3U61B

Structure of t4 bacteriophage clamp loader bound to closed clamp, dna and atp analog and adp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
305
Chain Sequence
b'ITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 95
structure length 305
sequence length 317
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u61B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u61B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u61B01
1P60A 4PHGA 3F8TA 3AF4A 2W0SA 4ILEA 3BAFA 2DR3A 4TLBA 4BLSA 4X8OA 4DWJA 3ICEA 1ANKA 4LRTA 4QHYA 1KI2A 1HT2E 3K8YA 4DJTA 1A82A 4BFWA 1OFHA 121PA 1O3YA 2Z6VA 3E5HA 3QF4B 3PJRA 5F98A 2ZE8A 3AF1A 3KJGA 1FL9A 4W7SA 1U90A 1G3UA 3UXMA 4KYUA 1Z29A 5JZVA 2QL6A 2G0TA 1IOZA 5EP2A 5FOVA 2PBRA 1T8TA 3SJBA 3SU8A 4A8JC 4NU0A 1XXHA 4IJMA 2F3TA 2F43A 2J59A 2DPXA 5J4KA 3I5XA 4WAUA 3A4MA 4HB2A 2R8RA 3GCGA 2V1XA 1TUEA 2PZGA 4I81A 4TMVA 4V0KA 3W9YA 3HJNA 5CDFA 3GLHA 1M7GA 1QHGA 3K0EA 3DPUA 2NMVA 3D31A 2XOKA 5SZKB 5EE5B 2FNAA 2ZR0A 3GLIA 1SQ5A 1Z8FA 3DEFA 4IVRA 3A1VA 4US0R 1KOFA 3AGQA 2Q9BA 2G83A 4F92B 2IWRA 2ATVA 2B6HA 2I3BA 3FOZA 2HT6A 5JWRA 3QQ5A 3AJIB 621PA 1FTSA 4QJ4A 4JL5A 1YZLA 4DB4A 2WJIA 3C7KA 2AKYA 2OILA 4A3VB 1HUQA 1XD2B 4V03A 2G3YA 1YU9A 4I1SA 3U6BA 1XPRA 1PZNA 2OT3B 3KQLA 1NI3A 1L4YA 5FH9A 3THXA 1XJ0A 1CTQA 1UBGA 5EXXA 4DIEA 1FW6A 821PA 3THYA 3MHVC 3WHLA 3VHXA 3OEHD 1U2RA 2CHGA 2HF9A 4Q4JA 3EPLA 5IK2A 3Q72A 4B3XA 1NKTA 5TARA 1H8HD 3JZAA 4JN6A 4GZMA 1WF3A 5TVKA 4MDFA 4TZ6A 2ZVQX 1NL3A 3EZ7A 4K46A 3RS3A 5FR2A 3VR5A 5FBLB 3IIJA 3MMPA 4C0LA 4MGYR 4DCTA 3LNCA 3GQBA 5DE3A 3RRZA 4ACAA 3QOFA 3WNCA 1P2VA 4V0ME 3ADKA 1E2LA 4CIDA 3FKQA 4M0LA 1BS1A 3MGCA 5D3MA 4YMVA 1RC8A 2E87A 2DFTA 2RMKA 5JRZA 3QENA 4EPTA 2RGNA 4DSUA 4LJ4A 1EFRA 2IYZA 1NIJA 1NP6A 1LVGA 2NZ8A 2UZ3A 3GLFE 1KKLA 2PCLA 3N70A 2GBLC 3C4JA 4C0HA 4BFUA 2QRZA 4EJSC 3VFDA 4P4UA 2I4IA 2HXSA 3VAAA 3JVVA 2B8TA 2BCJQ 2ZAMA 5GJWC 2HLDD 2XXAB 1RIFA 2ZTSA 3D7MA 2ZJYA 2DZOB 4L8GA 4DT1A 4OK5A 2KWIA 4XWOA 2B92A 4MKIA 2ZI5A 5CYPA 1SULA 1NNEA 5KOYA 4IOJA 4BFXA 1WRBA 1N6OA 5E7JA 4L15A 3QF4A 1IY0A 2BC9A 4NYJQ 3M6AA 3T35A 2Q9AA 1NKSA 2FFAA 3C5HA 1A1VA 1AS3A 1M7HA 2GZDA 4NBSA 3BB1A 3EC1A 2JJ1D 2D3WA 3LQRA 3PCRB 4HAWA 1E79A 5KSOA 2Z5FA 2ZJZA 1CKEA 3U5ZB 1G16A 4IOLA 4PHFA 4P31A 5GJBA 1S8FA 4NMMA 3MD0A 1JI0A 3IDQA 4LJ9A 2ODNA 3KQNA 5AK0A 1VG9B 5IDVA 4OBEA 3S1AA 2Q3HA 2QMEA 1NVWQ 1N2CE 1YZQA 3IHWA 2IK8A 3B1ZA 2BM0A 3NBXX 1AIPA 2WWWA 4TMWA 2GETA 3ZD7A 3MWYW 2FZLA 2Y8EA 2C8VA 4CDGA 1G5RA 2ZRFA 2OCPA 2PX0A 3M0EA 1G3QA 3IO3A 1XNJA 3GJ5A 4NYIQ 2BBWA 4XWAA 2C99A 1G4AE 4URYR 2GJ9A 1XD2A 3ZZUA 4C0QC 4WOPA 1JR3E 2RAPA 4HZUA 3AH8A 1D9ZA 2RGBA 1G8GA 1TPZA 3B60A 2JLUA 4DSTA 3I5YA 1ETUA 2A5JA 1HV8A 1PLJA 5FL7A 2QROA 4GT1A 5DI3A 1QDEA 4AYWA 2CCGA 1IY1A 4PC1A 3R9IA 1KI1A 4I1VA 1K5GA 1FP6A 1YR8A 1OF1A 3BFVA 4B2IA 1ZINA 2CJWB 1BKDR 4EFLA 5DN6D 1XU4A 4MITA 3FMFA 2ZR9A 2CEAA 4BLOA 1S3SA 2GJSA 4B2LA 5FPHA 2YV5A 5HE9A 5AR1A 4LK2A 1WBDA 3SN6A 3BS4A 4QXAA 4D4LA 4KLNA 4QBFA 1SXJD 5BN5A 4GNKA 4A2QA 2ZRKA 1F2UA 2FF7A 2ZSAA 5AJVB 5AUOB 4EFNA 3IGFA 2F55A 1EESA 2A3RA 4U00A 3LWNA 1W4AA 5DNYB 4XVQA 3DOFA 2HJGA 4GMXA 3BJIC 3KKNA 3I73A 4TT3A 5JECA 4RD0A 3TKLA 1SVMA 1G17A 3NHAA 1I4LD 2NPFA 1VTKA 3R8CA 3LA6A 3CUEF 1SVLA 3KB1A 4MKHA 5EE3A 2IS4A 3GLFB 4O25A 3U44B 1E2DA 4C0KA 1OIWA 3LV8A 2B7CA 3E70C 1E1QD 2O8CB 4NZYA 1D5CA 3Q85A 4HEJA 3DO6A 4B3FX 1CP2A 5LB2A 2BEKA 4NH0A 2NPIA 3AV0B 3BXZA 2OUKA 4M1TA 2GHIA 3W8RA 2ZR7A 2VSXA 1UKZA 3T1OA 4RD4A 4BFZA 1U9IA 4HAXA 4JSTA 1R0ZA 2D62A 3CX6A 1MT0A 721PA 2WBLC 5K8IA 1D6JA 2J7KA 2QPOA 4HLUC 2H16A 5DISB 1D2MA 5IRCD 5B57C 4Q1FA 1T5IA 5BN3A 1MO4A 2ZRPA 4J0QA 2EYQA 1ZD1A 1W4BA 3E2IA 3K09C 4OI1A 2XZOA 4E09A 3ZZTA 3A37A 1G291 3I8SA 4TYYA 4F4IA 5FUVA 2WJGA 2QAGA 1SKYE 4GRAA 4NCIA 2XGJA 1JXOA 2DWOA 3W34A 1GL6A 2PL3A 3OE7D 2QN6A 2VF7A 3BH7A 1UEIA 1VYVA 2XNDA 2YC2C 1P2SA 1NN5A 1W2HA 3QBVA 2WAYA 4P4TA 3TIFA 2ZE7A 3MFYA 5KSPA 4Q01A 4PO1A 3FMOB 1Q3TA 3BC1A 4JLKA 4QJ3A 3V4FA 3RS0A 4DCUA 3X1DA 3H84A 1W36B 4CT5A 1DAIA 2GXSA 4GL2A 2FJUA 4PPNA 1M2OB 4HUTA 3CRW1 4D26A 4TLDA 2NGRA 2CXXA 4TMTA 4RZXA 5HZKA 1W5SA 4C0AC 1ELOA 3UG6A 2ZS9A 4MYHA 3GJ0A 5E7IA 2CJWA 4E5UA 4RD1A 1W5TA 3V9PA 3FFBA 1ZVQA 2YINC 3QKUA 3KQKA 1LB1B 1EWRA 1F6BA 1GL7A 2ZAOA 3SYKA 1COWD 2HV8A 2PLRA 4JBYA 2DVWB 1NJFA 2HEIA 4TTRA 2B8WA 2GJKA 3DKPA 3U61B 3LW7A 4Q1CA 3GJ6A 1GVNB 2N1BA 2VHJA 2MSEB 1GTVA 1QVAA 4EPWA 1OPXA 4ARZB 1X8KA 4AD8A 2ZJ2A 4P4SB 4YDSA 2J45A 3X1WA 2JLXA 2GEDA 4US2R 1CXZA 3IBYA 3QXHA 2V55B 4GDFA 2QUZA 3K9GA 4LBZA 5KYKA 2ERYA 1E9CA 2EQBA 1VECA 4AYXA 1OB5A 4KFTA 1KJZA 3U2QA 2YWFA 1UFQA 3NH6A 1GG2A 3H0KA 3DOEA 2FGKA 1DO2A 3U3KA 4A0HA 4DLXA 2BKEA 1GITA 4F38A 2D74A 3A6PC 1W0KA 2V6IA 3N2IA 2C77A 1CU1A 1KDRA 1QHYA 1R10A 3B85A 2ZRHA 4DVGA 5KNCA 3U44A 3IEUA 2ZPTX 3UKDA 4DDVA 2VP2A 4QKQA 1NN0A 3K9NA 1NY6A 3K70D 2O8CA 2F1IA 1S1CA 4ZDJA 2P3SA 3WBKA 5K8UA 1KI7A 4AG5A 1F60A 2CE7A 2R44A 2YHSA 5AUNB 3U3RA 4HB4A 4MGIR 4OHXA 4DCSA 3SYLA 3ND8A 3AVOA 4LHVA 4MRVA 1G9XA 4R9UC 4BZXA 1AS2A 1IBRA 3IHLA 4DHEA 4MDEA 