RC8A 4C2TA 3WHKA 3IHLA 5E7IA 2D62A 4DKXA 1FX0B 1AKYA 4Z54A 4CZ2A 1S1CA 4QJ3A 1CRQA 1VKJA 3HPRA 4HSEA 4Q1BA 3GP8A 2ZJYA 1UJ2A 1Z0IA 4BEBA 3QG5A 2OBMA 4M9ZA 5DGXA 5JRJA 3HR8A 2EFEB 3AF4A 1F2TB 4NONA 1U94A 3W5IA 1NMZA 1GOTA 5G3YA 2GZAA 1NVVQ 2W0MA 4EFMA 4QJ5A 1Z0KA 4JSYA 4RZUA 1EFRD 2B8WA 4A8JB 1WE2A 2WWHA 4A15A 2GHIA 4RVCA 3UMRA 1GFIA 3GJ8A 5TXGA 2QBYA 3THWA 3QNUA 4BQSA 1W47A 3AVQA 4HYYA 2RCNA 1F3OA 1D9XA 2VHUA 1LTQA 3B8HA 1NIPA 5B30A 2R9GA 1N6OA 4KBFA 2FN4A 1CULC 1KY2A 5TB5A 2QSZA 1GRRA 1Q3HA 3DMDA 2J46A 2VSOA 1X8JA 3F5FA 3TAHA 2VBCA 2AWOA 3FGNA 3ZGXA 1U98A 2X19A 3Q7PA 3VTKA 1S8FA 1EFUA 4OI4A 2PBRA 1JQJC 4FWGA 1AIPA 2CMKA 4P32A 5FOXA 4NYMR 1Z08A 3FOZA 4UXIA 2IYUA 1NY5A 3I5XA 2V1UA 3QKRB 5C46F 2DR3A 1S3GA 3CNNA 3KKOA 4CW7A 1AA9A 1OIXA 1XEWX 3EZ7A 4I99A 1YHNA 4BLQA 4DSUA 4ZDIA 2MSDB 1XCPA 2REBA 2Z5FA 2EFDB 1VPLA 2UKDA 4M9XA 3G5UA 4G0NA 4JBWA 4CEJB 1JAHA 4JVMA 4RD6A 1N6IA 1UBFA 3AGPA 1OH5A 3RDPA 3RRZA 1WB9A 1DEKA 2ZS8A 2JLRA 3LD9A 3C4JA 1E79D 3ZVNA 4GFDA 3ZH9B 2ZUCA 2KBFA 4HLQB 1UBEA 2ORIA 5EP1A 2J87A 5GJWC 3UWKA 4DDUA 1XCMA 4V02A 3TRFA 2IXGA 3VX3A 2R6CA 2JA1A 4WIAA 3W6OA 3X1XA 4U00A 1DG1G 2IUTA 1N6NA 1AS2A 3AH8A 5GVSA 5L8VA 4LDJA 3GLGE 2OESA 2X77A 3TKLA 4OQNA 5CLLA 1A4RA 1OE0A 5J4LA 4WZAE 3LVRE 1IQPA 2QTVB 2A5DA 4TZ6A 4CYMA 1KI1A 1U8ZA 4PC2A 4DXAA 4NYJQ 5DI3A 1W44A 1QG2A 4IDQA 4ITRC 4MKGA 4AWXA 2AK3A 1NL3A 4TYWA 1Q1BA 3VKWA 3ZYCA 2W83A 221PA 1ZNZA 2QTHA 3E70C 1NLFA 2RKOA 2FPLA 4I1SA 2JJ1D 4US1R 4CEIB 4NH0A 3E2IA 1GRNA 1G7TA 4PX9A 2F7SA 3IEVA 1XJ0A 3DKPA 4ACAA 2O8CB 2P65A 2ZROA 1P9RA 4LYAA 3TVDA 2ORWA 2ORVA 4BECA 1NVMA 1XU4A 4BLRA 2V8OA 3A8TA 5SZJA 1XMJA 1IM2A 1WF3A 2ZTSA 1D5CA 2QI9C 3GJ4A 4P4SA 1Z06A 4DIEA 5FOVA 1E2MA 2GEVA 3UK6A 1S0UA 2GZDA 3KJEA 5KU1A 2DZOB 1S2MA 4K81B 3U60B 1VMAA 2W6IA 3QKSA 4D81A 2QE7D 4JL8A 4Q4AB 4URZR 1XWIA 1SQ5A 1W0KD 4F4JA 5JRZA 1KOFA 1P2VA 1OYWA 2QNRA 2GBLC 2PL3A 4M2LA 4HZIA 1T9HA 1RRGA 3VNVA 1LF5A 4N1AA 3TUZC 1G3MA 2ZRIA 2H16A 4NCIA 5JLJA 2GJAA 4X8MA 4D4JA 1TMKA 3OIWA 5J4HA 1XF9A 3VNUA 2BDTA 1BS1A 2CNWA 4KYIB 2ECKA 3NXSA 4TYPA 2NPFA 2AL7A 3I73A 3L43A 3BFVA 4OI1A 3ZZUA 1VIYA 2Q9CA 3TR5A 3ZS9A 2QT1A 1SXJD 1YZLA 4V0OA 2ODWA 2ATVA 2ZYWX 3PJRA 3MG9A 2WWFA 1HA3A 3KJGA 3FHOA 3BIFA 4HUQB 4IOLA 1RRPA 4JZKA 1T4GA 4QJ4A 4O3MA 2D4HA 4MKHA 1TL7C 2ANBA 1LS1A 1ZCAA 3NH6A 4B3CA 4C0BA 5FBQB 1KIMA 4AYXA 4DB4A 3B60A 1KMQA 5A4JA 2AKYA 3CWZA 3WMEA 4II7A 4D25A 2DFKB 3MMPA 2WZQA 4XVRA 1XRJA 1HY3A 3RWMB 4RD1A 4NP6A 1P75A 4BFUA 4V03A 3REFA 2GJ8A 3LY5A 1ODFA 5HE8A 3CM0A 4KSCA 4NYIR 2IL1A 3CX7A 2B8TA 4KJZA 2WPDD 1E69A 4R2HA 2RGEA 2RB4A 2QORA 3AVUA 1P9NA 1P2UA 2PMKA 3SI7A 3W8RA 5EUMA 1OFIA 3OEHD 1SGWA 3BK7A 2WSSA 4AIIA 1L7VC 3RS3A 1TUIA 3UATA 4FCWA 4QRHA 2V54A 1AZSC 2G1JA 4EFLA 721PA 4DLUA 4NHOA 4PC3A 3T15A 1DBSA 1XZQA 2OCPA 5IRCD 2ZRBA 2FOLA 1QG4A 2Z43A 4JLOA 4BFVA 3EWAA 1N0VC 3CX6A 3PQCA 4HZUA 3DMNA 4H1UA 4AY2A 1FOEB 3UPUA 2ATXA 4JKYA 2GCPA 1T0HB 1T3SA 4TMWA 1Z6XA 3AVPA 4NKRA 4TMZA 4Q9IA 5L3SA 4DB2A 1A82A 4F92B 1VHTA 4LZZA 1FTSA 4Q1CA 2W2VA 4BRWA 2LKCA 3B1VA 5HZKA 2NPIA 3Q5DA 2BM1A 4HDOB 4F4CA 3P26A 1COWD 1Z2CA 2BMDA 1TADA 3U6KA 2WJIA 4CVNA 1HTWA 4AG6A 4G3XA 3LLUA 2NIPA 1XJCA 2W6JA 2DHRA 1KTVA 3SJAA 2DZNB 1TX4B 1PZNA 1U8AA 2ZJBA 4LHXA 4A82A 3PCRB 5H8WA 5EP3A 1G3RA 3W5JA 4NZYA 5FTLA 1HE1C 1IJEA 2J0SA 2Y8EA 3R9XA 1P5ZB 2FSGA 2JLQA 1SXJC 4RY2A 2KJQA 1I2DA 3RRNA 4JSTA 5BXQC 4DDTA 3FHTA 3GQBA 1ZC3A 1H65A 1N5IA 4NYMQ 5JJLA 4PSAA 1P2TA 4HLDA 2P6NA 4JN6A 1P7CA 2QM7A 1E6CA 1YVDA 2VP6A 3IPYA 1N6PA 2AWNA 4PAMA 4WAUA 3T1OA 1ZBDA 5AUNB 3U5ZB 1XEXB 5H70A 1E2IA 1C9KA 4AKEA 5F98A 5JMTA 1P2SA 3EPKA 1WMSA 