3U61B

Structure of t4 bacteriophage clamp loader bound to closed clamp, dna and atp analog and adp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
305
Chain Sequence
ITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 95
structure length 305
sequence length 317
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u61B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u61B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u61B01
1R0YA 1M74A 3SYLA 2JA1A 3IO5A 2BIFA 3RRYA 4EPYA 1XEXA 4AI6A 2C95A 5FBRB 4X8MA 2D3WA 4LHYA 4IEIA 5LDDC 2ZUBA 3RS7A 4C0HA 2ZJ8A 1HV8A 4URYR 5IF9A 4DLSA 1E3MA 1BH2A 4UXIA 2WPDD 1KO5A 1L2TA 1XEXB 3OE7D 5SZHB 1WE2A 4UNSA 4OHYA 4GMDA 3TSOA 3UWKA 1D2EA 1NN3A 2QZ4A 2WWWA 3CPEA 4Q9JA 1UBFA 4ZDWA 1WBBA 4TMVA 4PHTA 2D4HA 1FNMA 2WOJA 2R2AA 5M04A 3IHWA 4MGZR 1OXXK 3CH5A 3GFOA 2QAGA 5J5CA 4CEIA 2ZE8A 4UJ5A 5KNBA 1T6NA 2RGCA 2C2HA 1Z47A 5HZHA 2QAGB 5AJVB 4CEIB 4HLDA 3CRW1 4MKHA 3EXAA 3FYHA 3QSYA 4UNNA 4B44A 3SJCA 2RH5A 4ACAA 1GAJA 1AS3A 5JMTA 1ZM9A 3AF2A 4Q03A 4MRPA 3AF0A 4D26A 3D3QA 1GUAA 3I1FA 2XNDA 4CW7A 3CM0A 2FPKA 4QHYA 5C46F 4FCWA 3ETLA 2IYVA 2OSBA 2QRZA 2WWFA 5JHGB 4RD4A 5GVRA 4WOPA 1VYTA 3CR7A 1XXHA 1N6LA 4A0HA 2ORIA 3HJNA 3Q3JB 2ZJYA 1HQYE 2ZYTX 2CMKA 1XXHB 4C30A 1TF2A 1G8YA 4ZCIA 4KSCA 1QHSA 3VHXA 1LFDB 3CF0A 3NH9A 1KI2A 4DLXA 2IYXA 2QPAA 1W0KD 1P7CA 4QGAA 3RANA 1S4QA 2EFGA 2VTKA 3HPRA 5GJVC 1Y3AA 4MRSA 2MMGA 4NYMR 1KIMA 1Z5ZA 1QHNA 5BW8A 4YONB 1W49A 2GZAA 4HSEA 3NBYC 4GSYA 4Q1FA 2JCSA 2NO1A 1RW4A 3CZQA 3B5JA 2G83A 3W6OA 3AUYA 5JECA 3DHWC 3Q5DA 4RZUA 4P32A 1IXSB 1NBME 1IOZA 1YZQA 4DDWA 3BERA 2JJ2A 2NO6A 1QVRA 1Q57A 3B78A 1W4AA 2WKRA 3OF5A 4UNRA 5SZKB 3QXJA 1YKSA 4X8LA 1JJ7A 5FOWA 1E2GA 2ZUDA 1HYQA 2V1XA 4TTQA 