3DL0A 2ZJOA 1HTWA 1AQUA 4PFSA 1G5TA 4US1R 2JEOA 1UKVY 3LX5A 3IILA 4B3GA 3RSLA 1C1YA 1DVRA 1M34E 4XH9B 4RKFA 1XPOA 4AKIA 2ZRMA 1GOTA 3QVVA 5FOUA 2R65A 5JJKA 4QC2A 4IEIA 2GESA 4IW3B 3TVDA 4DLRA 2IXFA 3L0SA 2R9VA 2OESA 1J7KA 2F9MA 1VPLA 5HCIA 3W6PA 2J0SA 3NBFA 4PC7A 2GTPA 1Q3HA 2IUTA 2LKDA 1R2QA 2BMEA 4I1UA 1CR4A 3CB4A 4JBWA 3MJHA 3IO5A 2XSZA 2RGXA 2OHFA 2ORVA 3R9XA 2CMKA 1SVIA 4Y0AA 4RVCA 4LYHA 3K0AB 4Z8XA 3ZIAA 4D4MA 1YHNA 1KJWA 3CPEA 2EFEB 1P75A 4L4UA 5EUQB 5TB5A 1SKYB 2ZRDA 1ZUHA 2OBLA 4GITA 2WWGA 3DM5A 2OG2A 3PIRA 1WA5A 2ZQ5A 2PT5A 3TE6A 1D8TA 3K0CA 4F4JA 1WXQA 4EJSA 1U98A 1JR3A 3CWZA 1G41A 2FFHA 1P6XA 1FUUA 2W6IA 4B76A 3DDCA 1FX0B 3THWA 2Z83A 3Q7QA 4Y0VA 1BIFA 3AQ4A 4NCJA 2EYUA 3U60B 3SHWA 2YYZA 1GNPA 3P4XA 1W46A 2VQSA 2ZI4A 1RYHA 5B2ZA 1EX6A 4DLUA 4LYFA 3T1VA 2GDJA 2ZEJA 3PUZA 4JLDA 3X2SA 4C7OB 1JAIA 2R2AA 2JDID 2ZRJA 2AFIE 2OFWA 2AL7A 2NQ2C 3GLGB 1T5LA 1WDTA 4K81B 3TK1A 4ARZA 1Q22A 1KMHA 3PV0A 4P4SA 1E94E 5FI0B 2IYVA 3EA5A 4NL4H 2AFHE 4DCNA 1G4UR 5FTNA 4DUGA 1DE0A 1Q20A 3TR0A 3NC1C 1G5PA 2EWVA 2FSHA 1QF9A 5J4VA 5KTYA 4QHSA 4KHZA 5L3RA 3LVQE 2QPAA 4FI3C 421PA 1AK2A 1P3JA 4QM6A 3QEJA 2UZIR 2GXAA 2BMJA 1GRNA 2QMHA 3ASYA 1T4GA 2NZJA 5EE1A 4GPTA 1LY1A 3CZQA 3OFND 2R9GA 5E7MA 1LW7A 3TH5A 5HZHA 5LD2B 5JCZA 3K9HA 1JJVA 3I32A 4LPSA 1XTJA 2WMNB 2QM7A 1W0JD 2X8AA 5C18A 4LDJA 1YJ5A 2G1KA 3CH5A 4PXAA 4D0LB 3ZVNA 2X19A 5FI1B 5HE8A 5LDDC 1V5WA 3HU3A 1MRSA 1O87A 2YZ2A 3TAUA 1OW3B 1UBCA 2ZRCA 4HAZA 4Q4AB 1ZYUA 3RANA 4YXWD 1XRJA 4DXAA 3CF2A 1P73A 1N5JA 2ZI7A 4BFSA 1SXJE 2OSBA 2QMUA 4LCBA 1ZM9A 2ZSFA 4BWYA 4EIWA 1UF9A 3SOPA 1G3MA 3QXSA 3BH0A 2D2FA 3TLXA 2NO1A 2VHTA 3QIAA 3IBGA 4LY6A 1N6PA 5JBQA 2BBSA 3P27A 5EE0A 2BV3A 5KSYA 4ESVA 4ZI3A 2ZUBA 1XX6A 5G3ZA 2PEZA 2P5TB 2R6CA 3KXLA 3DM9B 4BEBA 3EASA 2IYYA 3GEIA 4A92A 1E9DA 1XZQA 3C8UA 2WICA 2G1JA 1U9IC 4JLOA 4JJZA 3EARA 5TXGA 3LX8A 2RB4A 2IYXA 3RDPA 2ANCA 3BRWD 1ZNYA 4Z54A 4PC6A 1E1RA 4BQSA 1W47A 4R71A 5FL3A 3KKPA 1LV7A 1CS4C 1DAMA 2JAQA 2RCNA 2A5YB 4U5XA 1N6KA 5B64A 2QQEA 3PVSA 3VU9A 2GZAA 2WVJA 5FUYA 1FX0A 1QHSA 3HR8A 1JJ7A 4ZV4A 4NP6A 3TSZA 5JS7A 4M8NE 2JLYA 4KO8A 3ZZ0A 1XDBA 1BYIA 2GRJA 5J40A 5J5CA 1KO8A 5FR1A 4BEJA 5B58C 1OH7A 2OE2A 1E3MA 2C04A 5CLQA 4C7OA 3OF5A 3BFKA 4Q4HB 2W2XA 2DWZB 2FPKA 3EA0A 3G0HA 5H8WA 2HXYA 2QAJA 4OQMA 5BYJA 1GRRA 1Q1EA 3VTKA 4M1YA 2IW3A 2PJZA 5KDDA 2P5SA 4LJ5A 1KGDA 4R2HA 4QRHA 1IJEA 2QG6A 4DEXA 4AKGA 3KXIA 2J0UB 2L0XA 1VG0B 1Z07A 2ODWA 2VBCA 3OIYA 4GZLA 4S35A 4FWIB 2O8FB 1XFAA 4NONA 1Q0UA 4BRWA 3SQWA 2C9YA 2GA8A 5JWHA 1PVOA 4GBMA 4QG7A 3EXAA 1SVOA 1F5NA 4PPQA 4POAA 1NSTA 3K09A 1NMZA 4M9ZA 1N3BA 2FH5B 2V4ZA 1VG8A 4OK3A 1H8EA 3RS2A 1KI3A 3RRYA 3HPQA 4ABYA 4E22A 3KQUA 3KXKA 2H17A 4W5HA 1D2EA 4TLEA 1OSNA 1R5BA 2A30A 3U6KA 3DVLA 4URUR 1PJRA 3EWAA 4Z1MD 3NHBA 3KKMA 5DI9A 2C9OA 3L0PA 3UANA 1RRPA 8OHMA 1EFTA 4KU4A 1Z0IA 4Q4AA 1S9DA 1EFHA 4PZYA 1NY5A 2TMKA 4GFDA 4F7WA 4UXIA 1IXRC 1VIYA 4BZQA 4Q1AA 1TQ4A 2FG5A 3CBQA 2QZ4A 1II8B 1KY3A 2IBMA 2PH1A 3FB4A 3HYTA 4LJ6A 5L3QB 3NH9A 4WZAE 3NTUA 3OHMA 3SNHA 3PITA 3WNDA 5FTKA 5EUMA 3EX7C 2J41A 1TNDA 4B2PA 3VX4A 4UQOA 4ZCIA 1NBMD 4XIGS 3FKSD 3KUCA 4CYMA 4G0NA 3MRSA 3TUZC 3AVXA 1ZD9A 3OIUA 1SXJB 3NEJA 4WXPA 5DHAA 5HR5A 3AVUA 3AVYA 2F7SA 1HQYE 4LRSA 1LS6A 4ZDKA 2ZJAA 1NVVQ 2GCPA 3GD7A 3I72A 4N3NA 2PZFA 5F2EA 3RS4A 4CEHB 2JLWA 4LYJA 4B33A 3KX2A 3OEEA 3LY5A 3AUXA 2NO9A 1IXZA 1KKMA 3AVWA 4ASUA 3C41J 5JCPA 1AGRA 4IVQA 1XCMA 2GJ8A 4O2RA 5FOXA 2J46A 1Z47A 3KFXA 3L2OB 4AURA 3PEYA 3D8BA 1FOEB 3FWYA 3BGWA 1NLFA 1U8ZA 3X1YA 4MYTA 1RE0A 1QHHA 2ZREA 2IYLD 2VP4A 2CHQA 1T3HA 3A8TA 4TQAA 3VKWA 1MABA 2F6RA 1Q21A 4G5RA 4R2IA 1OXXK 2BIFA 4LWZA 4D0GA 3I92A 4S2EA 1CR0A 4UNRA 2F1HA 4Q4HA 2BMFA 2QGZA 5CYOA 2Z4SA 1YZUA 2C2HA 3GJ3A 1TADA 4NCNA 5KNBA 5EXTA 4LOAA 5J4YA 5GJVC 4F91B 2ASEA 3QXXA 1YZGA 5IF9A 1UEJA 1GZSA 1UKEA 1NIPA 4NPHA 2XOKD 4BFYA 4OKSA 4OQFA 4EFMA 2A78A 4AIIA 3PEVA 2DWPA 4XTCS 2ZRNA 4CEIB 4OJQA 1W36C 4IRUB 2XTZA 2A2ZA 3CPHA 3K0CC 5HPYB 2J0UA 1ZC3A 3HYRA 1R0WA 1DBSA 2IUSA 4BECA 4ZIRA 3J81k 4NHOA 4R7ZA 2YVUA 1GDDA 2O8FA 1QG4A 4JLMA 5KHOC 4X8HA 3QUSA 2O0JA 2O5VA 1YE8A 2AXPA 3PENA 4Z8YA 4D4KA 3WNBA 4FMDB 5DGXA 3EPJA 1U94A 2PLFA 3UG7A 4A0FA 2AK2A 1R6BX 2P2LA 3FVQA 3KUDA 4KITB 3B8HA 2QENA 1TF2A 2IXEA 1AGPA 4IOMA 2HF8A 5L3SB 3NIBA 2VP9A 1SVSA 1C9KA 1QHIA 2REXB 1A2KC 4M1WA 3GFOA 1RVDA 2J9RA 1CJMA 1JAHA 3B1YA 2GCOB 5AJWA 3FFAA 3G82C 1S9HA 2G6BA 1XD8A 4A1FA 3KJHA 5FTMA 2ZU0C 5IK2D 2WWYA 3SZRA 4C3ZA 4NYJR 2JJ2D 1X1RA 3RLFA 2GAOA 3UATA 4OQLA 4JYCA 3VKHA 2ZU6A 1ZCAA 2MMCA 1HQCA 2XX3A 3HR7A 5HKKA 4LUCA 1JXMA 4UJ3A 1R8QA 3K1JA 3AKCA 2R6FA 1E0KA 2HCJB 1KO7A 1TEXA 1Z0KA 1M1YE 1N5LA 3IIKA 5L3QA 4HDQB 2EU8A 1TQ6A 3MWKA 4PTLA 1Z6GA 1XD9A 2P67A 4Q9LA 1Z08A 4XSHA 1IQPA 3Q3JB 2OLJA 2WV9A 4C4PA 2Z4RA 3U4QB 3RRMA 4MGZR 4IVPA 4JLNA 2DYKA 3B6EA 1Z3IX 5C4MA 3BE4A 1EFRD 1UKYA 1OV4A 1II0A 1DELA 1OYYA 5EP4A 4LV5B 4AKHA 4DDUA 4PZLA 1YVDA 2IC5A 3TVTA 4FMCF 1UDWA 1T91A 2AHOA 5A0FA 4BZPA 1GWNA 1Z06A 1CLUA 4NYIR 1YR9A 1PLLA 2ZROA 1P72A 1SHZA 3P32A 1XZPA 5CIQA 3ZDQA 