1RJ9A 2BBTA 1I4DD 1W36D 2OG2A 1GRQA 1KNQA 1KO8A 2KB0A 1BKDR 3FWYA 1KDTA 2C8VA 3IIJA 4RSGA 1SVOA 4C0LA 1G291 1U81A 3LFUA 4Q03A 4WZBE 1UAAA 2FDCA 2OFOA 4UJ5A 3VU9B 3WBKA 3SQXA 2BCJQ 4YLGA 1FMLA 1P72A 2RHMA 2RHDA 1R6BX 3DM5A 3EW9A 4D4LA 5JS8A 2CLDX 3V9PA 2GK7A 3C16C 4N0DA 4QHYA 2VYFA 4BFYA 3C41J 2C98A 1E9SA 3U7EB 2PZFA 1JAIA 2JLUA 3QPUA 4LJ9A 2YKGA 1T91A 1N6RA 4PZZA 3B85A 4LYFA 2KBEA 2DY1A 3U44B 3T1VA 5AK0A 3OAAD 3REGA 4TZ0A 1TQ6A 5EP2A 4R7ZA 1OV4A 1NKTA 2GCOB 1AS0A 1I2MA 4XTCS 2C95A 5KDDA 2GNOA 2BKEA 3AP1A 3EZ9A 4KODA 8OHMA 4S2EA 4L9WA 1MT0A 1D2MA 4RFSA 4V0MA 1ZVQA 5FOSA 5SZHB 3U6BA 2YC2C 1G4UR 3CRW1 2O0HA 4MGZR 1E9BA 3SJBA 4A2WA 1JR6A 4KFTA 2QQEA 3MRSA 1E0JA 4GDFA 5EE5B 1X3SA 2WJJA 2V6ZM 1G5RA 1A2KC 3FPAA 1VHLA 3LRPA 2R6GA 3D31A 1W4CA 1E0AA 4B47A 3RSOA 1GP2A 2KSQA 2IXEA 2JJ1A 2FE4A 5FFMA 4EPTA 1J90A 1J70A 5FL7D 3BBPA 3Q7QA 1II0A 3H84A 3WHLA 4JVLA 3BH7A 2CJWA 1QHSA 4V0NA 3HR7A 2PCLA 2KWIA 4IDOA 2WMNB 4GZMA 3X1YA 4ZI2A 2P5TB 1R4AA 1Z0JA 1G8PA 1IBRA 3Q85A 2W2XA 2QP4A 1SHKA 3TW4A 1TEVA 2OBLA 4PQYA 2A5JA 4MRRA 1MR3F 3PXGA 4HATA 2ZJAA 4JLJA 2F1RA 1G20E 4AYTA 2CCKA 5JFGA 1CBUA 2QE7A 4KAXA 2O8FA 3LW8A 2P2LA 4ZKEA 5DH9A 3PR1A 2XTMA 3IUYA 3ZLJA 3R9WA 1WXQA 2CCJA 3H2YA 3FE2A 2GXUA 2HJGA 1J8MF 1E1RD 1N5LA 4GMDA 5F3WB 4AG5A 1G3UA 1UADA 4ON9A 3Q3JB 2H8KA 4TN1A 1W36C 1A2BA 1KO5A 3UG7A 1Q20A 1KJZA 5DN6D 4D2IA 5BW8A 2W58A 1EWRA 4BWYA 2WMOB 4RD0A 1TF5A 2BM0A 1PVOA 3SOPA 4FN5A 4R98A 2CLSA 2DFTA 4ZIRA 1KMHB 2QPAA 3OESA 5FR1A 1X8LA 1YZQA 4KI0A 3CKLA 5J4KA 4IFEA 4UNQA 4JLAA 5JI2E 5EE0A 1NLZA 3SE0A 2FH5B 2D74A 4NE2A 1R2QA 4NYIQ 1NMYA 3IQWA 4OI2A 2R6FA 4EFNA 1U9IC 1FMJA 2OLJA 3QXCA 2ZVQX 3NBZC 2PEYA 2OSBA 1KK2A 4RKEA 5JHGB 4UNNA 3RWOA 3NBXX 3RS7A 3AVVA 2WPDA 4FD2A 4LBWA 2K5UA 1KO4A 5KTYA 2CDNA 1W5TA 2OAQ1 2D7CA 4KVGA 1PLKA 4FIDA 1YU9A 4LYHA 4CT4B 1OXVA 2WJHA 1KO7A 3NG1A 4X8HA 3JVUA 3OEHA 3QI2A 4GBMA 4LBZA 5KSPA 4QM7A 1QHXA 1HYQA 5E7MA 2F9MA 1GSIA 4YXWA 5EUQB 1UKYA 1GG2A 2XXAB 2IYRA 2ZUDA 3IIMA 1FFHA 4LV6A 1F5NA 3Q72A 3GEIA 1QHHA 2BKUA 3E5HA 4NCHA 4IOMA 3H1TA 1IJFA 4A8JC 4C7OB 2IK8A 1G5TA 4B3XA 4WA7A 3PUYA 3CR8A 4D80A 4PO8A 4ZCMA 2O8BA 4Y0AA 1GL7A 4PSKA 2R8RA 4DHEA 1FPMA 4TYQA 1TU3A 2WSMA 4DC9A 5G40A 1GNQA 2ZR0A 3CRRA 3DO6A 3GLFA 1XFAA 3EZ2A 3NC1C 2P6RA 3IIKA 3ICEA 1FUUA 3ADKA 5DIFA 4AD8A 2YOGA 5JZVA 1CIPA 5JEDA 2UZ3A 1DE0A 4A2QA 5AJYA 3GFOA 3ZQ6A 4M0LA 4DCTA 1G3QA 3BJIC 1JR3E 3WP1B 1MABA 2HUPA 4DSNA 2ZUBA 4KU4A 1ZD1A 3Q5EA 4NYJR 1Z3IX 1KDOA 1MRNA 3TUJC 4C4PA 3G0HA 3NKVA 3KX2A 1YR8A 3SS8A 2TMKA 2P0EA 2B92A 1H8ED 2F43A 2HDNB 4HLUC 2BVNA 4QFMA 1AGRA 5FPKA 3B6EA 3W90A 2QAGB 2ODBA 4DDWA 3N2EA 1II8A 1S9DA 2BMEA 2MMCA 2PJZA 2CL7X 1J8YF 2DVWB 1C1YA 2BCGY 2RGGA 1AQYA 3K0AA 3OEED 1S9HA 3RSLA 4BZPA 1R8QA 2BOVA 3B1ZA 4EQ6A 1Z6AA 2OFXA 4LV8B 1DELA 1P62B 2HXSA 3AF0A 5EXSA 1SVSA 3HPQA 2FFHA 3M6AA 3RS4A 3MFYA 3F3YA 5ELXA 2C78A 1JECA 1KSFX 3BXZA 3CPJB 2QP3A 3C15C 3FFBA 4Q4HA 3AVXA 1IN5A 2ZRPA 2N42A 3NDPA 3WNDA 5L3VA 5B57C 2BBOA 1UF9A 2OCBA 1FL9A 4A6PA 1N6LA 2R6AA 5EZ5A 2YWFA 4PPGA 3QXHA 3DOFA 5JWHA 3KFXA 4GP7A 3IBYA 1XTJA 2P67A 3WRYC 2G77B 1ONBA 4HEJA 2QROA 1AZTA 3K1JA 5FTJA 1AN0A 1EX6A 1F2UB 1JI0A 1HE8B 2EW1A 2HV8A 2V9PA 3I8SA 3OAAA 2XZOA 1E2KA 4QBFA 4TMTA 5CIWA 4Q18A 5FPTA 1P6XA 1US8B 4IDPA 1GUAA 3AKCA 1U9IA 4JJZA 4GOJA 4Q19A 4EIWA 2YOFA 1U8YA 1GITA 3MLEA 4HLCA 4TYNA 3DKVA 2YHSA 3GJXC 1DS6A 1UPTA 4JYBA 4TLBA 2QY9A 4C0KA 4JVNA 5UKDA 2QL6A 2ZU6A 3OFNA 2WKRA 1QZXA 1FX0A 2CE2X 1EWQA 1R0YA 2MMGA 2AKAB 1XX6A 2NO6A 4J0QA 1NVUQ 1BMFA 2WJGA 3T1QA 4MYUA 1WRBA 3VFDA 3VR1A 2JLZA 4L8GA 1ZIOA 1AJEA 1R10A 3ICQB 4URYR 4B71A 4E09A 2WVJA 2X2EA 1F2TA 