1CJVC 2ZU0C 6Q21A 3H2YA 3QG1A 1FUUA 1TAGA 4JLBA 3E1SA 2W6IA 2YJTD 1YRAA 4PO8A 1KJWA 2VHTA 1HUQA 2OCAA 2OZEA 3IIKA 3AQ4A 3W3ZB 1IQPA 5CM9C 4DLZA 1XP8A 2FPMA 4HB2A 4EUNA 2ANCA 3DZ8A 5EP3A 1COWA 1NMYA 4K46A 3FFBA 3ZZ0A 1G6OA 2DFNA 1KSJA 1SHZA 1P3JA 1CTQA 4KJZA 3RDPA 1LF5A 3U60B 1ZUNB 3VR1A 3DO6A 3G5UA 3MRSA 3BC1A 5C2JB 1CS4C 4EIWA 2AX4A 3LD9A 4HB4A 5FPKA 4TMZA 4GOJA 4HDQB 4YDHB 4BE7B 2ZR9A 4R71A 4HUQA 4P31A 4NL4H 4RZ3A 5L3VA 1S1CA 1KZ7B 5FFMA 2ZI4A 1Y63A 2EU8A 4HUQB 1NVVR 2QMHA 3BWDD 2C03A 1T91A 4EPTA 2OAP1 2OBLA 3AKCA 4BPBA 4LSGA 3IUYA 2WWXA 1KYIA 3LVQE 2GJ8A 2ZI7A 4LK2A 2JGNA 5CIQA 2GJ9A 2J7PA 4LBYA 5FOUA 3D6TB 3RS5A 5JI3E 1KI7A 3C4JA 3NG1A 1E2DA 2ZRCA 4YXWA 1Z07A 1G20E 821PA 4NDZA 3J81k 4B2PA 1XJ0A 2GK6A 4M9QA 4MH0R 2G0TA 5KSPA 2DB3A 2VPPA 3GJ4A 3QPUA 4Q21A 4ZIRA 3V4RA 4KFSA 1HQCA 3EPHA 2ZRJA 3OAAA 4MYCA 2LKDA 1AZSC 3SYNA 4ZIRB 4C0BA 3A37A 1HTWA 1NSFA 1NG1A 4B6EA 1CLUA 1XMIA 2ZRAA 2AFIE 3IBYA 1OPXA 1UJ2A 2ZRNA 3HPQA 4KYIB 4PAQA 3TNFA 4MKIA 5FUYA 2YYZA 3V00A 3RC3A 2PCLA 3SJZA 4ARZA 1ZVQA 1FMLA 4GRAA 5KTYA 3PUVA 4IVQA 4IEEA 4ARZB 1AA9A 4KCGA 3V4FA 4NONA 1MOZA 2OBMA 1MO4A 2FH5B 3RWOA 1U0JA 2ZE6A 1UBGA 2NIPA 1YHNA 3OFND 1VYVA 3WY9A 1SVWA 4BFZA 2JEOA 2ORWA 2B7CA 4ZCMA 4FWDA 5FBVB 2ZYWX 2O8FB 2ZYUX 1KTVA 4ASUD 2CLSA 2CL6X 2WSMA 3OEHD 1G3UA 2O0JA 1NMZA 4TLCA 4KXFB 2HT6A 1WBDA 2RHDA 5TY0A 3PEWA 1N25A 4EAQA 2NPFA 4FWGA 2VP9A 1LTQA 1DG1G 2WJHA 3C8UA 3UG6A 2VP6A 1H8HA 1RJ9A 4QNRA 1XX6A 1G21E 3F5FA 3GJ0A 5KDOA 3K9LA 3O47A 4L9SA 3DZDA 2GCPA 5HCNA 2WWIA 3IO3A 4DLWA 3ZLJA 1RJ9B 4JVSB 2QMOA 1CR4A 1FFHA 1Z29A 4TWZA 4DCSA 3AP2A 4F4JA 4D81A 1CKEA 1E6CA 1Z06A 4LPSA 4YQFA 4PQRA 2OLKA 1Z6AA 4YMVA 2CXXA 3PFIA 2P3SA 4OYHA 5EP2A 2GZDA 3BB1A 4NBSA 3IGFA 3NVAA 