5JFGA 5JHHB 2QTFA 4R98A 2IS1A 2JLSA 1E2EA 4OI0A 3BOSA 4DLZA 3RS7A 1FFHA 3KFVA 2ZRIA 1JNYA 3SC3A 4DBLC 1S0UA 2IS2A 3MUFA 4NTZA 2A5GA 4QHTA 4AY2A 3LVRE 1P5ZB 1T0JB 3K70B 4LSGA 5CB6A 2ONJA 1N5KA 2VLIA 1E98A 5BXQC 1TQ2A 1E4YA 1KO1A 2AR7A 2IYQA 3GFTA 1G6HA 3QKTA 4N0EA 5CK4A 1A5TA 2WAXA 3A1SA 2R6GA 4TSFA 4QFMA 3VX3A 4A36A 4RD2A 3L43A 3TRFA 1G1MA 2SHKA 1OHHA 1E79D 1HH4A 3QI2A 6Q21A 3SQXA 1S3GA 2HDNB 4JZKA 1JALA 3RAPR 1OKKA 3T61A 2XJ9A 4OI2A 5FPYA 4CEIA 4FXPA 1K6MA 4PAOA 5C2JB 1N6HA 1G18A 4URZR 2IXGA 2DFKB 2XTNA 4FMDF 2Q0HA 2QORA 1CEEA 1IN5A 221PA 4B3CA 4IKEA 1TMKA 2JA1A 2XXAA 1F48A 4ZPXA 1IN7A 1UBFA 1FZQA 2QGNA 4AK9A 3R7WB 2WSSA 4KFRA 3U7FB 3QG5A 1QRAA 1T3LA 1CR2A 1UJ2A 4Q7KA 4Z51A 3QXCA 4QNRA 1DADA 2OV2A 2P6UA 3K0FB 1J8MF 2I1QA 2W58A 4PPGA 1YQTA 3B82A 4DLTA 4A15A 2ZUCA 1Z0AA 5JS8A 5L3SA 3UPUA 3H1TA 1JPNA 3LXXA 3BBPA 2WWFA 3FDIA 2WZQA 3C16C 5CM8B 1E9AA 2ERXA 2H7VA 4P32A 5FL7D 4JMPA 4PX9A 3L8YA 4TMKA 4P3YA 1X6VA 4KVGA 2ZYUX 2OAQ1 4Q00A 4D81A 3F5FA 1GIAA 1QHXA 1XF9A 2AK3A 4F4CA 4P33A 5JSZB 3VR6A 4CVNA 1Z6AA 3WRXC 3R9WA 1MV5A 4HI0E 1JECA 5FFMA 2WJJA 3B1VA 3GJ8A 4OHZA 2QBYB 4FCTA 3A1UA 2WWHA 1GL9B 4LHXA 3SJAA 3U4QA 5LD2C 1BMFA 1KIMA 2RH5A 3LD9A 3H4MA 2A5DA 3RC3A 2A5FA 3PFIA 3OESA 1R7RA 2IUUA 3AVPA 4KJZA 4B6FA 4KFUA 1YR6A 2ZVPX 1KSHA 4MH0R 3AVVA 4BUJA 2VP0A 3O8CA 4TT3D 3IPYA 4GSYA 4JBXA 5DHFA 3CKLA 4D25A 2BJWA 2DZNB 1KO4A 2K5UA 1XP8A 1NVUQ 2JASA 2ODBA 4Q1DA 1MH1A 5CLLA 3K9LA 2R62A 3ADBA 4LRWA 3WYFA 2V8OA 2J1LA 2JLVA 1XB2A 4ZKDA 4OL0A 5JI2E 1GILA 1K8RA 1TF7A 2CNWA 4LJAA 4I4LA 1HA3A 4M1KA 3CF0A 3PQCA 5AUPB 2X1VA 3LXRA 3DZDA 4GMDA 4HLCA 3TAHA 3GLGE 1ESNA 1A4RA 5JI3E 1RRCA 2OBMA 3LQQA 4RY2A 3QVUA 3AVTA 1E0SA 1EXMA 2JLQA 2JIZA 4DCVA 5C46F 4M9SA 5C4GB 2H92A 1E2JA 2B7BA 4PQFA 4G01B 1VCNA 4OHYA 2YOGA 2Q3MA 1XTRA 1CBUA 3OZXA 3B5JA 4O2LA 2GWHA 4KAXA 3QG1A 4Q1EA 3JZMA 4BLRA 5E95A 4TQ9A 4PR0A 2FDCA 3EG5A 4A2PA 2IEYA 1MO3A 1PUIA 1KAGA 1DO0A 3SBEA 1NBME 1XEXB 1ZIPA 1G19A 2QTVB 3VLFB 3RS5A 4AI6A 3I62A 4PANA 5M04A 3A58B 3UWKA 1KI6B 4K8OA 2EFDB 1Z0DA 1AJEA 4V0MA 2VSOA 4UJ5A 2GVDC 1M7BA 4PC2A 2A7QA 1QZMA 4BLQA 1FTNA 1PUJA 2J7PA 2VHQA 5KUTA 2QE7A 1VCIA 4HLQB 2FV8A 4LJ8A 1XEWX 3ASZA 3GP8A 3UK6A 3LBIA 3GLFA 2FU5C 2ZRAA 3R7WA 2OZEA 1D9XA 4HAUA 2G9NA 1XMVA 2GF9A 3FHCB 3U3MA 3WP1B 2C78A 4PC3A 2XAUA 2XNDD 1E9EA 2PJRA 3PUWA 3HWSA 3K0FA 4ACBA 2B21A 3SJCA 1DAGA 4JL8A 2IHYA 4EPRA 2GCNA 2BJVA 2FWRA 4LYAA 5H70A 4LHZA 2NO6A 4FCWA 3TQCA 4D82A 3L82B 4Q9HA 1P9WA 1SVKA 3SE0A 2Z0MA 4UNSA 1Z83A 2DWQA 3T12A 3ZQ6A 1VHLA 4FWGA 4V0NA 3RNLA 1T8UA 3WYAA 4B71A 4Q9KA 1XBTA 2GXUA 1JPJA 1G7TA 3DHWC 1KSFX 1YR7A 1UPTA 1E2NA 4RZ2A 1WP9A 1Z2AA 1RJ9B 2WPDA 1E2GA 4ITRC 5FBQB 3ZLJA 2O0HA 3C15C 1QVRA 1S1MA 1XCGB 2IF2A 2VHCA 2XTMA 1LF5A 4IDNA 2X2FA 4KVAA 5D3QA 3U7EB 4B3BA 4Q66C 1B23P 4D4JA 4XSGA 3FE2A 3GLIE 3PG5A 1N25A 2JJ8A 2J3EA 2JDIA 4H1UA 4MRNA 4HUQB 4TYQA 1KI4A 5JHGB 3CONA 4FINA 1LNZA 4DLWA 1HEIA 2W00A 3ZQJA 2HUPA 4I99A 2AWNA 3P1JA 1IAQA 1W7AA 1EK0A 1FQKA 3QKSB 5TY0A 1C1KA 1JBKA 1X1SA 3QE0A 1N6NA 1DOAA 3KJEA 4QGGA 2WTUA 3EAQA 1YZTA 4IDOA 2J87A 2P6NA 1II9A 1W0KD 2D06A 4QGHA 1XTIA 4M1MA 1KTVA 3CX7A 1KY2A 2QI9C 2V9PA 4FW9A 1TUIA 3D3QA 4YMUA 3H86A 2QA5A 2ANBA 4BASA 4MRPA 2ZETA 1TAGA 4JKIA 2RHMA 3IUYA 4WZ6A 3EPKA 1W44A 2AD5A 3AP2A 3HDTA 1IN6A 1SXJC 1DAKA 3CH4B 2NTYC 1FQJA 2CHVA 5AUQA 2CK3A 4EQ6B 3KB2A 1KZGB 1KI9A 4BLTA 1GP2A 2NO0A 1M6NA 1W4RA 5TV2A 3D6TB 4UXJA 3UMSA 2X2EA 3CM0A 3M4YA 4LHYA 1W4CA 2XZPA 1XEXA 2REBA 1HT1E 2FA9A 2FEMA 3QBTA 2XZLA 1KI6A 4RZ3A 2XB4A 1OH8A 1E99A 3BB4A 4URVR 4XVRA 2ZRLA 1IJFA 4G1UC 1HE1C 3N2EA 1OFIA 4JIMA 1EG7A 4MYUA 2QSYA 4B43A 3FMPB 3ADCA 4WW0A 1XCPA 1ZAKA 4V02A 2XSZD 4JLJA 4KYIB 3W3AA 2ORIA 2V7QD 3C14C 3SBDA 1VCMA 4H1VA 1KDTA 3ZIAD 2D7CA 4NDZA 4E07A 4WZBE 1HE8B 4RD3A 2Q3FA 1KI8A 4HLDA 4TMZA 3O8BA 3OIVA 1ZP6A 4QM7A 4XD7A 1R5NA 3B7GA 3I61A 4NYMQ 1W36D 4D0NA 4M4SA 3X1XA 4GOKA 1JR3D 5EQTA 1KMQA 1US8B 4QBHA 3NDBB 2W6ID 2AN9A 1ZMXA 1W48A 1NN1A 4XJXA 5FPSA 1FMJA 3IQXA 3LBNA 3JVUA 3PXGA 2D2EA 2H1LA 2WWIA 1JEEA 4IXNA 4LV6A 3W90A 3CX8A 2EVWX 1R0YA 1RJ9A 2FE4A 1NMYA 4Q47A 2CVHA 4BPBA 1YKSA 4CF7A 1YZNA 2WJYA 4BFVA 5KNDA 4OQNA 4W9MC 3GPLA 4CEJB 3EIHA 2VIIA 1OFTA 1OLOA 4RFSB 1WQ1R 2Q21A 4TL9A 4TTPA 1E0JA 1R8SA 3WRYC 2IYWA 4KLZA 2IS6A 4MQBA 4WA7A 2GVZC 4TL6A 3OAAA 4URXR 3KDSE 1X8JA 4RZUA 4HUQA 3B2EA 1RW4A 3T1TA 1C4OA 4OHVA 3T06B 4FWTA 3SEAA 1SKQA 2ZYWX 4ZDWA 1JB1A 1OIVA 3K0AA 3CIOA 3SI7A 5TDHA 4DUGD 3VMFA 4QL3A 3GLIB 1UAAA 1KK1A 2BCGY 2W6JA 4G5GA 4RJLA 3QKSA 5DYGA 3QSYA 2OCBA 5IT5A 3CWQA 4Q9IA 1E32A 4KODA 1TTTA 4MYCA 4TZ0A 3SYNA 5SZHB 3PEUA 2WM9B 4JSYA 3AF3A 1E4VA 3VHLB 5DO9A 5C1BA 2BEJA 4YMSA 1E2KA 1Z0FA 2DFLA 1G6OA 1RPZA 2ZSDA 4B3DA 4G5QA 3TSWA 2KI5A 2YOHA 3GJXC 1YZKA 3SHFA 3B9PA 1XPUA 2I1VB 1G64A 1L7VC 1ZM2A 4G3XA 2GXQA 4LBWA 4FIDA 1X8LA 1W2GA 2QP3A 3PUVA 5G3YA 4JVLA 4GOJA 1BOFA 3ZH9B 4Q4JB 5EP3A 3AP1A 4EQ6A 3SFVA 1UM8A 1G8PA 1WBBA 3IPXA 3R8FA 3GLGA 2VPPA 3TMKA 5EXPA 2C98A 3O8RA 2A9KA 3GEHA 3LBHA 4LI0A 3RSOA 2GZHA 1OXTA 4M53A 2BKUA 5CM9C 3RABA 5LBIA 3KQHA 4HB0A 