2JDID 1Z2AA 5FL7A 2V7QA 5BN5A 1VYUA 5KDLA 3LXXA 3AF3A 2AXPA 4TLEA 1XMIA 1G16A 4KBGA 1GM5A 4A8JA 2J0VA 3TSWA 3P4XA 4PQRA 4NMMA 2PCJA 3GLHA 3KKQA 4MDFA 3CNLA 1FP7A 3GJ3A 1SKYB 1G41A 2GWHA 3OZXA 3V00A 4URXR 3THYA 2IS6A 2ZSAA 1DAGA 4L4UA 2BWJA 1D6JA 4KLNA 2ZYUX 4Q1AA 3CLVA 4TMXA 3M1IA 4TMKA 2E1RA 3SEAA 4ESVA 3FMFA 4A1FA 1FUKA 3NVAA 5P21A 1GVNB 2IX3A 3SFZA 1SVKA 1Z47A 5FUWA 4C3ZA 3HWSA 1E1RA 5AJWA 1NSTA 5GVRA 3KQUA 3VKGA 1KI4A 4MGKR 1KY3A 3CX8A 4HI0E 2ZQ5A 2WV9A 4DZZA 2OCYC 2WOJA 5EE9A 1KI6B 5D3MA 4H1VA 4GL2A 3QKRA 5DN6A 1R5BA 3FFAA 2R6DA 1IHUA 2IYLD 3ASZA 3TLXA 2ZRKA 5DNYB 2F3TA 3HYTA 1KDRA 1O87A 2GAAA 4Q9KA 1ZW6A 2GDJA 1T0JB 3WNBA 1KSGA 4FMCB 1JNYA 3LW7A 5FI1B 5AUQA 2VP4A 3ZVLA 3CRQA 3K0FB 1OPXA 2XB4A 1DO0A 1G17A 3EIQA 2ZXUA 1MO3A 3L2OB 3RC3A 3AB3A 2GEUA 4B2LA 3K0EA 1GDDA 3P20A 3TIFA 1R5NA 2EQBA 2ONKA 4ZDKA 4ESHA 2XNDD 3KKNA 3ZD6A 2BBSA 2C96A 2OUKA 1TF2A 2V55B 4YMUA 3ECCA 3UMFA 4JYCA 1FTNA 4MH0R 4BFTA 3KQNA 1X1RA 4KHZA 1T3HA 3SYNA 3U7GA 2YVUA 3OIUA 3P1JA 621PA 4UXHA 3WRXC 4X8LA 1II9A 2FGJA 1ZAKA 3AKEA 2FF7A 3EG5A 4IOJA 3ZVMA 3GCGA 4F7WA 2HJVA 4PXAA 4B43A 2VSFA 1P73A 4HDCA 1Q44A 4B34A 5TMPA 4YQFA 3SR0A 2JJ8A 1YR9A 1U0HC 1JR3D 2BEKA 2NTYC 2L0XA 3KB2A 2QBYB 1ZU4A 4A6XA 3I3SR 2J45A 1T8TA 2HEIA 3BB3A 3NIBA 1H8HD 2FGKA 3LVQE 1Z07A 1T5LA 3W3AA 4G1UC 3AP3A 4WZ6A 3R8CA 2QT0A 4U7DA 5BN3A 1E9FA 1Z28A 3IILA 2NZJA 3KQHA 3KJIA 1T3LA 2O8CA 1G3IA 1N6KA 1RRFA 1LNZA 1I4LD 3KUCA 1EK0A 3SBEA 1XBTA 2IYXA 2D3WA 5KSOA 3SQWA 3VLFB 1QHYA 3ZD7A 3E1SA 3TQCA 4L15A 4LPSA 2WAYA 1WBDA 2GTPA 3KFVA 1ANKA 2XOKD 2JJ2D 3NHAA 4P4UA 1GL9B 3GJ5A 3ZDQA 4V0LA 4BZQA 4N3NA 4OYHA 2ZR7A 1FP6A 2WM9B 3TH5A 3KW6A 2EYUA 5G3ZA 1XPRA 5JSZB 2E87A 5FPSA 5L3QA 1P9WA 1XTQA 4XVUA 1KI3A 1MH1A 4PPQA 3B9PA 4I81A 2O8DA 1H8EA 4Q4JB 2HLDA 2RGDA 3PIRA 5JS7A 2XAUA 1OH7A 2FMXA 3W3ZB 2QSYA 2XX3A 1E2HA 2IYVA 2EVWX 1SKYE 4YDHB 2ZI7A 3T06B 2QMOA 4UNPA 3SU8A 1ZM7A 1RYFA 1E2DA 2GRJA 1ZUNB 5BWMA 2FA9A 3U3RA 3EPJA 4HUQA 1RRCA 2J5XA 2BMFA 4M9QA 4OK6A 3QJYA 3WP0A 2V4ZA 4IEIA 3VR6A 1W0JA 5KUTA 4ZPXA 1G21E 3A4MA 4A36A 4LPKA 3R8FA 4TQ9A 4B76A 1OSNA 2HF8A 2IEZA 2JLXA 1W2HA 1EFHA 3GMTA 1IN6A 1N0WA 4AYWA 2FJUA 3K9GA 4FXPA 1SVMA 2DB3A 2D2EA 2GXSA 3FYHA 3K9HA 1UKEA 1HURA 3A37A 1A1VA 1O3YA 4N0EA 3WYFA 2QPOA 2EU8A 3MGCA 4KCGA 4O25A 5EE3A 4TL6A 3CNOA 5EP4A 1X1SA 4BLPA 4KVAA 1KI2A 3M4YA 3CIOA 4KLZA 3VR3A 2AFIE 2F1IA 4NCJA 3HDTA 5H68A 3SBDA 1TAGA 2GF9A 3A6PC 4BFSA 4B73A 2QG6A 4MRSA 3TUIC 5F9FA 1JALA 1KK1A 1CJMA 2IHBA 1ELOA 1EXMA 3CPHA 4M1YA 4RFVA 2VLIA 1E1QA 2G0TA 2RAPA 3JVVA 4F93B 4OBEA 1FNMA 2A7QA 3B5JA 5JWRA 3KKMA 1AK2A 1R0XA 5KO2A 4LY6A 2Q3MA 3HP1A 5FTNA 3AP2A 3ZIAD 2ERXA 2IS2A 3MWKA 2F9LA 2VPPA 5CIQA 4Q9LA 2Q3HA 3AVWA 3RS2A 1UBGA 4EPWA 2QPTA 4ZO4A 3VR4A 3GD7A 3QKSB 2IYQA 5B64A 3MWYW 4FMDF 4B6EA 1IY1A 4HB0A 2F1HA 3KJHA 4PC6A 3B1XA 1L4YA 3QEOA 2GCNA 2IYYA 3FKSD 1Z6TA 2VF7A 2CXXA 3KXIA 3IHWA 1E99A 5K8TA 3QE0A 5KPJA 1YKSA 3QY0A 4LJ8A 1SZPA 2ZI6A 4OQFA 3NDBB 1NRJB 4JLBA 5DISB 1JB1A 1OXXK 2OXRA 2O52A 3T1TA 2WWXA 4FMBB 4RZXA 1TF7A 3SJCA 1E9RA 3CR7A 2QUZA 2ZRGA 2PLRA 4JIMA 1P60A 4NTZA 2BMJA 1XXHB 2NOAA 2ZPTX 3RRYA 2NO7A 4BFZA 3SFVA 2H1LA 2IYSA 4DT1A 5SZIA 4AKHA 3VKHA 2FFQA 5HTKA 1KNXA 4U02A 3WBJA 4LJ6A 1NN3A 2ZSEA 2X8AA 3AKYA 1UDXA 2IWHA 1G6OA 1Z0AA 2A5FA 3I61A 1G8HA 4TYYA 4CF7A 4GZLA 4Q02A 4QHSA 1T6NA 1XEXA 3MAAC 4BRUA 3EA5A 1EFRA 2O0KA 4HDQB 4FWDA 1HQCA 2GJSA 3R9IA 1M34E 2VTKA 1CRPA 4A3VB 1D9ZA 3I5YA 3K09C 4CDGA 1G4AE 2NQ2C 2ZI5A 4PTLA 4DUGD 3SHFA 3TJZA 2J0UB 4QBGB 3PVSA 3IO3A 4XTRA 3W34A 4GT1A 4A0HA 3TQFA 4ZCIA 1BOFA 3NBYC 4LGMA 2WWYA 3IDQA 5BYJA 3X2SA 4W5WA 5KYKA 4KSBA 3WYGA 