3QXSA 1LS1A 3Q7PA 1XCPA 2CLDX 1X6VA 1PLLA 1JBKA 2R8RA 4IFBA 4P4SA 1TUIA 1ZC3A 2J0UA 3BB3A 4M21A 3ASYA 1KDTA 4IXMA 5KNCA 3B85A 5E3HA 1T3SA 1J90A 1NN1A 1Q1EA 5JRJA 2V6JA 3U6BA 1VTKA 1ZAKA 4B3BA 1VHTA 4HB0A 1IN7A 4BFXA 1E96A 4JLKA 5LB2A 3IKJA 1Z2CA 2VHUA 1JQJC 3PEVA 1XU4A 2ORVA 1GIAA 4F93B 1NVWQ 2Q21A 4YMTA 1ETUA 3QJYA 4NU0A 4L15A 2Z43A 5GJBA 2HLDA 3QF4A 4FMCB 2X2FA 1QDEA 3CO5A 4C0JA 3X1XA 3CX8A 4M1YA 3SI7A 3SOPA 5DYGA 1OKKA 2UZIR 3QF4B 1HH4A 3ADKA 4F7WA 1G5RA 1W0JA 3AV0B 5FL7D 3FDIA 3KKOA 4JYCA 4GBMA 1GILA 2NMVA 2FZLA 3EZ7A 4BFSA 5FOSA 5HE8A 4M22A 1GTVA 1UM8A 3KW6A 4JSYA 4Q1DA 2OM2A 4V0KA 1SVLA 4EKDA 2RGEA 3CX7A 2B6HA 3VR6A 4Q1BA 3A36A 4R9UC 2OESA 5FR1A 1N6IA 1XPRA 2FJUA 1EK0A 5L3RA 1Z28A 3CBQA 4C7OA 1EG7A 1IHUA 4ITRC 3KFVA 3HP1A 3QVVA 1GDDA 3TR5A 3OHMA 2HXSA 1N3BA 3U44A 3JZAA 4Q7KA 4O2LA 4C7OB 3VNVA 4P4TA 2IUTA 1DAFA 3K8YA 1NVXQ 1NVMA 1XDBA 3BGWA 1HT1E 3U44B 1TQDA 2EVWX 5P21A 1HT2E 1J8YF 4JIMA 1Z0DA 2WIBA 4HATA 3TW8B 2V8OA 4MRRA 2Z0MA 4G0NA 5KDLA 1F3OA 2WKQA 4W7SA 4FXPA 1R2QA 2CL7X 1XRJA 1SQ5A 2BEJA 3RSOA 5J4KA 3CPJB 3W3AA 1X8KA 1GRRA 2E9SA 3TSWA 2GXAA 1SXJA 2O8DA 4F38A 4GOXA 4DUGD 3NIBA 4PC7A 1N6KA 1A2BA 2RKOA 2O8DB 4LJYA 1ZC4A 1SXJB 2XTZA 4S2EA 4A92A 3U4QA 4M1OA 3C16C 3A8TA 2V7QD 4XOIA 2IS2A 4UXJA 1XJQA 3K09A 3REFA 3HU3A 1MKYA 3U4QB 1GRNA 2EYQA 2GBLC 2VH5R 2OCBA 2FEOA 2J7KA 1G6HA 2ZJAA 3GJ8A 5L8VA 3CNLA 1SVMA 4LC1A 5FPSA 4B48A 2ZR0A 3TQCA 1W36D 4CEJA 3MJHA 2GXSA 3E5HA 4BEBA 4PHFA 1EFHA 4KBFA 5CDFE 1TX4B 4EJSC 4GT1A 3WMGA 3B82A 1G1MA 4BFTA 2YV5A 2AKYA 1KKLA 4UQOA 3GLIB 2UZ3A 1WRBA 3LXRA 3VR3A 3D31A 1IONA 4R2IA 3LQQA 4KFTA 4V0OA 2IUUA 1D9ZA 3AUXA 4CIDA 3NDPA 4A0FA 1Q3HA 3UG7A 1KI4A 3I92A 2I1QA 4D4MA 4IDQA 2H57A 3GEHA 5HKKD 1UBCA 4XVQA 1RPZA 