1CJUC 4DIDA 4B35A 4LV8B 2BBTA 5FTLA 4YC7A 2FMXA 4MUAA 2XEXA 1XTQA 3K70C 4EUNA 1P7CA 2ZM5A 4Q02A 1X86B 2QNRA 2RKOA 1S2MA 1S4QA 4IDPA 1SGWA 1CRQA 3Q5EA 4V0LA 2OO7A 1GFIA 2VEDA 5J4LA 2AX4A 4JVNA 2ONKA 1K5DA 1T0HB 3FYHA 1E1RD 1G7RA 2IYUA 2MSCB 1V43A 2ZJ8A 2XB2A 2Q9CA 3A4NA 2ZE5A 2VF8A 3NVAA 1NVMA 1G21E 1VYUA 2YWEA 3AF0A 4DT1B 1WMSA 2CCKA 2D4HA 3DMNA 3OEHA 3AVQA 2R6DA 2OXRA 1US8A 1RFLA 4B6EA 2OM2A 2O52A 1R4AA 1H8HA 2IYRA 4PSKA 2OAP1 4JKYA 5F9HA 1OXSC 1ZM7A 5KPJA 1I2MA 1VIAA 5DSZA 4XVUA 4MRSA 2ZSEA 3NXSA 3KTAB 4ERNA 3REFA 3W3ZB 5FTJA 4CEJA 3SS8A 3RWMB 3BD9A 2KB0A 3LDAA 3CRQA 4RFSA 1BYUA 2FOLA 3ZJYA 1KK3A 1JEDA 3QJYA 3LH5A 5JWOA 2V54A 1TQDA 1HY3A 1VG1A 3AGPA 2LKCA 3KW6A 1Q57A 3TBKA 1J8YF 1A7JA 3U7HB 1XTSA 1OIXA 2IYSA 4B75A 5JEEA 2HT1A 1CR1A 4D80A 4KCGA 5JJLA 3S1AB 2YJTD 1ONBA 1ZNXA 5P21A 4DRZA 2ZRGA 1NVVR 4M1SA 3MSXA 4FMCB 4EPXA 1J70A 1KK0A 4L9SA 1JR6A 2NG1A 4PO9A 1NJGA 1P2TA 2HLDA 3ZGXA 4Q48A 4E03A 1RZ3A 1S96A 2LCFA 2ZI9A 3W5JA 4M2LA 4OHWA 1H8ED 3WMEA 2AKAB 3RC8A 4FN5A 2LWIA 1U8AA 3B78A 1KK2A 4HZUB 2YWHA 1N0VC 5JRJA 1KYIA 5LB4A 2O8BB 1Q1ZA 4C0SA 2QW6A 3LAWA 4AYTA 3KKQA 3AKEA 4G5OA 3WBJA 3NBZC 1OB2A 3ONWA 3VQTA 4P0TA 3KZ1E 3LW8A 1AZSC 5HTKA 2O8EB 3CNNA 5KDLA 1P9NA 1NLYA 5DI3B 3AKYA 2FX3A 1E69A 2ZYTX 1HURA 2JJ2A 2ZSBA 2JJ1A 4U7DA 3T5GA 5G41A 3E1SA 1U8YA 1OT3A 4IDHA 1KZ7B 5FOWA 3BWDD 3ECCA 4HDCA 1NG1A 2RGDA 2FN4A 3EPHA 1CJVC 1MR3F 5J47A 4IOKA 3CF6R 3GJ4A 3WP0A 3I8XA 4OQXA 5BWMA 4X8LA 5DLQC 1AZTA 2ECKA 3TSOA 2ZYVX 2ORWA 1F2UB 2UVQA 5SZIA 4HATA 2VL7A 1W1WA 2KBEA 5KU1A 1KNXA 3L8ZA 1MKYA 4XWKA 3F3YA 5G53C 2IL1A 4GP6A 1EWQA 5BW8A 1JQJC 3LRPA 3B1XA 4Q9JA 4IFBA 3OEED 4PO8A 3O47A 1KDOA 2C96A 2WMOB 4N1AA 4Q1BA 4A9AA 4L16A 4JLVA 4KSBA 4ASUD 5FBVB 4PAMA 1P2UA 2QT1A 3I4LA 3NKVA 3QY0A 3CO5A 2OFOA 2H8KA 2IT1A 1ZW6A 1RRGA 3MWJA 2VSFA 2WHXA 4H9GA 1IM2A 1OJLA 1B0UA 2VA8A 4B44A 5L8VA 2CE2X 5GADl 2KJQA 2WJHA 4EDHA 2ODEA 4LGMA 2AWOA 4PAQA 2VHUA 4HZIA 5FOSA 2W0MA 2ATXA 3WXMA 2ZS7A 4YQFA 2C03A 2RGAA 4NCHA 1II8A 2CCJA 1SHKA 2H5EA 1H65A 3ETLA 5DN6A 1E6CA 3KTAA 1FP7A 1ZNZA 4U02A 2WKRA 4KFSA 2KE5A 3QPVA 4TWZA 2VP5A 1LS1A 1M74A 2BOVA 4TLAA 4UNPA 1EGAA 1SXJA 1QG2A 3RWOA 4LZZA 3EZFA 1QHNA 2P0EA 5FPKA 4LX0A 2GEVA 3PR1A 3CR8A 2X77A 1LTQA 1AN0A 2XJ4A 4LC0A 4CEHA 4D2IA 1GUAA 4JL6A 1G3IA 2IHBA 3A4LA 1J99A 5DH9A 2FFBA 1CF4A 5JMTA 4M22A 3NBYC 2ZS8A 3O8DA 4B74A 5K8TA 2QAGB 3UIEA 1DG1G 5KDOA 4WVFA 2V6JA 1MRNA 1P9RA 1PLKA 5FOTA 4TTQA 2GK7A 4C9BA 4DLSA 1NF3A 2DY1A 2E9SA 3ZS9A 4CZ2A 1MO6A 4LPKA 3CRRA 3SR0A 1E1QA 1OYWA 1G8FA 3MAAC 3V4RA 5TMPA 3K0SA 2V3CC 4F93B 3TGPA 2O8BA 1N6IA 5FUXA 1F3OA 1I4DD 5CJPA 3W6OA 2W83A 4UNQA 4TQUS 4AG6A 2O8EA 4HB3A 3DKVA 4DSNA 2WJVA 1G20E 3F0TA 1NMXA 2WOJA 3FPAA 3I1FA 5HKKD 3X1ZA 4BRUA 2JLRA 2WIAA 3MG9A 2WKQA 4PQYA 1NN3A 2GJAA 2QPTA 5FUWA 2OEPA 3SDZA 4ZCMA 1ZCBA 3KKOA 3AF2A 4MA4A 2YOFA 3PUYA 1E2QA 4QGFA 2RGGA 3DMDA 4PHHA 2QEQA 5H1YA 2ZIAA 3TQFA 1DS6A 1WCV1 2FSGA 1Z2CA 5L3VA 1QZXA 2QMOA 3OE7A 4A8JB 2WIBA 3AP3A 4QGAA 4II7A 4PHTA 3CNLA 3KJIA 3AM1A 2BMDA 4UNNA 4Q7LA 5CJ2A 1Y63A 4X8MA 1ZM4A 2FSFA 5JLJA 3ZVMA 2GCOA 3W8NA 5J4HA 2ZI3A 1ZBDA 4DEYA 2OLKA 4WXRA 1JQLB 4EPVA 3ICQB 1G7SA 2QP9X 1UBEA 4AC9A 3RRNA 2E1RA 3UWOA 1CRPA 4QOSA 4HAYA 3SFZA 3B9QA 3LLUA 1OXUA 4TLCA 2DHRA 3EW9A 4RFVA 2IX3A 3W6NA 3EZ6A 3EZ9A 5EE9A 3GEEA 4DLYA 2O0KA 4DB2A 4B32A 4M9QA 1TL7C 5FBRB 1XMIA 4GP7A 4LJYA 4TSFD 521PA 1R5OA 1ZRHA 4URWR 4WBSA 1COWA 1X3SA 4CT4B 4EKDA 5KO2A 2OCYC 2EFHB 4IFEA 1ESMA 3FGNA 4N0DA 2WWXA 4W5JA 1VDZA 3ND9A 1J2JA 4EPYA 2MSDB 3ZVRA 2CVFA 1OHHD 3FHOA 5E3HA 2O8DB 4UKDA 1OKKD 1XEFA 2BM1A 4M21A 4LC1A 1L8QA 1GNRA 2VYFA 4YDHB 5H68A 4RKEA 4ON9A 1T3SA 1DARA 2RGEA 4NCKA 1XJCA 3EC2A 1GRQA 5BN4A 3LFUA 4LBVA 3T5DA 1NVXQ 1ODFA 1Z63A 5GJCA 1U0JA 4CGZA 1A2BA 4LJ7A 1XMJA 4JVSB 2WSSD 1RKBA 1Z6TA 2WKPA 3Q9LA 4DSOA 1WB9A 3AB3A 3VR3A 1Q44A 1CJKC 2VRWA 2IA5A 1ZUNB 2C5LA 2Q6TA 2XNSA 4G5SA 3TUJC 1OXVA 2DFNA 2IF0A 4C2UA 3QKRB 1G8YA 2ZE6A 4ZDIA 5EJEA 5DYIA 2F3RA 2FGJA 1ZC4A 5FPTA 1CULC 2KRKA 4JYBA 2ZITA 2CLSA 2HCBA 2CL6X 4JT2A 1VKJA 2WOOA 4EJSB 4QBGB 5CIWA 2NO7A 4YMWA 3EWSA 4HYYA 1D2NA 1IHUA 2PX3A 2IWHA 3THWB 2R6AA 1T6NA 4DZZA 1AM4D 1ZUIA 2PZEA 4KXFB 3LLMA 5DIFA 1E2MA 4CW7A 2VO1A 3IQWA 2HYDA 2BWJA 2JCSA 3ZS8A 2W2TA 3ADDA 4Q18A 1IXSB 3UMFA 1P4SA 2JATA 2QSZA 3P20A 3HU1A 1BMFD 3L0OA 2QP4A 4JVMA 3TNFA 3EIEA 5F3WB 3HP1A 4A0RA 2F9LA 1J90A 2QRNA 4XOIA 1KMHB 1FNNA 3WHKA 3TUIC 2FEOA 3AUYA 3PUXA 5K8LA 1QBKC 5ANRB 3T15A 5AWFC 2BDTA 1YRAA 4A8JA 2AXNA 3U3OA 1NLZA 1PV4A 4FWDA 1DTSA 2N46A 2PEYA 2J0VA 2EWWA 3NC0C 3VNVA 5B30A 4KI0A 4A0GA 4OK6A 1G7CA 2AD1A 4Q7JB 1Z28A 4NE2A 3NDPA 4MKFA 1MOZA 5LPNA 2MMGA 3AKDA 4Q21A 1KJYA 4DKXA 2CNWD 2H18A 2VTKA 3TW8B 3HU2A 1TEVA 2P65A 2PMDA 4DDWA 1XXHE 2DB3A 3LO5A 4JS0A 2JLZA 1CIPA 4JT4A 5JSZA 1E9SA 1Q1QA 2CL0X 2BBOA 1IN4A 2JIZD 2EFCB 5CDFE 4OYHA 5GVRA 3GLHE 1DEKA 2OFXA 1E9RA 1NSFA 2NOAA 4M1OA 2RGNC 3NWJA 2BHRA 4ZO4A 4EAQA 1ZD8A 2QBYA 3RHFA 3EIQA 2ZUDA 1SZPA 1W49A 5A4JA 4DC9A 4RSGA 4A2WA 1R0XA 2F1RA 2O8DA 4NKRA 3ZD6A 1TU3A 1L2TA 1ZIOA 3QF7A 3WY9A 2PCJA 4KBFA 