4EJSB 4GMXA 4BFWA 2GBLA 3MCAA 1BO6A 5FOTA 5HCIA 2XNDA 2I4IA 1QHNA 1GWNA 2DFNA 1ZNYA 4M1MA 1OKKD 4MGYR 4D26A 1E2JA 1OFTA 5L3SB 3SYLA 3K0SA 1RKBA 5H1YA 4M9SA 1X86B 4PHFA 1QDEA 1PUIA 3EZFA 4XIGS 3P27A 2HCBA 4OJKA 5A0FA 5CDFA 4CEHA 2CL6X 4IW3B 2WWWA 1IN4A 3FMOB 4DEXA 3A1SA 4K8OA 1UM8A 3M0EA 3KQKA 5D3QA 2C9CA 2YV5A 4Z8YA 1ZM3A 3KKPA 3EZ6A 5KNDA 1E32A 4JMPA 1IXRC 1E79A 2QRZA 2PT7A 1Z0DA 4BGDA 1BYIA 4Q1FA 1XPOA 2NZ8A 4GP6A 2O5VA 4BLTA 3MJRA 2ZRLA 2ZAMA 1ZCBA 2DYKA 3CF2A 3GLIA 1NBME 2H92A 3IKJA 3RVBA 2QGNA 2G0NA 4BZXA 3I4LA 5DE3A 4DLRA 2RH5A 4JVSB 2BC9A 4RKFA 2J1LA
chains in the Genus database with same CATH superfamily
1WZEA 4I4IA 4PIMA 5LOVF 2NSDA 2C7RA 1W46A 4MVJE 3NVKI 2YR0A 2VPXA 3LOQA 2WLTA 3E27A 4ZTUB 4CLEA 1XQ9A 2OE2A 4I4TA 5EZ6B 3WFIA 2G72A 1BN6A 4FYKA 3VZPA 3SVTA 3G3EA 1ZC4A 3GAMA 4D4IA 1RI4A 4CQMD 4KRXA 5EGNA 1LPMA 5EVJA 2CWDA 5C4GB 2V5AA 3ZWNA 3G0GA 1ENYA 2BGMA 2YNMC 5JO0A 3JU3A 3BGIA 2ZDGA 1B43A 5DNUA 1EG7A 3DMYA 1IB0A 4EF6A 3GRVA 4HS9A 5DTIA 5FPYA 2J67A 4H1TA 1OBCA 5HJ2A 3SLRA 5FF9A 1ZRMA 4D44A 4R69A 2PUFA 1NQTA 2QJOA 2PRKA 2H2WA 4U39A 2VOEA 2XYPA 4TS9A 1I3NA 3AHDA 3DE5X 4Q93A 1YF3A 5JS2A 4ZVTA 1Z8FA 1OAKA 1ECBA 5D2CA 1U0LA 1M9NA 2ZULA 3BOSA 4EHKA 5FI0B 2JLVA 2X7HA 3M9XA 1CUIA 3IUMA 3N2NA 4RJLA 2GEJA 5C2JB 4HNTA 1E7QA 3IMKA 1OB5A 4L2IB 1I1NA 4B75A 1DXQA 1N0HA 1F2UA 3FTNA 1H3NA 1XGKA 4EKYA 2D00A 3UV3A 2FMUA 2WNSA 3KSXA 2F5NA 1AIPC 3FI9A 3B9RA 3FDIA 4IRXA 4KXFB 4ARZA 5LKRA 2FP4A 3TMYA 1I4TD 3DL0A 4I3GA 1O58A 1X9IA 3D54D 1UOPA 2FWBA 2HXGA 4DLLA 5TQVA 5IABA 2YWGA 3JCZA 3LY8A 4RLFA 1LD3A 1QHGA 3ZIUA 4YMVA 1ZICA 2P8SA 1GDTA 1XMSA 4TLAA 3A1WA 2UUBM 4WOPA 5FTKA 3IVAA 4N5HX 3T3EA 2D0OB 3PK0A 1YZKA 5ALJA 3I2HA 1XMVA 5CG1A 1XC7A 3IQEA 1ZPDA 1KXJA 1E60A 3BTOA 2CXUA 4BV2A 3GFPA 3LAWA 1EXWA 3Q1LA 2KW0A 4E2YA 1SCUA 3K6RA 5A2QA 1Z62A 3DMRA 2W6JD 3E5RA 4FOTA 4N5LA 3P2JA 4PINA 3V7WA 2IT1A 1NG1A 2BNKA 1QV6A 3IE1A 1EXNA 2ZJ7A 4R1OA 1VYTA 2QTZA 4C0HA 2GXAA 5K20A 1DC7A 2IIVA 4FIZA 3T6PA 3OUUA 2FR0A 1T8YA 4U2DA 2HHLA 1VJTA 4LRTA 3P97A 2RGNC 5LWHA 1RYBA 1WO8A 3WGYA 1SO8A 3WAJA 2O5RA 5AUOB 1SWWA 2AYXA 2XLJA 2OGWA 1EUQA 4TQUS 3KEGA 3FMIA 4Q4DA 4ZP1A 2RARA 4DSAA 2MYTA 4DMFA 5C34B 1XYVA 1CDZA 2JVJA 4OA8A 3RS5A 1R2ZA 5D5HA 2DUNA 1P4AA 2CZQA 3WB1A 3D6MA 3L6RA 4JDUA 1SC9A 5U9CA 4U2GA 1Q6YA 1PRBA 1B6TA 3CW9A 2O2HA 4AMZA 2NXNA 3LYLA 4S2UA 1UXHA 5KIAA 4MAMA 2ZRCA 3NNDA 3OKPA 4MVJA 1R15A 2PH5A 4Y28F 2WIBA 4YECA 1B8UA 4KO3S 1HLDA 4NR0A 2DC1A 2C57A 3BD8A 3KFLA 2FUNB 2I2XB 2C97A 2FLKA 1J2UA 4LXTA 3TW8B 4CM4A 3AG5A 3O31A 5ITUA 2ZSBA 3UA3A 2JDIA 3FOAA 2Z2JA 1SXIA 3HY3A 4LI3X 5TQ0B 3C6QA 5TQJA 3GHYA 3MSXA 4DLZA 1W7AA 3V76A 2QRKA 2D7DA 2ZBPA 1K2VN 3L7LA 1KEKA 4AUEA 4O3FA 2JY8A 5ALHA 4C4AA 5CT9A 1QG6A 1K6MA 1WQ1R 1ZOIA 3W8NA 5ICFA 2ZJ0A 1ZWLA 2ZE8A 3R75A 3LQRA 3IR7A 3GA5A 3E8MA 5E1BA 4TS1A 1VJDA 1UM9B 4BB5A 4IGFA 4REZA 2RAVA 4BEJA 4GI1A 4FFVA 3QAUA 4O2AB 1CJBA 3ABSB 5FDFA 1CKEA 1Z25A 4G2NA 2FFAA 2AW3A 3PG5A 1YFJA 3DOCA 1WZNA 4NOJA 3BREA 4G8BA 4AP9A 3NTUA 4AQYB 2M6SA 4BV3A 3WL4A 3VPCA 1MKYA 4ZEMA 3DEYX 4EW6A 1C4OA 2HWUA 2OV4A 4HB2A 1CC1S 2IC5A 2QD5A 4BGVA 1JFLA 5HM8A 2VQEB 2L17A 3NHPA 4E94A 2JJYA 4R8VA 3PC3A 3KETA 3MILA 4JLKA 2ZWIA 5KX5A 1N5JA 2XF3A 1GZSA 3DDOA 4BP1A 2WBLC 1N9ZA 2HU2A 3M9WA 2FW9A 4ALLA 5C31A 2XE4A 1M2WA 3TTUA 5ITZB 2XCTB 4NABA 3UXMA 1K4KA 4CLRA 2ZIXA 5FR2A 4NFYA 4J75A 3I4YA 4G1MB 2FNAA 1VE9A 2F1OA 2L7IA 2JLYA 2RGHA 4MMYB 1FDTA 3N7AA 4K46A 2J85A 3FPKA 4OQMA 3SXJA 3A6DA 3IV9A 3O8QA 2R44A 3PZRA 4PO9A 3QV2A 2H52A 3RVSA 1LY1A 5LCXA 5IK2A 2WJ3A 1TJ5A 3AEKA 4PN3A 2J3JA 4HEOA 4RMHA 3GUYA 5CU7A 1E3LA 1CR1A 4GR9A 1ATZA 