3SS8A 1U99A 2ZSDA 1UDWA 1E1RA 2YWEA 3TUIC 5IT5A 1Z0KA 1BMFD 4Q01A 5FBQB 1N6PA 3EWAA 3OEHA 5DI9A 1T3HA 4Z8YA 3QBVA 1PUJA 1G8GA 2ZI3A 4HDOB 3LO5A 1KK3A 2FU5C 3OEEA 4IFEA 2GESA 1ZM3A 4DDTA 1DOAA 1WXQA 4KAXA 1ZCAA 4BLSA 2Q3MA 3G0HA 1IN5A 3KX2A 1VKJA 2QPOA 1NVUQ 4TQUS 3TBKA 2VIIA 1OHHA 4B32A 4JVLA 5D3QA 3HYRA 4V0MA 1OH8A 4P33A 1D9XA 2GJAA 4ESVA 4XVRA 2HEIA 1T8UA 5EE3A 1WDTA 4PX9A 5C4MA 5ANRB 3B1ZA 2QM8A 2WIAA 4XIGS 1SKYE 5DYIA 4AKHA 3A4LA 5AUNB 3K70D 2ZRHA 1VG1A 3U6KA 3RRNA 2Z83A 1FNNA 3AKDA 1W48A 4DJTA 1P6XA 2R6FA 1G3RA 1KMHA 3CX6A 4MRVA 1E69A 1Z3IX 3WBKA 1OH5A 2Z6VA 2DZOB 4KFRA 3NWJA 3VKWA 3JVVA 2O8EA 1KMHB 1R5NA 2AHOA 2BMEA 3K0EA 3KKMA 1KJZA 4RVCA 1YRBA 4W5JA 1GL7A 1KSHA 3GEIA 3GLGB 4US1R 3P1JA 1GZSA 2WJJA 2O8BA 2O8EB 4FN5A 3QVUA 4OI0A 1GP2A 1JR3A 1W5TA 1VPLA 4O2RA 2G88A 2KBEA 2GHIA 3D8BA 1E1QA 4DT1B 2R65A 2O8BB 4L16A 1A2KC 1YZLA 2QN6A 3K0AA 1XPUA 3KQHA 1GM5A 5EQTA 4F92B 4HI0E 3VHLB 4WZBE 3TUZC 1UKEA 1M34E 1Z83A 1ZNXA 3K0AB 4JL6A 1X8JA 4OQMA 1E9AA 2RGNA 1R8SA 4MGIR 3T15A 2P6RA 2F1HA 1YJ5A 1RYHA 3K9NA 4QC2A 4TSFA 3L82B 1NBMD 3L43A 2OAQ1 2C98A 4L4UA 3WNBA 4OQNA 1QHGA 3HR7A 4ZV4A 2XX3A 2ODBA 3BK7A 5LD2B 4JVNA 4LGMA 1CJUC 3I61A 2C9YA 2Q3HA 4CEHA 1VECA 3I3SR 2B8WA 2HF9A 1S2MA 1C1YA 621PA 1RC8A 1RRPA 1IJFA 2KWIA 3KL4A 5J4HA 2R6CA 4CEHB 4GPTA 3CNNA 1NI3A 4C9BA 2QNRA 2J0SA 2BKEA 2OBNA 1N6HA 2GDJA 4ZPXA 2CCJA 4XD7D 2B92A 1OF1A 5BN3A 1IY2A 5E7JA 4Q9LA 4PHHA 4LPKA 1W2GA 4HEJA 3PXGA 4RD3A 2PBRA 1F2UA 4IOLA 3P4YA 3R9IA 1JQLB 1TMKA 1CJMA 2QP4A 2ZSBA 2E1RA 4DB2A 4WVFA 1Z2AA 1F2UB 4RSGA 5HCIA 4V02A 2WZQA 2BCGY 4W5HA 5AWFC 2Q9CA 3WNDA 4A9AA 1S9DA 1G64A 1RYFA 2OV2A 3PEYA 2H8KA 5LB4A 1UDXA 4BLRA 2A7QA 2FEMA 4GP7A 3I32A 4R7ZA 3THWA 2JJ1D 2DWPA 2QU8A 1U8AA 4WIAA 