1DAHA 5AJZA 1AS0A 3T34A 4FD2A 4XTRA 4QBIA 4RCZA 2VP6A 4ZCLA 4A6XA 1DPFA 3BK7A 2ZXUA 1IONA 1I2DA 1ZNWA 4HSEA 4IDQA 3NEYA 1AQYA 2J7PD 3MLEA 4O0MA 3TJZA 2QE7D 1GNQA 3A36A 1E96A 1KHTA 1WE2A 2GK6A 3NG1A 3QEOA 1AKYA 5SZJA 4C30A 3WMFA 4BE7B 4C2TA 5F9FA 2EFGA 4IHQA 1M8PA 5BYKA 4BLPA 2CLCX 2V7QA 3DZ8A 3W5IA 3OFNA 4JLAA 2YKGA 4AKEA 4Q5IA 2FPLA 5CB8A 1MO5A 3IEVA 1Q1BA 4D6PA 4FCVA 4O3MA 5UKDA 2D7DA 4MGKR 2FPMA 3K53A 1W0JA 3QKRA 1LF0A 3M1IA 1Y3AA 3VKGA 1UDXA 1DAFA 2NIPA 4PZZA 1G8HA 1XTKA 4L9WA 1KNQA 2GBLA 1U0LA 4FWHA 5KSZA 2DBYA 1T9HA 3QXJA 1RYFA 1AA9A 4Q4LA 4YXWA 3V00A 3VU9B 4UXHA 4TL8A 1E2IA 3P26A 1KAOA 4HAVA 4MUBA 3VR1A 5KPDA 2WPDD 1X37A 2CL7X 3IKJA 4LHWA 1E0AA 2QTHA 1XMSA 4C0BA 1U99A 2YC4C 4A6PA 1NRJB 4AWXA 1VCOA 1N6LA 1Z0JA 1E2PA 3P4YA 4TL7A 1FMLA 1L4UA 2GEUA 3FMIA 1Q12A 4B48A 2CBZA 5EXSA 1F2TB 2GNOA 1SVWA 1VHTA 1U81A 2ZJBA 4JLBA 4B47A 4OJKA 3I3SR 3CLVA 3CR7A 3CNOA 1E9FA 3A1TA 2V6ZM 2Z43A 1N0WA 1I4TD 1GSIA 1KDPA 2C95A 4M9XA 4ZI2A 5CITA 1Z22A 3THOA 1GM5A 1BO6A 1XWIA 3GMTA 4ZKEA 3MCAA 4GOXA 1VMAA 2EW1A 5HCNA 3MJRA 4B73A 2G88A 1GAJA 2FZ4A 3BH6A 4RD6A 1DG3A 4C0JA 1FPMA 4W5WA 4NYMR 3VNUA 2FSIA 3FTQA 4JLPA 1E2FA 4L5BA 4RCYA 3HPRA 4TYWA 3R20A 5ELXA 1OH6A 1TX4B 1N0UA 3L0IB 5BQ5A 3BFXA 4A82A 2KSQA 2PMKA 2RGCA 1ZU5A 4MRRA 2GAAA 3U7GA 1DAEA 2REOA 2ZI6A 2IEZA 3B13B 3GFPA 3QPUA 4YLGA 1TU4A 4YMTA 3ZVLA 2CK3D 1Z6YA 4PQRA 5E4FA 4KBGA 5AJYA 2V1UA 1XXHB 3QNUA 1ZJ6A 2F43B 2QQ0A 2OCAA 3T1QA 5A5GA 2DCUA 4TYNA 2QT0A 3BERA 4A4DA 4B34A 5JEDA 2CDNA 1XEWY 1BH2A 3C5CA 4OI4A 3MWLA 5EP1A 3CZPA 4QNMA 3GLHB 3KL4A 2XITA 4LBYA 3AEZA 2J0QA 3VR2A 3Q5DA 2P6RA 2YNMA 1OFUX 4Q7MB 1EFCA 1KO5A 3WYGA 4IXMA 1CJTC 4WIAA 1IN8A 5JJIA 1FNMA 4FMBB 4Q03A 1RRFA 1ZM3A 3G5UA 3OIWA 4GI7A 3UMRA 2WSMA 1OH5A 2H57A 1LFDB 3N5CA 3EZ2A 2QU8A 2RHDA 4TN1A 4PSVA 1AKEA 1ZU4A 1GKIA 3BIFA 3GJ7A 2HYIC 3BGEA 3SJZA 4V0OA 4MKGA 3CW2A 1E9BA 4TMXA 3THXB 4IEEA 3CPJB 3REGA 5EZ6B 3VR4A 2G77B 4XD7D 3H2YA 3THYB 1KSGA 2QY9A 2W2VA 5G40A 5IHPA 4Z1MA 3BB3A 4HDOB 5AJXA 3Q7PA 5EZ5A 4KV9A 1GKYA 2BVNA 2ZRBA 3A1WA 2JGNA 3Q8XB 3CTDA 2GF0A 2G0NA 2C9CA 1P61B 2KBFA 4PSAA 3BORA 2GKSA 3WMGA 3PEWA 1FUKA 4PPFA 1KSJA 3CRVA 1QHHB 3FHTA 2J5XA 1NG9A 1P62B 1VYTA 3RVBA 4JJKA 1MABB 2UKDA 4ESHA 3RYTC 1Z5ZA 2QAGC 3IIMA 1N5IA 2FFQA 2IYTA 3ZYCA 2N42A 2ZANA 1XJQA 1UADA 1EX7A 2YWGA 3TW4A 2ZJ5A 4Q19A 1NBMA 4QJ5A 3FKSA 2CLDX 3OAAD 5D3MB 5FBWB 2PT7A 3QPWA 4YONB 3CRMA 3B1WA 4BGDA 1F2TA 1YRBA 5CK5A 2GILA 1OE0A 1GKUB 4DDTA 2HJVA 2VH5R 2W6JD 1Z6XA 4BFTA 1G3RA 1TF5A 1EFUA 2F1JA 1IY2A 2OBNA 3U3JA 4I1OA 4HLUA 4ZIRB 4TYPA 4DLVA 4KSCA 2OXCA 1N6RA 5GVSA 4CRWB 1E2HA 1HYQA 1U0HC 2QM8A 3TR5A
chains in the Genus database with same CATH superfamily
4FVMA 1U8CB 4DWJA 1A82A 1YVUA 3STUA 2J85A 5JXHA 3DO8A 1DWOA 3TI7A 2C00A 2PBRA 3MSCA 2GTIA 2HJSA 1V8PA 5BPVA 2E85A 4NU0A 2MU1A 1KZ4A 2HPZA 4DNOA 4PGMA 2EKKA 3K6KA 1JX6A 2DKFA 3BE8A 5ALIA 3A1VA 3MRTA 2G83A 2ATVA 2B6HA 1DI0A 4IUCS 3FCYA 4UHKA 1LTKA 1XD2B 4A1OA 4IHAA 1DQNA 5FJIA 4RK0A 4Y3UA 3SR4A 3NPAA 5EXXA 3ZGNA 4FBGA 1YXMA 5EJFA 3HBMA 3I5AA 1I13A 1JYSA 3M6IA 1TLFA 1ITZA 3RHZA 5BUQA 3TKYA 1PRYA 3IIJA 1LLCA 4L72A 3TSYA 5C5EA 1SCUB 2YHIA 2WUVA 1BS1A 2A14A 2FKNA 3DH0A 4JEHA 3FHLA 2IYZA 1FVXA 2H1HA 3N70A 2EAUA 1GPAA 2A1TS 5IAGA 4PVCA 4HRYA 4P4UA 3W5DA 3VOBA 1RIFA 2CZQA 3Q8GA 4DT1A 1U6IA 1SXIA 1Z75A 3B3AA 4GVXA 5CDYA 4MKIA 1D4OA 3ADPA 5IREB 1OIPA 1ORYB 2XY4A 3AEQB 3IRUA 3OMWA 4L8FA 5ICGA 2AEFA 2JKZA 1YR3A 4DG5A 3G3EA 2QX6A 4GLJA 1VZ3A 3VPSA 4YWJA 2ODNA 5BN3B 1CUBA 1QYXA 5DX1A 5A3VA 3R5FA 1P4AA 3DE3X 2OCPA 3ZBQA 4PY2A 4URYR 4M3NA 5LMUB 3HUFA 1CUSA 2JD1A 3F97A 4XX0A 3B60A 3K4HA 1V8BA 4MQEA 1HV8A 3VRHA 3F96A 2CCGA 5CIYA 4D8YA 2AE2A 2GASA 2WP8J 2CJWB 2VQEB 2CMFA 3CW9A 2GJSA 4G0QA 3UBMA 5IVDA 4DIOA 4RMGA 4ZQHA 2FMTA 1TCVA 2VJNA 1C0IA 1FE8A 3WFJA 4RF1A 5T64A 1I4LD 3R41A 3R8CA 2PIDA 1H1LB 3CUEF 2JWSA 1TO1E 2B7CA 3TZBA 3KQMA 3SX0A 1YNSA 4IGEA 5E0KB 2VSXA 4RLHA 2QMQA 4QT0A 4Y1RA 1VA4A 3ML1A 4MWDA 2XQVA 4XVCA 2PX4A 1JEQB 3TTTA 3E2IA 4CTJA 1Y3DE 1XNQM 4D7AA 1QIEA 3LPDA 4C76A 4FZVA 1CUKA 1LDNA 1Y1TA 5ABPA 1PEKE 1ZGJA 4YUXA 2WJPA 4U7HA 1QDUA 4C0AC 4IUYA 4NOLA 3A3NA 3RJMA 4NFSA 2TS1A 2C29D 3N7TA 3RLFA 4ITUA 2B8WA 4Q1CA 3GJ6A 2ADMA 3OJWA 4O6VA 2GEDA 4TROA 4X66B 4QJBA 1VKHA 4TV8B 3FWZA 3TIXB 5FWAA 1OB5A 4E7PA 1HDCA 1UMCB 4A0HA 1WO8A 5KQDA 2LE0A 2BGLA 2D74A 2HMVA 2IDKA 4G0YA 1D1SA 3D3KA 4IDBA 1N92A 3K9NA 2WG2A 1I6WA 5FD8A 4TLMB 1QFZA 1C3JA 1OZ0A 4ALMA 2CHUA 3I9KA 3EGOA 5K6AA 2H4WA 4GGMX 3RG8A 1AQUA 1DOHA 3LX5A 4H3KB 3GFVA 2WNIA 1DVRA 1PV2A 4MRAA 5JJKA 4HNGA 4FGUA 2UZ1B 3NBFA 2LKDA 1S8AA 3K20A 4XEUA 5U9CA 3IO5A 2QUKA 4D4MA 1MEOA 1KJWA 4U3JB 4BE4A 1USWA 4GITA 3TE6A 5AVVA 4MR9B 4J90A 2XQJA 1SBIA 1VPWA 2CY0A 3WDSA 5AP9A 1ABEA 2J9FB 3T4XA 5ICMA 1V3TA 5F3WA 1DKLA 3ESQA 2NQ2C 1BG6A 5J5VA 2WVAA 1KPIA 4ZYZA 1L6RA 4IDAA 4NY1A 2UUBB 1FUEA 1UWLA 3A9WA 3IPAA 1VHDA 3AFNA 3TLEA 4NBLA 4F9TA 4QEZA 3FDJA 3L40A 1QKIA 2XVZA 3HHEA 1XTVA 4Q6BA 1JJVA 1C0LA 2RC5A 1C30A 1H2YA 5FI1B 1MRSA 1QANA 1MC8A 3RANA 3WI7A 4PGGA 2PO5A 3H4VA 4N5HX 2Q1UA 4BFSA 