3W6NA 4WCDA 1R0ZA 5LDDC 4YAOA 5DDIP 2XZFA 1YTUA 1PL7A 4KVFA 4PQFA 1K0FA 3B1WA 4PHCA 3E35A 4OY3A 4GWKA 3BSFA 2N47A 3OU6A 4X62M 5LNK1 4B2PA 2QN3A 4XB6B 3IQGX 5T67A 1ODIA 1AKRA 2C2KA 2VYVA 1G4HA 1P4SA 3T1YM 2NU8A 1S1MA 3BBLA 3I6QA 3MTAA 3AHJA 2SBTA 3VO9A 1IHOA 5HKKA 2PD4A 5FP0A 1MJGA 1SIBE 1HQYE 1NG9A 1FQOA 2V6GA 3JS5A 3AR7A 3RK0A 2X2OA 3OQMA 3FJYA 2A0UA 3EG9B 1V5FA 3EHEA 1KI6A 2UVDA 2OPBA 4H3KB 4IHKA 3H9UA 2ADFA 4M55A 4FFMA 3BB4A 5DNYA 3TNJA 1M2OB 1F2VA 4XSHA 1RQLA 1U0EA 1VE5A 5KOYA 1PZMA 5CK4A 3GL9A 4LS3A 3UW1A 1AQUA 3DXYA 4DRXA 3GP3A 3R3JA 4UUNA 5D86A 1OH8A 4DSOA 1LJLA 2PANA 1G55A 4RJJA 4HGQA 3KPYA 2FWPA 4WKNA 2PLAA 3IURA 3KOWE 3QFFA 3JV7A 4EEXA 1LQ2A 1SY7A 4KO4S 5TLSA 5A2QS 3UH0A 3DNFA 3V8VA 3AVQA 1NBIA 4BQOA 1S4MA 5B30A 1LWOA 2HCFA 4DPLA 1X8JA 1KP2A 1U2GA 4AJ2A 4OI4A 1DDOA 2CMKA 4UXIA 4P83A 4RHCA 1P9OA 4C3VA 2REBA 4J94A 1PYDA 2CUNA 1DXYA 4AX4A 4TUYB 4LF6M 5AXAA 4CJXA 3SDSA 4GVXA 2C0CA 1SJ9A 2ZRQA 2JLRA 1E79D 5E6UA 1R0BA 4O1HA 4GZ6A 3ZH9B 2IXGA 3FAKA 2JA1A 3DFZA 3SJ7A 1TCVA 4KPUA 5JSYA 2XCOA 3GFQA 4B85A 10MHA 2OBYA 4XJSA 3MGGA 1G71A 1KI1A 4UHBA 2H0RA 2ATEA 4IDQA 3FM9A 1Q1BA 4BBJA 4I1SA 1H05A 3FJOA 3X0DA 4BYGA 4TXJA 2CNKA 1SXQA 4J0GA 2NUAA 4BO9A 4BECA 2V8OA 1C1XA 4EMTA 1UWVA 3UHFA 2GZDA 3V34A 2RIPA 3AR5A 4LVOA 3GUUA 2QVZX 3QKSA 5AKZA 2QNRA 2TS1A 1GR0A 1XZAA 1GCIA 5EJ4A 2JIOA 1MX1A 4TTAA 1C0PA 2P9YA 3NXSA 1RWXA 3I73A 1SKUA 3TR5A 1SXJD 4C01A 3EOZA 3QLTA 1RRPA 3HU5A 3SMQA 3LUCA 3AJ9A 5A4JA 2C4UA 4CG0A 1GCAA 1GAWA 4MHOA 4V03A 4KSCA 4YO8A 4YRGA 2B8TA 4X64B 4JENA 3OD5A 4ZU6X 3WBFA 3SI7A 2O3SA 1RKQA 4N12A 4AIIA 1UFZA 1C2YA 3GGOA 3K9WA 3KV3O 4TMWA 3VJLA 4F92B 4NXMB 4RJIA 4GKAA 2DAKA 1ISHA 4UHFA 3DHVA 1H2AS 2O59A 2DUUA 3CURA 3QTTA 3H83A 1HTWA 3LJKA 1LLUA 3T9BA 2QMZA 2LGJA 1U8AA 2MYPA 2ZJBA 4LHXA 2ZGVA 5H8WA 5LYYA 1YJBA 5CFQA 1HE1C 4HMPA 1Z38A 4OQZA 2O3RA 1I2DA 3RRNA 3EFBA 3S55A 2QM7A 1AHNA 3W77A 2C2GA 3A25A 1JU4A 1N2JA 2DPMA 3AUUA 2OG2A 1KNQA 5HQ3B 3GXBA 4DLBA 4EFKA 2DLDA 2BCJQ 1XDUA 1CUGA 4BO6A 5AW1A 1JAIA 1Q0PA 1WWKA 4G1VA 3KT8A 1JFFA 1HNXB 4R7ZA 2AN1A 3L26A 4KODA 3VVMA 8OHMA 2X14A 2XDQA 4TV9A 4F3KA 4FX2A 3SJBA 4QXQA 3MRSA 4OBBA 2YRWA 4WECA 3GLQA 1H85A 5J1SB 3W0LB 4C7KA 3U80A 2KWIA 4EY4A 4BNDB 4N7RA 1JHDA 3Q85A 1W93A 4MRRA 5F7ZA 2CCKA 1WB6A 1BA3A 1A96A 4ZKEA 4OVZA 5K2MA 1RBZA 4RPHA 1QX3A 5GIOE 1YFLA 3MAGA 1J8MF 1KP3A 2ZPAA 4TN1A 3MUOA 1EUDA 3UG7A 3OCVA 4S0XA 2VJOA 3E81A 3DV0A 4P34A 2OYRA 2CLSA 1T4CA 1Z7GA 1Z5WA 3MRTA 4DLKA 1JDTA 3C1AA 5K2OA 1F38A 1YKGA 3HSSA 4JLAA 3RFWA 5IT0A 2D74A 4IRMA 1I3OA 3IQWA 4OXYA 4EFNA 1XXLA 3VI3B 3RVOA 1RXSA 1P3DA 4CXMA 3RWOA 3KWLA 1JSCA 1UBRS 7REQA 2E49A 2J9ZB 3NG1A 5TJ9A 3V42A 2GNPA 3A3KA 2Z57A 2QW8A 3IRVA 1TPYA 2PUHA 4MZXA 3TTYA 3R7LA 3CR8A 1MAVA 1SIOA 3E21A 1FPMA 3UJ3X 4A3SA 1XQXA 4Y1RA 5JIBA 5JZVA 2UZ3A 2ZJFA 5AJYA 1BVRA 3PEEA 1IMOA 3RRJA 1Q0RA 1EH5A 2SKEA 1YCFA 3BBZA 2PG3A 2Z6QA 3PI6A 4MKRA 4DDWA 2G9ZA 3RSLA 3M4XA 3BD7A 3EPRA 5IAJA 2DVMA 1CP3A 2ONCA 2Q9UA 2QZZA 1LBHA 8ABPA 3PQEA 1QCZA 1RRKA 1F2UB 1YJQA 5CIWA 1TVCA 4IDPA 3PXCX 1GG5A 4TYNA 2ZWAA 4JYBA 2PYIA 4ARVA 1FX0A 1XX6A 1F3LA 1NI4A 1U0BB 4B71A 1F2TA 3IOBA 5EIHA 3KSBC 2FMHA 4PQRA 5AESA 4L4ZA 2FP4B 3NOVA 4ILKA 4IPTA 2IS6A 2GN6A 1FRZA 4KLNA 4C05A 2JFPA 1DT3A 3P9RA 2ZBFA 1XEAA 2VAMA 2IH5A 3EMKA 4X60A 5KO3A 3KUUA 3RREA 4N41A 1EP9A 1R5BA 3GVIA 2Z2KA 3COSA 5BSRA 3MLAA 3VYWA 4KDCA 1BEEA 1O87A 3VR5D 2GAAA 3D5QA 4CHGA 1W87A 1I5RA 3VC7A 1FP2A 2XUJA 4DMMA 2GPAA 1A9OA 1OPXA 1G17A 2IUYA 1ZGJA 5BV0A 3W4KA 2I7PA 2VKQA 3GG2A 1FFEA 3ECCA 4NWIA 2CXHA 5DP2A 1II9A 4IOJA 3TZLA 2OAGA 4ZO9A 4FGSA 1ZU4A 3FNEA 1SCQA 4HN4B 4BIMA 2FN8A 