4WXPA 2IT1A 1E2MA 4AD8A 3FHTA 3THWB 2RMKA 1KAOA 2XZOA 4NCIA 1QZMA 5KUTA 3I5YA 1K6MA 2QSZA 4XSHA 3NXSA 3NH6A 4IDOA 4KFUA 2JATA 4QNMA 2QW6A 2CK3D 2ZPTX 3LH5A 2IXFA 221PA 4XH9B 1U90A 3GPLA 2JLRA 4UXHA 4AKEA 2IEYA 3FMPB 4LBZA 2NQ2C 2DWOA 2BMDA 1L7VC 3HYTA 3Q72A 4RKFA 5G3ZA 3WMEA 2QAGC 1I2MA 4HAWA 5BYKA 4B3FX 3QKUA 1WQ1R 2IYLD 1QHYA 3BFKA 1MT0A 3LWNA 4HDCA 1QG2A 4LBVA 1KK0A 4HYYA 4QGFA 3T1VA 2A9KA 1ZD9A 4NP6A 1KDOA 1E79D 3VX4A 4AYTA 4D0NA 2BEKA 3CH4B 1M1YE 3PQCA 4BLPA 1G18A 1T4GA 2F9MA 2XTNA 5FBWB 1HURA 2EFCB 2L0XA 2FG5A 3SU8A 3NTUA 4IJMA 1OIWA 4CZ2A 2KB0A 2EFDB 3ECCA 1G8FA 1JXOA 4NCKA 1OLOA 3GLHB 3LXXA 1F5NA 2C96A 2WJVA 4JYBA 5JJLA 1N2CE 121PA 4FWHA 1NKTA 1G3IA 2BMJA 2W0MA 1NLZA 1KO4A 1FQJA 2N42A 3AVWA 1OXVA 2GEUA 3Q5EA 3P26A 4JBYA 3T5DA 2GCOA 2BDTA 4FCVA 4Z1MA 3H86A 4H1VA 1OB2A 2QTHA 4P4UA 2XEXA 3LBHA 2GCOB 4TZ0A 2DFLA 5CYPA 4XVUA 1KO8A 4LHWA 5KDDA 2A5FA 2AK3A 4W5WA 1U9IA 1NSTA 3EG5A 4QHSA 1W46A 3L0OA 3TR0A 4AC9A 3TIFA 5EXTA 4BLQA 4TMWA 4RCYA 5FPYA 2PCJA 1Z0IA 2PZGA 5FPHA 3RRMA 3WYAA 1XJCA 2A3RA 5HR5A 4JT4A 1UAAA 4OQFA 3U3OA 5HTKA 1ZJ6A 1E32A 2JAQA 2RGAA 2QMEA 3F8TA 3C5CA 2BJVA 4QJ3A 5D3MA 2GEVA 1MO5A 4URZR 1E2QA 1MRSA 1Z8FA 1EWQA 2D2EA 5CM8B 2FSFA 5D3MB 2VP4A 2BC9A 4EFLA 2B21A 2QA5A 5JFGA 1SVIA 5E7MA 3RRZA 4PSVA 5AJZA 2AD5A 4B6FA 4E09A 4BZXA 1X1SA 2VP5A 4DC9A 4NPHA 1DS6A 2WWGA 2CHGA 1IBRA 3LX5A 4B73A 1XCGB 4Z54A 4NE2A 1T5LA 2GZHA 2Z4RA 3QXCA 4ZDIA 2BVNA 4HLQB 3F0TA 3B60A 4EFMA 4Z8XA 2QT1A 1LB1B 3T34A 4TYQA 3PENA 2DWZB 4JLOA 4HAXA 1DG3A 1NBMA 1U0LA 1JECA 2QTVB 3LFUA 2B7BA 2QY9A 3DMNA 1ZUIA 1L4YA 4X8OA 3EPLA 1ZM7A 2WSSA 2IHYA 3I4LA 1U0HC 4C4PA 2SHKA 3DL0A 5C18A 1W2HA 2REOA 3EWSA 4IOJA 3AVXA 1KOFA 4TYWA 2CE7A 4U7DA 3M4YA 2PX3A 4LY6A 2XSZA 4DLYA 