4MROA 5JSHA 3J7AC 3RFWA 3ORRA 4HVCA 2D2FA 2VHTA 4KKXB 4D74A 3P27A 1KTIA 4RW0A 1XX6A 2HQBA 2P5TB 1XQYA 2WIFA 3C2QA 3GEIA 2ZIGA 1PD1A 2XMZA 1O95C 4E5YA 2ZJFA 1CZOA 1Y5IA 3CKYA 3UFXA 2Q3LA 2P90A 4U5XA 3EF3A 2GKOA 4ZV4A 1QG0A 4ZAXA 3OY2A 1LNSA 4RF4A 5B58C 4B3MM 3G9QA 2EZTA 4BMYA 4GMFA 2VDKB 4EA8A 3CLTC 1K3XA 2P5SA 1MTOA 5TJ9A 1O8CA 2FPWA 1Z07A 4NABA 4WASA 2XZUA 1I2CA 1FNSA 5K0TA 2AFHB 1UOPA 2H2AA 1B4DA 4R40A 2XDAA 1ONSA 5A2QA 5TPWA 5ERXA 3FWHA 1QU3A 1T4CB 1ZMVA 1JLRA 1HYGA 3AFGA 3NAGA 3MPUA 5DLEA 2FG5A 4LY3A 1DB3A 1F1JA 3GROA 4LJ6A 3SNHA 4OLFA 2O6HA 4ZCIA 4XIGS 4NX2A 2W6NA 5DNCA 1HQYE 5KVSA 2EKQA 1Y8RB 4OX9M 2FUKA 4C4YA 3UXYA 4CLXA 4ZAFA 3E0XA 3L2OB 2QX7A 3FWYA 8ADHA 5CVCA 1Z9BA 3HCDA 3WFZA 3EWIA 3DNFA 1AKVA 2IEBA 2M2IA 3PGMA 4WRRA 1FLDA 3F6CA 5LXTF 4CL3A 3RHTA 4CMJA 4QWWA 4NPCA 4LFCM 1ECJA 4Q3KA 1N33B 2DWPA 1U0BB 2XTZA 4V38A 5HPYB 2HBRA 1DP4A 4UEQA 1Z4MA 4FGJA 1DX9A 4Z8YA 1NI5A 3NVDA 5DGXA 1HX7A 3UGJA 1E63A 4AJJA 3PDIA 4IOMA 2XZFA 4F4HA 1MUUA 2J9RA 3R7BA 3FFAA 5EERA 3KJHA 3SZRA 1WKVA 2JIQA 5GM1A 1YB6A 5BORA 2QIPA 2ZSUA 3OY7A 4EG5A 2Q6LA 4XSHA 4C4PA 3U4QB 3M4JA 1SU4A 3ZHBA 2OQ2A 5EP4A 4LIPD 4NVRA 1N32B 2GQFA 2BAGA 3ZDQA 1JHAA 1K7CA 4FZ3A 2F2TA 3ZWOA 5F4BA 4X6XA 3OD1A 2XT6A 3PD1A 1L4FA 3GFTA 1H6DA 4RZIA 1A5TA 1CUYA 2OO5C 1M6HA 3MT0A 2BISA 5BSEA 2VR1A 4JZKA 4Q7QA 4ZCRA 3M6VA 5GOTA 5BR7A 5TT0A 2V7PA 1N6HA 1P9OA 2IXGA 2BRUA 2FPSA 2CV2A 3BL6A 4YRJA 2YVQA 4ZPXA 1LBTA 2J08A 2WSSA 4C43A 1R9MA 2IOYA 2YIMA 1EJ6A 3SC2A 1FIUA 4IF4A 4DY6A 4MI3A 1Q50A 1KFVA 4LC9A 1X6VA 3JD3A 2A9JA 4FXOA 2L19A 4CVNA 4LMPA 4XFKA 1NXWA 4MGHA 2J0EA 4ODIA 1G8KA 3T7DA 2DFPA 2VPQA 1C50A 2JAWA 2BF4A 5KCMA 2C7VA 2WRZA 1T34A 2ZVPX 3F8WA 1XSEA 1S5PA 5DHFA 3N76A 3UN1A 2BJWA 2XRYA 2HX1A 3K9LA 3ZHYA 3A25A 2ZSHA 4OL0A 3IMGA 3HKCA 4GMDA 1PQ4A 3P0IA 1RRCA 3QVGA 3CTMA 4M9SA 2H92A 3RARA 3OZXA 1VPTA 1PZGA 1NUUA 1BVRA 1V34A 3DL4A 5TQ2B 3LVBA 1MO3A 5AK5A 1I7DA 5CW1A 5LJLA 4PANA 2VSOA 3GG2A 3DEJA 4Y2GA 1I2BA 2P7HA 1XPJA 4BNDA 4LJ8A 4A03A 2BFNA 2Q5QA 2I7NA 5LOVA 4C4XA 3ZCBB 2G9NA 1W88A 4J4TA 3D8SA 3ZCVA 1YTLA 2B21A 4KQ2A 2CZGA 2GCNA 3GJZA 3JD0A 4HQKA 4YR9A 4XGNA 4Q9HA 2FHSA 3FA2A 4UNSA 3TOZA 3IX7A 5CG1A 1TLTA 4RTQA 2WSYB 3WYAA 1WGNA 4X93A 3PRKE 1UXHA 1YR7A 3TL6A 1Z2AA 3OO1A 5FBQB 2Q5FA 2P1RA 4RQUA 2QTGA 5KKCA 1QP0A 2ATEA 1FYFA 2YV4A 1LNZA 3ZJVA 2X15A 3SFTA 4BV2A 1C1KA 2RCYA 4K9NA 1XLUA 1TKCA 3UW3A 4MCAA 1KY2A 4CGYA 2Z9DA 2OY0A 5IM4F 3CT6A 3CW8X 3VH2A 4YQEA 1XVAA 3ERCA 5BVHA 1EFPB 2QQ5A 4P93A 3ROFA 2ZATA 4TKVB 5K01A 4WLVA 1OX4A 2QSYA 1MZVA 4REQA 4HADA 3SBDA 3DE5X 4NEHB 3JWIA 3LDGA 1H9CA 2CDAA 4PLHA 3OIVA 3FPLA 1VLVA 3EDMA 4NSOB 3NDBB 3GEDA 2R46A 1U7DA 5IBCA 2FE4A 1JWLA 2E0IA 5IC6A 3PCXA 2CDBA 2EZ8A 4HUQA 2C5GA 3T06B 7MDHA 4BCBA 3NDJA 1OIVA 3SI7A 3PFKA 4JQOA 2HPAA 1W75A 3IFSA 2IXDA 3IODA 1DTWB 2PMBA 3L4JA 3BZUA 3ISTA 1G6OA 2DPYA 1XPUA 4BPRA 2C5BA 3PNLA 2GXQA 2P62A 2JEYA 1AKMA 4OPMA 3O38A 2J48A 1G8PA 3GLGA 1YB5A 5ITVA 2X1MA 3TMKA 4G0XA 2C98A 4U7GA 2CLLB 4KJXA 1XQWA 2ZP1A 5LBIA 3LVWA 2Y9PB 3KQHA 4B35A 5CA0B 3S8YA 2IHUA 3BXHA 2AN1A 1XTQA 4PFJA 4JT9A 5IZCC 1P7CA 4M7PA 2QNRA 2VUSA 4ER0A 3P0HA 1YSYA 1LNQA 4MULA 2ZJ8A 3S1SA 3KG2A 5TRTA 1E59A 1YBAA 2HMSA 5LU8A 2VTDA 5E9QA 3TS1A 1OXSC 2QK4A 4JJIA 1I2MA 1LV8A 4XVUA 1NRXA 2QRHA 2HK7A 1M6VA 3SHTA 2O1WA 1C7RA 1I1OA 1OIXA 4KIFA 3WX0A 4DJEC 3PRJA 4CM6A 1XYGA 1TGVA 4FMCB 1FSSA 3VDUA 1FQWA 1FLAA 2IH4A 2VT6A 1VLJA 1Y80A 4F6LA 2GZRA 1OX6A 3QUTA 2DE0X 3BTOA 3O26A 2Z09A 4X1KB 3L6DA 3FFXA 4G4IA 1X0XA 2A9VA 3ROMA 2FN4A 3AYXB 3N5KA 2ZIXB 1Z39A 3QZUA 2PUVA 2GBCA 2Y1CA 4RACA 4Y0NA 2ORWA 4FGLA 3HFGA 1KNXA 3G9TA 4RHCA 1EX9A 4RY8A 1E9VA 4KH1A 3NBKA 2BEUB 3JU3A 3QY0A 1IMOA 5KREA 3L49A 3QJ5A 4WZBA 2Q6VA 2QRVB 3HLYA 2HSDA 2VA8A 4JI6B 2HK6A 4I4IA 5JPCA 4EHFA 1ZJ4A 2J3MA 1T9ZA 3OETA 1EGAA 2KNAA 5JCJD 1XDGA 1J1IA 1AVTA 3OJFA 1NF8A 4CEHA 3U1BA 3OA0A 4OHUA 1NBWB 3A9CA 1GQOA 4JASB 1V96A 4IYJA 1XZIA 4U63A 2E9SA 4CZ2A 4J6EA 3CRRA 1G8FA 2WF5A 2FW1A 1C9MA 1S7CA 5L53A 4N9WA 2W83A 2MT9A 4Z7JA 1BXGB 3KAKA 1QBGA 3EE6A 3IQIX 3WGKA 5HKKD 3X1ZA 5IHXA 3SDZA 1GZUA 4R1NA 1XMOB 2RGGA 4U6QA 3BT7A 4D4HA 4XWGA 4OQDA 3UJCA 1EE2A 3I1IA 3SSOA 5IEBA 3CNLA 2QVLA 1TIPA 2CUKA 3ZD9A 1OWOA 1JMVA 2FSFA 2BGWA 3LFTA 1X1BA 1E61A 2MSNA 1HXHA 4EPVA 4OVZB 4JROA 3EXHC 1OIZA 2GBGA 4WGFA 3EZ6A 1Y4SA 2O0KA 3ACBA 3NIDB 1TL7C 3AR4A 1UQUA 5FBRB 521PA 1KS2A 1VDZA 4ZOEA 2MSDB 5E3HA 4DGSA 3V8PA 2AE1A 2NT3A 1DQSA 1ML4A 3A31A 4P1ZA 3JV7A 3JPWA 5G0WA 1XZLA 2PQMA 5IJXA 3ZJYA 2C5LA 2Q6TA 3M3HA 3RU3A 4BVHA 1ULHA 5HBRA 1NE7A 5EPUA 4GYJA 2FGJA 2YS6A 4JYBA 1Q0QA 2CL6X 5LUBA 2E4YA 3LIIA 3PGLA 1CF2O 3VSCA 3GJRA 5F51A 4DLAA 1O0CA 3LLMA 5J2TA 1FFSA 2FSSA 3G5MA 1I4WA 1P4SA 4QASA 2VZEA 2HJ9A 1O6FA 3LVFO 3DC2A 3FBWA 3T15A 2R1VA 4QYMA 3U3OA 3UF0A 3MTJA 4RCVA 4E1BA 5LZ7A 4A0GA 1MOZA 3RTDA 1YE3A 4X7PA 3HU2A 1T5SA 3TSAA 4F2GA 1CIPA 3MMXA 3IJ5A 3TNJA 1A04A 4P7KA 1ADGA 3UFBA 3E46A 5D86A 2A1UA 4EUHA 3HUUA 1IZ7A 3Q15C 5KYXA 3ZGVA 5BV2P 3OZBA 4D9KA 1SHJA 1AKYA 5EHIA 2EFGA 1XLTC 2WT4A 4BLPA 4D99A 5B1YA 3DZ8A 2W6QA 3BG5A 3K2LA 