3GNSA 2O2DA 4H4EA 1VSUA 2D3WA 2BEUA 2BN4A 2H4ZA 1YNSA 3C85A 1J1ZA 1SCBA 3EVDA 2GTPA 4TWJA 3CLSD 1Y6GA 2XF8A 5AW3A 3QU9A 1MPTA 1P9WA 1VPDA 3NS7A 3CVXA 3SMPA 3PIRA 4LRTB 4M9UA 3W3ZB 5ITSA 2XX3A 4H1HA 4GVLA 2GRJA 5BWMA 2BMFA 5A1JA 4PSUA 1BCRB 1R6UA 2FJUA 4F9FA 1X9GA 4CIZA 1X1SA 3ZWMA 4RNCA 1KI2A 1JR2A 2Y9PB 3LUDA 4DR5B 4NCJA 4CMCA 1X70A 4W1QA 3TUIC 4ZVVA 1KK1A 3GJQA 1Y3HA 3GPDG 5I4BA 4EPWA 3H2ZA 5AP9A 1IY1A 2Z3XA 3KC2A 2HIMA 2XH9A 4RZSA 3FKSD 4HWOA 1E99A 1YS1X 1MX9A 4TUWA 4PFJA 1TF7A 4OMUA 2B30A 2JLCA 1P60A 1KQGA 4CM4B 4DT1A 5SZIA 3OFSA 4U02A 1U8FO 1YDWA 4RMGA 2IPAB 3H5LA 3Q3GE 3QFTA 1WW2A 3GCDA 3HBJA 4W63A 1ZIDA 3KRTA 3VH4A 4PCAA 3W34A 3BMNA 3GROA 4ZCIA 3NM4A 2ILVA 3RUPA 4WBNA 4PLZA 3TPCA 1KVQA 1OGIA 3G79A 3TN7A 4FBMA 1BFKA 1V5GA 1WQ3A 3PRYA 4YJFA 1NM5C 4FYMA 5H1YA 3FXAA 2GHTA 2I03A 4L8LA 2IHVA 4CEHA 4LSZA 3RE1A 2RFLA 2C9CA 5D7NA 1F8YA 3P0HA 5BV7A 3P19A 1CZRA 5B1HA 5CXXA 5AOVA 1TOAA 1GZVA 3C97A 1O0SA 1X1AA 2QUAA 4LZOA 3PLRA 3RKUA 3U17A 1PTJC 3ZCVA 4XCQA 3LHDA 1PWXA 3Q8MA 4U6SA 4QNNA 1RI1A 1CUAA 1HFWA 5AKIA 3E9YA 2OVBA 1IWBB 3DGFC 4WURA 4LJYA 2ZM6M 5FLKA 1D0LA 3HHYA 2A2ZA 1SC3A 5EJAA 1C5KA 1U9YA 4KR6A 5IKPA 2VNKA 4IO0A 3ZJTA 3WTBA 4WJLA 5DK6A 3KYCB 1D0KA 4DLPA 1GG9A 2EEPA 1DJOA 3VVBA 3SPXA 4N03A 1IATA 4O8ZA 2N75A 2VK4A 4DSZA 1VBKA 5KX5B 2Y77A 3B6JA 5C8YA 3M2PA 4ITQA 2X22A 3FMGA 1GXSB 2QSUA 3OZ7A 3ZIAA 3U7QA 2BEJA 3K0CC 4QFCA 2JAHA 3EE6A 5EHNA 1QG0A 4F2GA 1UJBA 3FZNA 5MGNA 5F73A 5E38A 5GM1A 1YZGA 3HCNA 2PUTA 5DCUA 4S1WA 2O8EA 2PUJA 1T1GA 3DE3X 1GQOA 4FGLA 2KEBA 5HIMA 1FDUA 3R3UA 5FUYA 3V8EA 1K5PA 1E0KA 3I6YA 5IFKA 3T3PB 2WSYB 4JYZA 2JCVA 4YAGA 2ZYHA 4UCWA 3EARA 4IX1A 3L8CA 3HJQA 4IKEA 1WW8A 3AEKB 4DMCA 1ZVKA 1IN7A 3TL6A 3K2EA 4UOZA 3P32A 5DYTA 1JZSA 4GXTA 1HSZA 1AGYA 4OQXA 2DAGA 3OTOB 3U3MA 1RQGA 3S1AA 1DKLA 1R4NB 3IPAA 2PKQO 3ZY6A 1TM2A 2KNVA 3E58A 4MIOA 3UCEA 1GZDA 3A9TA 4II3A 4RTSA 2XRMA 4PFQA 2P2NA 3PUZA 3PXAA 1PJ2A 3UKDA 3EPHA 1WUJS 3F90A 2WM8A 1B3BA 3PNOA 1RPAA 2I4RA 1T3ZA 2GPBA 3DBLB 1AGPA 4US0R 1PR6A 2WAXA 5F7OA 3SJUA 4K0KM 2B1QA 4YJHA 1K9SA 1QORA 3IELA 1B93A 4IJFA 4I6GA 2Z0MA 2NU8B 4O2AF 2D0DA 3ESYA 4G07A 4RV9A 3ENZA 2O6HA 6Q21A 3K6JA 4DCGA 3LDAA 1MO2A 2Z95A 4UEOA 3AOEC 1X37A 3ABIA 1SN7A 2C03A 4MW9A 4UQLA 3KSUA 1WIVA 3ADDA 3Q6IA 2PUAA 1ZM9A 4P92A 3OM0A 5E9QA 4UMDA 5FI3A 5HEKA 1KR5A 3F9RA 2NYVA 2BP7B 1TYDE 4BY9E 1LGYA 1Y4ZA 2P4EA 2VHTA 4BLUA 3DOUA 4UTPA 2QTVA 4IAOA 2MR9A 2Y0EA 4QYSA 1HT1E 2XDAA 4OU4A 1QRDA 2YHAA 2BZSA 1L5OA 3QPCA 2C1XA 3FLAA 3R3WA 1Q1NA 1NR1A 1B0UA 5J4YA 3EGXB 1GKUB 2WG0A 2WF7A 1LVGA 2VT2A 1VG0B 2BBWA 3QGMA 4FEAA 5KJCA 2DECA 4Q7QA 2R8BA 3R76A 5ALPA 1FVXA 4YUAA 4X6LA 4CGYA 1L2TA 2Z58A 4XM0A 5E6UB 2P9JA 5ECDA 3ENNA 3F7TA 1LPAB 4GGOA 3IT2A 3STUA 4IKPA 5L45A 3UV7A 3KK0A 4G4GA 3MT0A 4G8JA 5H3LA 4OB7A 2WNIA 1G7CA 3VO8A 5M04A 4LSGA 4E2WA 1Q3TA 4N6GA 3CVWA 4F3RA 1K8ZB 4DA8A 1CS4C 4NECA 2Q3BA 1C1XB 1NVXQ 5KVQA 3EZXA 1MVOA 2WUFA 3HKDA 1V4NA 3O8LA 3K9NA 4QTZA 1B0ZA 3T38A 3DVLA 2HFKA 2ZETA 5YASA 3WISA 4AECA 5BT9A 1VMIA 2B4RO 4I50F 4LWZA 1T34A 1D6MA 3HZHA 5LBTA 3RFXA 4B6OA 4IDCA 3BGVA 1ZGZA 3UOWA 5EJFA 4YRKA 2QN6A 3E53A 4NBUA 2NZXA 5BR8B 2RGBA 1I7NA 1Z2OX 2DXIA 4KGXA 2G1KA 1E7MA 5IVPA 4TXHA 2H08A 1MV8A 2PA0A 9LDTA 1XNRM 1WGLA 3PJEA 1GEGA 2VDRB 3DEFA 1VP9A 1ECGA 4RUKA 2WQ7A 4GHWA 4TL8A 2OFFA 2YJ6A 3EQ2A 3ILSA 3M6VA 4YRIA 3BH0A 3WGOA 2H2HA 3U44A 1GA6A 2LCQA 5B1DA 1QMGA 4S1TA 3LCMA 2LH0A 3QXJA 2IZ1A 4KQKA 4TT3A 5FAKA 1ZINA 2X5KO 1Q39A 1OI2A 1UQRA 1T9GR 2MSNA 4PZLA 1V0JA 1K7EB 4UM8B 3OT1A 1WVMA 1URPA 1ZMTA 2GEDA 3HN6A 2IPXA 2J0QA 4LFBB 1OILA 2R48A 1U9CA 2NU7B 3WMWA 1VA5A 1SCAA 3NM6B 