2X77A 4URVR 4NKRA 5DHAA 3AVUA 1YR9A 2ZRKA 5GJCA 2W83A 4XD7A 1CBUA 2C04A 3KQLA 5F9FA 5CLLA 3FWYA 1BIFA 4C0QC 2KJQA 1JAHA 3CRMA 4GZMA 4V0NA 3FMOB 1KGDA 3B1XA 1VCIA 4B2IA 1XXHE 1NN0A 2VHJA 4DDUA 3TE6A 3WRXC 2ZRMA 2ZRFA 1SVSA 4OQLA 1PLJA 2ZS8A 3BFVA 1CF4A 2O8CA 2QTFA 1PVOA 2WMNB 2RGGA 4TL9A 2DZNB 3UK6A 1BS1A 1TTTA 2GNOA 2JLQA 1FTNA 1Q44A 3U2QA 1I2DA 2O8CB 1DARA 5H70A 2JJ1A 1XZQA 2NO7A 3MUFA 1Q3TA 4LJ4A 1OFTA 3CTDA 1QF9A 4B34A 4PSKA 4JBXA 3SDZA 2IBMA 3CPHA 1WMSA 5IDVA 5J4LA 2ERXA 2OXRA 3LQRA 1G4UR 1G7RA 2R9VA 1HA3A 1ONBA 1TUEA 1MO3A 4JLPA 4RD0A 2IXGA 4FWTA 1P2SA 1G3QA 3A1SA 2ODWA 4P3YA 2OO7A 1G7SA 4EPXA 1NG9A 5HE9A 1RRGA 2PLRA 5DGXA 2FN4A 1NY6A 2W00A 4JMPA 1W4CA 3PR1A 3VMFA 4C0AC 1M8PA 3IQWA 5F98A 4FI3C 3W9YA 3HWSA 1X86B 2CJWA 1NLFA 4PPFA 1A5TA 2PL3A 2ZI5A 3UKDA 4NHOA 1I4LD 4QBFA 1U8ZA 4CRWB 3FKSD 4NCNA 3SQXA 1IY0A 2CJWB 4ON9A 4HUTA 5FBLB 3L0IB 4Q48A 3ZQ6A 5G53C 4X8HA 3TJZA 4MDFA 3KTAA 1KI1A 1PUIA 1ZU5A 4HB3A 4II7A 1J70A 4PPQA 1VG0B 3DKPA 3KTAB 4LV6A 4Y0VA 1VIYA 2FDCA 2VLIA 3QBTA 3LLUA 2XOKD 5A0FA 2ZETA 1GNQA 5AUOB 2DWQA 3IEUA 4BZPA 3ZDQA 4PSAA 4B3GA 1B23P 3EZ2A 2PT5A 2A5YB 4IKEA 3GJ6A 4NH0A 3GLFE 2A5DA 3FOZA 1ZYUA 2FF7A 4PQFA 3VKGA 4ZDJA 2G0NA 1X37A 2QT0A 2OLJA 1IM2A 1C1KA 3QF7A 4XTRA 3O8DA 2WPDA 4TQ9A 1UPTA 4TT3D 3OE7A 1W47A 4DCVA 2TMKA 2RGDA 5SZJA 1UEJA 4TN1A 1UF9A 3GFPA 1OFIA 3BH0A 5SZIA 1GL9B 2PZEA 5ELXA 2ZRIA 1FL9A 4PAOA 3BIFA 3SNHA 4N0EA 5EXPA 1CP2A 1NY5A 2WOOA 2ZRDA 2R9GA 2OUKA 5TARA 3PCRB 3MWYW 2WJGA 4OHXA 2GK7A 1XWIA 4B3DA 3SQWA 3KDSE 1II0A 1M7GA 4LBWA 3V9PA 3IEVA 2XAUA 4DSOA 2O8FA 3IIMA 3RC8A 2IW3A 5EUQB 2H92A 4MKGA 2WTUA 1P2VA 3QXXA 2XZLA 2ZJZA 2BBWA 3P32A 2W2TA 4TLAA 1F48A 3O8BA 1NIJA 4FMDB 3EX7C 4LJAA 4WW0A 2BHRA 2RB4A 1TADA 1AN0A 