4FCVA 2RKBA 3K53A 2C84A 2BP7B 2AZDA 3L7YA 2QUAA 5DMXA 5BSHA 1MCZA 3NUZA 1AA9A 4FSDA 1C81A 1NSYA 3MNFA 3PHHA 4YJGA 5ADUS 1ST3A 3JQ7A 2UZAA 1LRJA 3A2LA 4B31A 1QO0D 4RNCA 2PUCA 1UT8A 3T8YA 4UTPA 4LWQA 3Q9NA 4PG8A 3V2UA 3F3MA 4BNZA 2C95A 2VDRB 4GOXA 3F2VA 4AY6A 3KP1E 2LGJA 1XZDA 2W8BA 3M9XA 1N0UA 2XLBA 3QVOA 4A82A 1ZI6A 3H83A 2D1RA 4UHJA 1UODA 2Y1EA 3QNUA 1ZJ6A 1MHPA 4E21A 4QNMA 2OOSA 3VNSA 1DAPA 5H4GA 4RQAA 5LMNB 2QF7A 1EFCA 2JGRA 1CHNA 4DMFA 4WIAA 1O08A 1FDUA 4LXGA 4AO7A 3ZOZA 3TOCA 4PBSA 2OL4A 5G40A 3IIEA 2W2PA 1YJAA 2G0NA 1KSJA 3CRVA 3FOBA 3CZCA 4IHJB 1RMQA 4DA0A 4DV3M 1XU7A 4N03A 1T1JA 3OP1A 3CF6E 3OWHA 2H9YA 1EINA 1BWRA 2WK1A 4IGAA 2W22A 3TTYA 4U7PB 4U7JA 5GVSA 5KPZA 1LQUA 2R3SA 3V48A 1CUDA 2QYOA 4H15A 4WD3A 4C6TA 2ZE8A 1YFJA 2YY5A 1ZH4A 3H5AA 1U7OA 1QAMA 3CEPB 3SJBA 3W5BA 2ECFA 4ZEXA 4LXXA 3EDRA 3HJNA 2XOKA 2X0RA 1SQ5A 2EUCA 3T3PB 1ACMA 4M0PA 1EK1A 621PA 3H2HA 1FTSA 4ISCA 4ZV7A 1Q5PA 3GIDA 5EVJA 5KOJB 1G66A 1ORTA 2WSIA 2CHGA 1NF9A 3SSNA 4GH5A 5A6SB 4TZ6A 2DECA 4RULA 4MGYR 4D3FA 5DCWA 4CIDA 3NTRA 4YMVA 2QD1A 2AFVA 1RFGE 3DFIA 3ELYA 4GZ3A 1NMEA 2RGHA 2QG9A 4IDGA 3EMDA 2QRZA 4KC0A 3DCJA 2C2GA 2B8TA 2BCJQ 2I3AA 1LPSA 1TCCA 3N0WA 4L8GA 4JNKA 3LHIA 4WH0A 1R16A 4CKEB 5L4SA 2B92A 3FTCA 1Y6RA 1IATA 2BC9A 4H7PA 4NYJQ 1WXWA 3MBKA 1XRNA 5CCXA 1KA9H 4O63O 3IKVA 2JFWA 3JQFC 3LQRA 2A9OA 3MD0A 1YBHA 2Q3HA 1QDLB 1WLSA 2X76A 2RHLA 4F71A 5FWDA 1M54A 1NW8A 2WZDA 4NYIQ 3DBRA 4ZAZA 1NW7A 1U28A 5JW6A 1CC1S 1G8GA 1VLZA 1XA3A 1T0IA 2A5JA 1R1DA 1QIGA 4AYWA 1D0LA 3FPSA 1OF1A 1ATZA 4QYWA 3NPMA 3A6JA 4A16A 2WJZB 4MITA 3JQ9A 2UU9B 1Q7BA 2FF7A 2K47A 5IC5A 5DNYB 2PRIA 4M9RA 2NVUB 1VTKA 4MKHA 3KB1A 4M99A 4R31A 3WR5A 1BE6A 4C0KA 1OIWA 1FK8A 3E70C 4NI5A 1MHTA 4MI6A 4U2DA 1E1QD 4ZGGA 1NM5C 3SHGB 2NPIA 2E6UX 1SM4A 4Y6OA 4MUGA 4LNHA 1R0ZA 5ECWA 1I2AA 2VTEA 3WOHA 5KTPA 4BO6A 4QNNA 5DISB 3S7TA 4HQ6A 5IRCD 4JUBA 5B57C 1T5IA 2Z6UA 4C21A 2KW0A 4JD5A 4OI1A 1SH7A 2VDNB 2GPTA 2QAGA 4GRAA 3IA2A 3NRCA 1HDYA 3VH4A 2XNDA 1W2HA 5E3IA 1SQ0A 3FX2A 3CISA 4HNUA 3HMQA 3D8RA 4JLKA 2JFXA 2Q8QA 4Q3OA 4TLDA 2NGRA 3GJ0A 3CX4A 5JAOA 5BR1A 4JBYA 2PLRA 4YLGA 1L5GB 1GVNB 2F4NA 2MSEB 4Y6RA 5A5EA 1WXHA 1OU0A 3E7FA 3IBYA 9LDBA 4CV2A 1Y5NA 3NGMA 4B4KA 2L18A 4XPZA 1C41A 1H69A 2AS0A 3CT4A 3N2IA 4MQFB 1R5JA 4KE9A 3EBLA 2DBZA 3I2JA 3U3RA 4OHXA 2KHHA 4KDRA 2A9PA 1Z88A 4BZXA 4N39A 4L08A 4EKIA 1UKVY 1M34E 1STOA 1SIBE 4XH9B 1H3FA 3KXDA 4LFAB 3ZLTA 3L8EA 2IXFA 2A5LA 4LE2A 8MHTA 3QI7A 3ZHTA 1Q3HA 4JBWA 1EX1A 4MUHA 4RVCA 4E0BA 3DAOA 1TE2A 3A1FA 4AMGA 3DM5A 4HN2A 4EJSA 1U98A 3PLAE 2FFHA 2OORA 2J4CA 2G80A 3THWA 2EYUA 4ZI7A 2RHRA 3SHWA 1X7XA 3EFOA 4D3XA 1E5XA 1QGZA 1PVVA 2XQGA 2AL7A 4QWMA 4RMHA 1WDTA 5KYTA 1ISRA 4ER3A 3PP8A 5FTNA 2Z1NA 3HCBA 4MUFA 1IBLB 3JWPA 1G5PA 5IAOA 4CKBA 4P8RA 4RUKA 2ASVA 2VK4A 4IXWA 4UHEA 1ZVMA 3DOUA 2GFIA 3OBIA 3PDHA 4NBVA 1KYQA 2OSBA 3QYEA 4LCBA 1ZM9A 2GK3A 2WLTA 5A04A 4X45A 3IBGA 3PRYA 1ECPA 4CKCA 2ZUBA 4NQRA 3EASA 3W1VA 1PG5A 3WV5A 4EY4A 2ZYSA 3GAMA 3IBSA 3MTGA 1QAOA 3HJ8A 2KDLA 1QP4A 1QOZA 4UBIA 3RT7A 2R68A 1LSSA 5B64A 4IZ6A 5AW5A 2GZAA 5FUYA 5K0EA 5GMOA 4KO8A 5G4KB 2G06A 3DZGA 1OH7A 2YFQA 3AJRA 3I6MA 2R1TB 1GFZA 3KC2A 1F0PA 2DMRA 3L4BA 3Q3CA 4TM7A 1CIVA 2IEGA 1P6UA 4AKGA 3OIYA 1OLXB 1VG0B 1RI2A 3TPCA 1PVOA 1P7WA 2Y05A 4QG7A 3WNZA 4YT8A 2F67A 1W35A 1T3ZA 1ZO8A 1DIGA 2PMWB 1UBNA 3HPQA 2DENA 1Z4IA 2H17A 1OSNA 3D6AA 1L4EA 4L5JA 1YR2A 2COKA 9MHTA 4HPWA 5KVCA 2PSHA 2TMKA 2WZBA 2ZOSA 2IBMA 4CM9A 2FPIB 4BZZA 3GT4A 1UMBA 3AVXA 5C1DA 3T6PA 3DMPA 4N01A 3NEJA 2FUNB 4BQEA 2ZJAA 3FCEA 2GCPA 3BD8A 3KX2A 3VSAA 1NO1A 2GJ8A 2F8SA 5I9IA 2H59A 2BGTA 3AR5A 5JD6A 2YWDA 4OG2A 4WNAB 3GPUA 3VKWA 4RQTA 1NVGA 3QFSA 5LKAA 4YTEA 2B1JA 4LOAA 3UWDA 3E3OA 4CV3A 1UBKS 3MS7A 1GZSA 4UPDA 3U1VA 3FD8A 4P3OA 4AIIA 2BGMA 2YW9A 2J9ZB 4HMPA 2J0UA 2O0JA 3K8OE 3N2KB 5DTMA 1R6BX 2ETXA 4KITB 4HOYA 2WJWA 3T54A 3NS7A 4AS3A 1DQRA 5F7OA 2WWYA 1O6GA 2AA3A 2JJ2D 1PZXA 4JYCA 1HQCA 2HRZA 3FRJA 2R6FA 3PK0A 1KO7A 4EHKA 2ZK7A 5EFZA 2MJLA 2OLJA 4CF3A 1X1CA 3PZRA 2C5SA 4UPEA 3IG5A 1N5RA 1TEZA 4DDUA 4FHCA 3L4SO 2HK8A 2JCVA 5JHHB 3GLTA 4GX5A 4HO1X 3SOZA 3D8LA 1E2EA 4JZYA 4G97A 3L6OO 3A9RA 1V47A 4MHOA 3EGWA 2B4KA 5AVWA 3HWWA 3PU6A 3ELWA 1P5HA 4D8WA 1V5FA 3CO0S 3MTDA 4PZDA 1VJTA 3OFJA 5CCDA 4ND4A 1SG9A 1MOPA 1QORA 3IOCA 4D8VA 1TMKA 2OCIA 4IJFA 1VMKA 1Z74A 1UJ2A 3K0FB 3DS8A 4PPGA 4NOMA 3PBKA 3ODGA 2AOTA 3H1TA 3LXXA 3DW3X 2UZ0A 1Z5OA 1ZXLA 4EGCB 1A9RA 5D87A 1MGOA 1RQRA 1MV5A 2ACKA 1IOWA 1UBMS 5ALMA 3DLHA 3SJAA 1KIMA 4I5EA 3H4MA 1H3NA 3BWBA 1VBNA 5EL0A 2Q3EA 4J6FA 3IPYA 3S68A 2DZNB 1ACLA 2BH2A 3LWDA 4M38A 1L2DA 1HYEA 1AO0A 2QRPA 2IUYA 4HYTA 5E1DA 4C01A 3OTOB 4X71A 5EY5B 2LRHA 2JLQA 4KYTA 2YOGA 3G49A 3ICCA 1ZDMA 3N0VA 5TIIA 1KC3A 4BNIA 4YAIA 5DOVA 1GG8A 2J7PA 3QBJA 3AOEA 4WERA 3LDFA 2CNDA 3GP8A 2FU5C 3L92A 3TL3A 1SBQA 2PJRA 4DUZB 4ACBA 1M2KA 3KTDA 3FUCA 4HMQA 1U7PA 2BGJA 1SVKA 3HXTA 4HEOA 1G7TA 5F4ZA 4RZ2A 4UCFA 1DL5A 1PWZA 3GRYA 2B1QA 3RFVA 3GLIE 1N25A 2E4WA 3LLVA 4BC1A 2J87A 2AG5A 5ALWA 2QI9C 4O2BB 2L82A 3SNKA 2DHQA 4IWXA 