3RUIA 5BMOA 2B1GA 2OR3A 3BRCA 3J7TA 3UGKA 2VPIA 2X42A 4EB0A 3QLUC 4YRPA 4N3GA 2NU9B 1RYDA 4DUYB 1JFFB 1EQUA 4TUYF 1CY8A 4TXLA 5FADA 3K9FC 4Q7MB 2QN2A 2XDQB 3IP7A 1KJIA 3W1VA 4NBSA 2QRVA 4P58A 2Z4SA 4LJAA 2CV0A 5IF3A 4D3YA 3THXB 3DO5A 1NXVA 3QPAA 2M6KA 4GRDA 5J5CA 3SHWA 5E6RB 4B3JA 3TTSA 1CJVC 3IX7A 1XNQM 3PBKA 2D7HA 2I8LA 2PMWB 2CNDA 4OVZB 5EXPA 5KBYA 4ZZ0A 5CUQA 1EUDB 2J9XB 2PUEA 5A5EA 3BTVA 1ZY2A 2C0PA 2O3QA 3DV0B 3QXSA 3AQ4A 1M0SA 3DEIA 2AXNA 3LDGA 521PA 1Z0SA 3W5SA 1DEXA 3B5EA 1XHFA 2BIFA 4MR8A 4GPTA 3UUWA 1SIWA 2NZVG 4YCSA 2OCGA 8CATA 5LLTA 1LVHA 3IDZA 1A88A 1ECFA 7REQB 5FQNA 3IG5A 3GF4A 1B8VA 2BFEB 3T9EA 4PVCA 4Z1MA 3HLKA 4G0WA 4RKRA 3NTRA 3DMTA 2RBEA 5FJIA 1Q0TA 1IQUA 2QL7A 3LV8A 2R66A 1R0RE 4WY5A 3E46A 4KYUA 4R9RA 1ZONA 4M54A 4OA5A 3ZNOA 2JZNA 3SZMA 3NALA 4UDXX 1OZHA 4XFDA 2HSEA 2WTNA 3VR6D 5H80A 1ESMA 1S02A 4PCVA 5BYBA 4GH5A 1I0ZA 5JSHA 4ES6A 3UJAA 2Z3WA 4MW7A 2BEWA 2CF5A 3OCJA 4ANFA 5ALGA 1YBVA 1PL6A 2VP0A 1TDZA 2Y92A 3AT1A 5AJUA 3AVOA 2HYDA 4GMFA 1SC1A 2V6IA 3HYRA 1JKMA 2HJWA 1MB3A 1TCCA 1ONNA 2WSSD 4FFBB 1UCFA 3AOGA 2HQRA 1SC4A 3NBFA 3HA3A 2RGUA 2HKJA 2WFAA 4D97A 1FX0B 4QGBA 1DL5A 1YJ8A 1NI4B 5JRJA 1F2TB 3ETNA 2R45A 3D7NA 3WV4A 4OXKA 5CTJA 2KMLA 3NWEA 4GEKA 3HP7A 5JXHA 1NIPA 1C1HA 2MDTA 3EVAA 1FPQA 4C0XA 2Z3VA 3F5FA 1SBZA 2AWOA 4YQZA 4HNVA 2UYGA 3HR4A 1Z08A 1K86A 2L18A 1NY5A 3GGSA 2HY7A 3BF7A 4CIWA 3ISVA 4NDNE 4YUWA 2MSDB 1M6HA 4KK3A 2VNJA 3FUXA 3BXPA 1UBFA 5AJTA 3RDPA 3J7AS 1U3VA 4B82A 3TDMA 3MWDA 2IDKA 3WK4A 2OXEA 4X41A 1L9XA 1UBOS 3AMVA 3VNAA 4QWMA 4I9GA 2FE1A 5ALYA 2VNHA 3GFBA 5LMUM 3NW9A 3UQZA 2AK3A 2RKOA 3SARA 3AFNA 1T6OA 1M8JA 3LKBA 2OO5C 2GHQA 4D9GA 4F8YA 2KQUA 4P4SA 1FJGM 3UK6A 3SKVA 4H2DA 4MYSA 2YHBA 4DQLA 1VMAA 2VDVE 2QE7D 3ESQA 4F4JA 2PL3A 3A2LA 1Y9EA 1J1UA 4GZ5A 2AMLA 2ZIWB 1LSUA 1R4GA 3OUTA 4ZQFA 4PX2A 5CDSA 3V8BA 2ANBA 1BDMA 1CNEA 5FBQB 4OSOA 2VJDA 4Y6PA 3LOPA 2PWYA 2P9QA 4WLFA 3LY5A 2P4SA 3VNSA 1NYRA 5DBEX 1YFKA 2ZJ3A 1TT5B 4TVBA 4D9KA 3DE2X 2BFBA 3P2OA 2BM9A 1TUIA 2A33A 1QB8A 4OAQA 4EFLA 3UJHA 1JXAA 3E9NA 5ALZA 4AY2A 4LG1A 1Z5VA 2OXIA 4LZZA 5HF6A 3B1VA 3NNNA 5I9BA 1QKIA 1O6CA 3RU3A 5LQJA 1E59A 5I45A 2FEKA 1T8RA 2J8ZA 4RTMA 2VHVA 3UYLA 2NV2B 4NYMQ 4HLDA 1YVDA 1ZBDA 5ENVA 4AKEA 5F98A 1GLNA 3ELYA 3H4IA 5JBNA 4CTJA 2GPJA 16PKA 4WZBE 4FQ5A 2OFOA 4UJ5A 1U80A 3VDXA 4DR6B 3T54A 3M9LA 3IAM1 2GK7A 4DC0A 1IBKM 3CA8A 1ZH0A 3OAAD 2X9VA 1FU8A 5JBIA 5B5SA 4HPXB 1EFPA 4G26A 3HKCA 4LVCA 3Q8KA 4ATNA 1E0JA 5H7XA 2R6GA 1UKBA 1V1MA 1O57A 4DLAA 3KQQA 4EPTA 1J90A 5HKAA 3Q7QA 2OCDA 1K6EA 1U4SA 4BDSA 2GUGA 4HWRA 1UWCA 5FWXA 4F6CA 1RHMA 3AZQA 5T6MA 3PB3A 1G8PA 1KXZA 3M6WA 1EZ4A 1WZCA 1KDYA 3MJ5A 4NXNB 1JKJB 4E7OA 1CBUA 1UBTS 4KAXA 3PR1A 4AG3A 4JV5M 3VGJA 2QX4A 3DYIA 1N5LA 1LFAA 1W36C 1TFUA 1FMTA 2QRGA 5DN6D 3RBVA 4G5FA 2I71A 5I7FA 1CQJA 3PNYA 2OK8A 1PFWA 2HRDA 5KTRA 5LP1A 4YJ2A 5ALNA 5J4KA 2CBGA 4UNQA 1AUVA 3PFHA 2QVYX 4MWDA 1W4LA 3NBZC 2PEYA 4CWAA 1KK2A 2JFXA 1Y98A 2FN7A 2LTUA 2CDNA 2NW6A 3I83A 3RVMA 1QKJA 1E7SA 2WHEA 4OKNA 1SK9A 5EFOA 3NP7A 3KSMA 1RZRD 3GEIA 2XLBA 3S8MA 3U7QB 4C7OB 4WA7A 4QUDA 4Y0AA 2H65A 5TPWB 4ZOLB 4ZK2A 1HG0A 3DO6A 3DZBA 2HMAA 3L0DA 3WZLA 2ZKIA 3K0HA 1R18A 1DE0A 3KZXA 1D1SA 3DWEX 1HR0B 4MVJF 3KX2A 4AJJA 4FZVA 1EPUA 3DEZA 4U9IS 4HVCA 5FO0A 2W6NA 5JD5A 1NHWC 4UHCA 2BMEA 8LDHA 4FDUA 1C1YA 2RHHA 4BVLA 4FNMA 1V41E 2PKYX 1WOMA 4H7FA 1WX1A 5EXSA 1SVSA 4E2FA 2UZ0A 5J59A 1B7GO 1MOPA 3C15C 3T5BA 2F4VM 2JFFA 1EVIA 1CVRA 4HCJA 4RJKA 4MUIA 1YRHA 5H4HA 3SSNA 4WUTA 2ZAYA 4HEJA 1EX6A 1HE8B 2M60A 3H5IA 4AICA 2W2LA 1GITA 3DKVA 3EVEA 4U1RA 3OFNA 1I10A 4NE9A 2PXAA 4KPYA 4MYUA 5CVJA 4URYR 