5JWRA 5EUMA 3CR8A 2QL6A 1WB9A 1ZINA 3AB3A 3EPKA 1ZCBA 5DLQC 3B9PA 4TLDA 4G5SA 4DCTA 5L3SA 3AM1A 2PMDA 1JR6A 3K9HA 4QXAA 3R9XA 1MO6A 2IYRA 1KI8A 4IVRA 2C9CA 4URUR 4WBSA 1N0VC 3KKQA 1RZ3A 4D80A 5L3SB 4ZCLA 5KSYA 721PA 3LAWA 3ZGXA 3RSLA 1TL7C 1RIFA 3I73A 2F3TA 1VCMA 1E9EA 2PJZA 3B2EA 1W0KA 2XTMA 5E95A 4QJ5A 5C4GB 3ZS8A 4A2QA 2XJ9A 1PJRA 2VP0A 3NC1C 4Q9IA 3THXA 4Q7JB 4G3XA 3PJRA 4AYWA 4KI0A 1LNZA 4US2R 1QHXA 1U2RA 3FE2A 3LV8A 3THXB 3SEAA 4W9MC 2IYYA 1DO2A 2BM1A 1W4RA 4URXR 1T9HA 4A8JA 2V54A 2IYUA 4B75A 3M0EA 3SYKA 4O0MA 1ZP6A 1FQKA 3B6EA 3BXZA 1TNDA 1ZW6A 3O8RA 3I62A 4A8JB 3BOSA 2IYWA 2JDID 3UMFA 1N6NA 1II9A 1PZNA 2WMOB 4RZXA 5UKDA 4BFVA 3ND9A 1V43A 4L5BA 2ZSFA 3ADDA 1SXJC 2GA8A 2AD1A 1XTSA 3T1OA 3TSZA 1EXMA 4DIEA 4LRWA 3K0FA 2BBTA 3M6AA 5FOVA 3U3KA 1OIVA 2VRWA 3FPAA 4TMTA 1FW6A 1RVDA 1Z22A 2F43A 4LZZA 1A4RA 3WXMA 3K09C 3K0FB 3O8CA 2IC5A 2H17A 2Y8EA 1S8FA 4OBEA 2NTYC 1NVVQ 3EASA 4LJ8A 1T0JB 2F43B 5KPJA 5DH9A 1AK2A 5FUVA 1WCV1 3R8CA 1XD8A 4OHZA 2O0HA 4GZLA 2JLWA 2F3RA 2ZJOA 4OI1A 2X1VA 3LBNA 3WBJA 3C7KA 2IS1A 2J0VA 3NBXX 2J41A 2ZITA 3W6NA 3QUSA 4AG6A 3LW8A 2G77B 1UFQA 4PXAA 1YVDA 1OE0A 4WAUA 5KPDA 3W6PA 1YR8A 2ZI6A 2REBA 3MAAC 4MUBA 3EPJA 1J99A 1DVRA 1M7HA 2ZS9A 4JL5A 5G3YA 4US0R 2HCJB 2VSFA 1KI9A 2FFHA 1P9WA 1QHIA 5JHHB 2YC4C 3A58B 1DAGA 1JXMA 1WA5A 1KZGB 1S1MA 1OFUX 3TK1A 2ZVQX 1P75A 3MCAA 3PIRA 1IN8A 4JSTA 4I81A 2FOLA 3M1IA 3H0KA 5AUPB 4WA7A 4MGKR 3GD7A 1Q21A 3K9GA 1Q1ZA 3B13B 3TAHA 3ZIAD 5JRZA 4GL2A 1R0ZA 2P2LA 2NZJA 2W2XA 4M9ZA 1FOEB 1QBKC 4TQAA 4FMBB 4Q5IA 2OXCA 3WYFA 3AGPA 5FL3A 4BWYA 3PG5A 1XPOA 1R0XA 1K8RA 2J87A 5B58C 1GRQA 2FSGA 4LV5B 2KBFA 4OKSA 4AG5A 4AKIA 4HZUA 1BKDR 1U8YA 1AS0A 2GETA 4OJKA 3TVTA 4ERNA 1H65A 2BWJA 1HEIA 3Q85A 4RFSA 