1Y34E 3GD5A 4CDNA 4UBLA 2J7NA 4LA4A 2CK3A 4PGHA 4BCCA 2REBA 4D9EA 3D4IA 2I76A 3K6JA 3AU9A 3GPIA 3WKDA 1WDKA 1YQDA 3EXEA 4WW0A 2V7QD 1E5VA 2QW1A 1P7ZA 1EJ2A 2II6A 3O8BA 3VK7A 3JARB 3ZW7A 3PNSA 4NRDA 3L93A 5LFAA 4M4SA 1CUCA 1TRHA 2X86A 4AB1A 4N8EA 1W48A 2WFLA 4L5IA 3TFQA 1CS0B 2EVWX 1RJ9A 4RTKA 3P4UA 1TZCA 2I8LA 2NO4A 2I1LA 4KLZA 3MBIA 4GX1A 3ES5A 2YN0A 1GU7A 4FCCA 3SATA 3JASB 2DSTA 3QSYA 2AKEA 5JMOA 2HKIA 3LECA 3SYNA 4ZI5A 2UVDA 1GUDA 4YMSA 2GHTA 3ZXXA 2O54A 4RPLA 3JD4A 1W2GA 3SFVA 4N7JA 4B9AA 4LWPA 1RAFA 1JVSA 1NDQA 4IJQA 1TM1E 1CJUC 5CLIA 2BBTA 4MAMA 4YC7A 2A0UA 1J00A 3WLMA 1O8BA 4YJHB 4J9VA 3KEFA 4JVNA 1SOVA 4IDCA 4YUZA 5L6LB 1V43A 3NVAA 2EKDA 2VF8A 1IG3A 4YPFA 4QARA 5JUWA 4ZVQA 4L75A 4ZTBA 4QBKA 3QE9Y 2Y9MB 1GTJ1 3P9SA 4U9HS 4YAGA 3OMXA 4X3OA 2JPDA 5JEEA 4F85A 1DIAA 4ZGBA 4EX7A 3Q8MA 3DEZA 3N2GA 1JR6A 1ZWLA 1VEKA 2GLUA 1RZ3A 3PEFA 3BULA 1WDLA 3ZXYA 2YQ5A 2H1FA 4MPRA 4F3RA 1U8AA 3RKUA 4IO1A 3MMSA 4AYTA 3CNQS 3VQTA 2Z8YA 1BROA 6NULA 1NULA 2OHJA 1W76A 2P2NA 3EW7A 1BQ3A 3KAQA 1OT3A 3ESDA 3K4PA 4HF7A 3AHJA 3ER6A 2J09A 4Z0PA 2XYRA 2PIAA 2VL7A 4DA4A 1W1WA 1WETA 1TVEA 3WGMA 5KU1A 1CVRA 1K82A 4Q9JA 4CMIA 4PO8A 4Q3AA 1JTEA 4KQIA 3TBFA 3ZKWA 3BHMA 2QT1A 4ND3A 1ADFA 3KSAC 1BMTA 3LCRA 2A35A 4YYZA 3TLBA 3DA1A 4ZQFA 3MJDA 2XNKA 1WB4A 5ECYA 4YY3M 2CE2X 4BS9A 5B6IA 2W0MA 3STWA 2LVPC 1C1HA 3ETLA 3QX7A 1FP7A 2OZLB 3QPVA 3N8DA 3FZQA 3G2IA 3E8MA 3NT5A 1DHRA 2EX1A 4JMLA 2O2SA 4WFIA 3RUCA 1PCXA 2IHBA 4M22A 4MHSA 4WLOA 4KL8S 5KDOA 4TTQA 4DLSA 4UN2B 2Z8XA 1DG9A 4DXDA 1EQ2A 4RVGA 2HQRA 3N3BC 1XJWA 1DDOA 5DBFA 4DSNA 2FPPA 1NVBA 4BRZA 1HEUA 3KUXA 5LN1A 1ZCBA 3PUYA 4IZIA 3U6LA 4MWZA 3SIPA 5EYPB 5IDWA 1CB7A 2ABWA 1NVDA 2CRUA 2BTOA 3GMSA 1Z2CA 1D0VA 2CP8A 5L3VA 4W8OA 1N5OX 2QLFA 5AFSA 3X2FA 2BMDA 3AMVA 4AVYA 1Y9JA 4RYLA 1VZ2A 4DEYA 3WZ2A 3ED5A 1P0PA 3LHSA 2GEFA 2OUIA 4QQFA 2IX3A 3N8KA 1LLUA 5EE9A 4B7CA 3NWPA 1PWXA 3T9BA 3VJRA 4HEHA 2J4DA 1OHHD 3COZA 4R2KA 4MUMA 1L7OA 2PWPA 5JE8A 2PYDA 2VNIA 2DQ4A 2A94A 3H19A 3KYBA 1E3WB 1NVXQ 3BWXA 4UNIA 1D2HA 2XRFA 4V3BA 3HCRA 2VRWA 4UBMA 3TUJC 3AIIA 4L57A 2ZE6A 5EJEA 2IODA 3ZWMA 4U5QA 2WOOA 2NO7A 4HYYA 3AL3A 4H6VA 2JFGA 1TEHA 3AIOA 1TYEB 4YIHA 1LA2A 4Q18A 2QSZA 3PL5A 3SWWA 3SQNA 2YQ4A 2RK4A 4DF3A 1J90A 5CLGA 5C8YB 5JALA 1HJPA 2IUEA 2AXNA 1BFDA 1RACA 2J0VA 1NNUA 1Z28A 1GXSB 2VTBB 2H18A 3B52X 5JSZA 3GLHE 4YAUA 5HF8A 6CHYA 5A4JA 1L8XA 1VHJA 3MJCA 4A2WA 2QVBA 1G5HA 1AS0A 4FSHA 2VP6A 1WZNA 2QE7D 2CNBA 1B0AA 4XCQA 3FAZA 1JG6A 2PUWA 4I55A 2AHRA 4JWKA 3IEVA 1Q1BA 4DCCA 1P1HA 2H4YA 4L0QA 2OA0A 2DBYA 1OX5A 4F3CA 1DNPA 4RDXA 3LPNA 1YCFA 2PUGA 2ID9A 4C0BA 4D5GA 4EFDA 4IIVA 1WCXA 3NYRA 2OB2A 2H4JA 4G0UA 3NOOA 1RWVA 1U81A 2AOUA 3GQ3A 4ZRDA 5FO1A 3CNOA 3A1TA 4AF8A 4ZI2A 3HHZA 1ORVA 1GU0A 4R1QA 1XWIA 4G86A 3AUKA 2F5NA 2IPXA 4UFOA 1Z34A 2N0SA 3KD3A 5E6RA 2IYPA 1WXFA 4KBGA 2F43B 1UZAA 4A4DA 3OOHA 3RYHA 1Y8QA 3RS9A 3CZPA 3O75A 4IIJF 3N1UA 3OLXA 2C4KA 4JJ4A 1V95A 5DBEX 1OFUX 3VJLA 2DRIA 4PZPA 3ZX5A 1Z2OX 2RHWA 5K0BA 3BCHA 3JYNA 3N5CA 3OM8A 4TKUA 5M3BA 1SJ9A 2VN8A 2Y2UA 3L01A 1R6XA 5CVEA 1B2LA 2N3ZA 3FPCA 4HDOB 1G9TA 2BVNA 2ONZA 5EQFA 4J43A 2FJ0A 5DF1A 3BCSA 2BPOA 4FQ5A 1LI5A 1Y7HA 3JALA 4FYXA 1HR0B 4GIPA 4XRGA 1FEZA 2XMQA 4MIOA 3CUTA 3UGTA 3NO4A 3JQGB 4L3OA 3QPWA 3TLAA 1VLQA 3D5EA 2CLFB 2VH5R 2NUAB 1YFLA 1IY2A 4G37A 2AXEA 4KSCA 4ADSG 5BURA 4CRWB 2QM8A 2XTAA 4OHOA 4TLBA 4BLSA 1V6SA 2DR3A 3BAFA 3K8YA 3PQ4A 4BO7A 4E7OA 1O3YA 3ZN2A 4BAGA 4HV4A 2QL6A 1IOZA 5CNIA 2OC4A 1VL8A 1FTYA 1SXHA 4QUHA 3K0EA 1AZWA 5F1OA 4DNPA 5TQ0B 2VKQA 3E9RA 3EGDB 1MH9A 4WESB 1QCDA 2JFZA 4QJ4A 4X1IA 1Y8GA 3GMDA 4I8OA 2OT3B 4UULA 4IV8A 1XJ0A 2BN4A 3DLCA 4PM4A 3SZ3A 4BCDA 4AL4A 3MGAA 2ADFA 3H8SA 4XGIA 4YT5A 3AZQA 2JVKA 1U2RA 3Q72A 3RK1A 1V3QE 3SE7A 4B3XA 4E5NA 4F6CA 1KEZA 1FTGA 1FTWA 1NL3A 1YTUA 3LC2O 1FB5A 1EFVB 4EYKA 2GO7A 3FLMA 3OT1A 4UEOA 3FOAA 1L5VA 4DYDA 1QFJA 2EJWA 5L7WA 3GPDG 2IY8A 4BFUA 2BZ1A 2C4NA 1FP4B 2ZAMA 1DJPA 1TFUA 2V5VA 3WB2A 2XWBF 3Q3IA 1ZMOA 5A4AA 5CYPA 3I4CA 4X44A 4K9PA 5DU2A 1SWWA 1KAMA 1AS3A 5IKOA 3A6HA 2ZJZA 3M82A 1TCAA 2PR7A 3OQVA 4PHFA 1Z5CA 4LJ9A 1VG9B 5IW8A 4D0RA 3BXEA 2BR4A 1KP9A 4MS3B 4CDGA 1YSCA 4HX9A 1G3QA 4ED9A 2C99A 3QFFA 4HZUA 2EEPA 2I2AA 3PXXA 3WC4A 1TPZA 3I5YA 1SC6A 1QS0B 3TZEA 3MCVA 4YRNA 4BP1A 3RT1A 4D43A 1XU4A 3FMFA 1QIFA 2BL4A 1I7PA 4HDKA 4LK2A 2QRLA 4BB9A 2IIPA 4WMLA 2ZRKA 3QUCA 3DDHA 5JECA 3RJ5A 4HFJA 1SVMA 4LSZA 2GF2A 2FR8C 2Q4OA 2V6FA 3JQDA 2YW2A 1QNFA 2MYUA 4NZOA 1I36A 3JR4A 2B94A 4YJKA 3ILVA 2DTEA 4NZNA 1XUOA 1RKVA 1U9IA 1AKUA 3KSMA 2A58A 1MT0A 2WBLC 4LHEA 5JTTA 3FNBA 3RGWS 4G5YA 4L4XA 1XZHA 5AH0A 3IUSA 3WLHA 5HKAA 2XZOA 4TV9A 3KR9A 4GPEA 3K6RA 5EIBD 1K4KA 3PVCA 3ZHCA 1SKYE 1GL6A 2PL3A 2DSNA 2YC2C 2DQYA 2H7CA 4I5FA 4CT5A 3GG9A 4O02B 2MROB 3B7WA 2H2FA 1U3TA 4ESEA 4DCJA 3C1AA 1OROA 1ZVQA 1PR5A 1J56A 3DKPA 2GJKA 1T36A 2IELA 5BQ3A 4P4SB 5FA8A 4MA5A 3ZOKA 1A5BB 3KYDA 3UGQA 2FSPA 1B8VA 5T6BA 4F38A 4OJNA 2O3TA 1C3EA 3VGPA 4JI8M 3N6XA 2O8CA 4WWHA 2K4MA 4F97A 1PW7A 4DR2B 1E1YA 2A88A 1ADCA 4LJSA 3PWTA 3ND8A 4CKXA 2R7LA