9GPBA 1IPHA 1XHBA 5ED0A 2VHWA 2WAAA 4FFOA 1R8JA 4RH1A 3V00A 5T4BA 3THYA 2C4TA 4D8WA 1JU9A 2XWPA 4RELA 3KFUG 5AHOA 5GVRA 3L84A 4MYDA 3WOVA 3KLMX 1TJ4A 5AIBA 3ZDZB 1H1LA 1N8SA 3K9CA 1FRQA 2BAGA 4ZQGA 5AM0A 1ZQ9A 4QTYA 3LW7A 1OX5A 3FOFC 1PJSA 5HCUA 5BW6B 3GJSA 3TRIA 3OPVA 4B2LA 4XEUA 1AKUA 1WD5A 2VJNA 5F9MA 1VXOA 4E5YA 1FJ2A 2XNDD 1R66A 4MV5A 1TF2A 4DQDA 5KOHA 2PQ6A 4C06A 1ADCA 3SYNA 3PGA1 1LRLA 3UWPA 3GCGA 4LE0A 3LGSA 4KVZA 1T3GA 4UHHA 2J45A 1AY0A 3IILA 1T3LA 3FDFA 2UXDM 1JLLA 3WWDA 4XQ9A 4A26A 3E1SA 3NR2A 3RM3A 3NWLA 4Q9NA 3OOHA 3FYUC 1QIGA 1R0LA 2FPIA 2RH4A 3NFYA 4OM8A 4G1CA 4OOEA 2HSWA 1HNZM 1O94D 4WZBA 1C8KA 4QAQA 3VISA 4YMIA 2D7GA 4G25A 4BMZA 2QMOA 1OREA 2FA9A 2EFYA 1O2DA 4WGGA 2O4UX 4A36A 2O8VA 1WNFA 1FYEA 2QTTA 1W2HA 4AYWA 4G1EB 1SVMA 1IK6A 2OV3A 3ZGNA 2DB3A 3A37A 3WI7A 3MGCA 1L7MA 4BLPA 1J0AA 5I7AA 3G9ZA 3QLVA 3ZCBB 1U63A 1VI2A 4KAJA 3KQPA 4Y2TA 4IJKA 4M0KA 1LV8A 2AJ8A 2M98A 1IFYA 4BFSA 3FPGA 1VIVA 2MSLA 3CPHA 4RETA 1VJCA 1CUEA 2Q3MA 3HP1A 2G76A 3HUEA 1C81A 1ZLYA 1UZUA 4I55B 3GD7A 3ZW7A 4X85A 2HWJA 4OLFA 3KJHA 4RTOA 4FGUA 2CXXA 3TL4X 2QRQA 4U3JB 4MVYA 4ZQHA 1OXXK 1XQWA 2OXRA 4MB0A 2PLRA 3HKDB 3IBCA 1VBNA 3GMIA 1FFDA 3H3XA 2IYSA 3EZNA 1U04A 1NN3A 1ZK3A 2R751 3ZI4A 2DBZA 1VRCA 1M34E 3I5YA 3JSAA 3DWFA 3QYAA 2YV2A 3TQFA 4DGQA 2JNWA 2WWYA 4GU5A 3TLEA 3AFMA 3EDRA 4QOIA 5AI4A 4CIXA 1CNFA 2WFZA 1OKKD 3SYLA 2Q46A 3A9RA 3HDJA 3CRZA 4TV8A 4YMHA 5DT2A 2FRDC 5EZSA 4ME6A 4JQCA 5D3QA 3C8DA 4CTKA 1JLMA 3EMDA 3GDWA 2YNMD 3ORHA 3KR1A 2QRZA 2PT7A 4BGDA 1ACJA 3BCUA 2O5VA 3JAMA 2ZAMA 1RWMA 1DCKA 3EGWA 2G0NA 1PG0A 3CR3C 4TVSA 1B0AA 1IHYA 1E6LA 3GZTB 4KO1S 1SNYA 5HF8A 3WGVA 5CFRA 3HCFA 2XUOA 5FBLB 1M83A 4EHNA 1HWYA 421PA 4ZCRA 2PD6A 2IH4A 2JFQA 2J4CA 1DEOA 3P9KA 3DKIA 1A5BB 1Y5MA 4KPEC 1XMOB 3U7HB 5CT5A 1KAOA 3D8NA 4HXEB 2ZQZA 4GPIB 3C6ZA 2WKPA 3EGVA 3MMXA 1GQYA 1FK8A 4D4GA 3RYCB 1LSOA 4YK7A 1ZUHA 2DY0A 4E70A 2C04A 2I2CA 1TW2A 3W2HA 4QVKA 4ECAA 3DL7A 1ESCA 2IX9A 3UFXB 2AJCA 4D0GA 4G0MA 1TYBE 2PU5A 4FOLA 3ZHZA 4GSLA 3AY3A 2ZZMA 1P2FA 5JO9A 2QRVB 4US2R 1Z4JA 2LNHC 4RF0A 4OF4A 3H2KA 1QVAA 1DKOA 2I2FA 4S1PA 3RKSA 1Z36A 4ZOCA 2QF7A 4OQQA 3UWSA 1IAQA 2RHTA 3ZPXA 4WLVA 4ZIRB 2AEJA 1T10A 3FWZA 1M2EA 2W0SA 1ESEA 4P3NA 1Z56C 3MIIA 5CBPA 4L8RC 3S2FA 2IXBA 1X74A 5DHAA 4NPHA 4O4JB 1I7LA 2SHKA 3VMFA 1L4LA 4C2UA 2FG5A 1TRHA 1UAGA 4IDHA 1OT5A 1VLHA 3ZJYA 2B4YA 1W9HA 2Y66A 4EDHA 4KHPB 4LUCA 3TIXB 2UUBB 2NT4A 3HB0A 4YJDA 1OFVA 4FMDB 3P4UA 3WGGA 1L3IA 2VK8A 4W1SA 5FBHA 4DKJA 5DSTA 3A58B 3EDQA 4OHCA 2H5IA 2A3NA 2JLSA 5DBIA 4NEQA 4V0KA 3RYIB 4Q6BA 2CY0A 4UU1A 2P3LA 2I76A 2WSEF 3V4RA 2WSLA 1TNDA 5FHRA 3GEHA 4B7UA 2K2WA 3UMSA 3QX7A 2ZYVX 1UFQA 5ARDA 2V74B 2X15A 4NENA 2XUKA 4FK8A 4N5IX 3TWKA 1SR8A 1Q0HA 1OR8A 2GSDA 2ZSDA 4KFSA 5LZ9A 1AV7A 3I37X 5IXJA 5CLGA 3IQHX 4DJTA 2NXJA 3U9SA 4O63O 2ODQA 2OQRA 1JJIA 5KSZA 2GAIA 1L4HA 4YAFA 4PSDA 1FNCA 3MD0A 1VECA 3CNEA 1F6WA 4F56A 2Q4OA 1JEOA 3ZUGA 5DF1A 3PFGA 1F60A 2QI9F 4DCSA 2G1AA 4FONA 2G7MC 2HUNA 2W2TA 1YZUA 5DGTA 3JATA 5HKOA 3C8ZA 1Q84A 4WK4B 5EMJA 5F2NA 2VA9A 3S27A 5BORA 2ZYIA 3A3YA 3U4HA 1RS0A 1ID8A 4CQJA 1XEFA 2HMTA 3QVUA 4DLSA 3QELA 4NBTA 4WASA 1DKUA 1U99A 2R46A 1NJFA 4RGQA 1RPZA 2APJA 1QGYA 5GONA 3RU2A 1M34A 3GU3A 4CEIA 5LQKA 4NMWA 2FSFA 1HNWB 4Q7EA 1DQRA 3B82A 2WI8A 2ZTMA 3WX0A 5IKMA 1H4TA 5F52A 3Q10A 1GSAA 1CVLA 2PIAA 4FWHA 1EJBA 3WIDA 2J3EA 4IRUB 1GFZA 4TYMA 2A9PA 1GJTA 1MO6A 4BWFB 1CFJA 2GASA 2XTJA 4Q3CA 2H5EA 3FSGD 2OENG 3KYBA 4PS0A 3CUUA 3ANTA 3OEEA 3BGWA 2EFCB 2D6FA 3MWDB 1M74A 1X1DA 1CIJA 4AZ3A 1WHSA 3C7KA 3EC1A 3CPEA 2XE7A 4GPBA 1UMDB 1XLWA 1XRMA 3QENA 4ZZ1A 2BWEA 2BTEA