4TL7A 1TQ6A 3SFZA 2ERYA 4M8NE 2PT7A 1GG2A 4HZUB 4D6PA 5FTMA 1H8ED 4J0QA 2YVUA 3CKLA 2ZUCA 1XTRA 2WJYA 3NBZC 2ZANA 4RFSB 3NBFA 2FPLA 4ZKEA 2PH1A 2AWNA 1D2NA 3UPUA 3Q7QA 4TT3A 4XJXA 1QHHA 2AR7A 2CL0X 1QG4A 2P5TB 2CHVA 4BECA 4DCUA 1FX0B 3AKYA 4NYIR 3GLIA 4LJ6A 1QHHB 1L8QA 4BFWA 3EC2A 3OIVA 3NHBA 2QP9X 3GEEA 3GFTA 2KI5A 2W0SA 1BYUA 3BFXA 2R6AA 2IWRA 2G6BA 3T5GA 5DN6D 1ELOA 1MH1A 3FTQA 4DZZA 4JLMA 1DELA 3EAQA 1SXJE 1XD2A 2WHXA 4DHEA 1G5TA 4TZ6A 2ZS7A 2KRKA 4LX0A 3GJXC 3OFNA 1KMQA 2IYSA 4K8OA 2QORA 1XD2B 1AJEA 1R5OA 5JZVA 1UADA 1DEKA 3LW7A 4G5OA 3RS0A 5J47A 1EFRD 1FTSA 3B1WA 3X2SA 4ASUA 2H18A 3PITA 3CWZA 3QPVA 1ZBDA 2AWOA 3KUCA 3AVTA 2BBOA 2RGNC 1P61B 3H1TA 3OESA 4PR0A 3SFVA 3PVSA 3I5XA 2GKSA 4DLTA 1ZM4A 1TPZA 2MSDB 2VBCA 3GCGA 5LD2C 2P6NA 3NKVA 4M1KA 1E0JA 2YWHA 4D25A 3L0SA 2FSIA 4Q4JA 3ZH9B 1KO7A 4QM7A 3U3MA 4E03A 1XBTA 3NHAA 5J4YA 3NEJA 3ICQB 1GNPA 1RRFA 3DPUA 2ATVA 4Q4JB 3A6PC 4XWKA 1ZIOA 2OE2A 3THOA 3ZS9A 5KYKA 4YMWA 4LI0A 3Q8XB 4DKXA 3QXHA 3FFAA 1J7KA 3KJHA 1VCOA 3REGA 3VR4A 2Z4SA 3BGEA 2HYDA 3ZYCA 3C14C 3GLGA 2JLSA 4I99A 4O3MA 4Q00A 2FZ4A 3IILA 1MABA 1N5KA 1OXTA 2GWHA 2OILA 3MLEA 4UNPA 4ZO4A 4DT1A 2YZ2A 3U7EB 1E94E 4E07A 5LPNA 1JJVA 1MABB 4C0KA 1AQUA 1KDRA 3QOFA 4LUCA 2ECKA 3VX3A 5KU1A 1SULA 2J59A 2WAXA 2FA9A 1JEEA 5AJXA 3F3YA 3R20A 3W34A 1U81A 4LJ9A 3DM5A 3RLFA 4V0ME 1OSNA 4H9GA 2QGNA 2IHBA 1XZPA 4G5GA 4Q19A 5CJPA 5BN4A 1YZNA 4C2TA 3QIAA 1G5PA 1MV5A 1TF5A 2YOGA 5JJIA 4KBGA 5FL7A 3RS3A 4C3ZA 4M1WA 1Q12A 3DMDA 4JLDA 4C0SA 4BUJA 3FHOA 1CR1A 1TU4A 2XNDD 4HAYA 3CZPA 4ACBA 2EYUA 2GRJA 1DAIA 4EPWA 1KI6B 1O3YA 5KOYA 2YNMA 5FTJA 2NO0A 3DKVA 2OG2A 3B9QA 5CIWA 2KE5A 3TMKA 1SKQA 1P2TA 3CB4A 2NZ8A 2R6GA 4QRHA 5FOTA 3BS4A 1G16A 4G5QA 3SJAA 2IUSA 5DISB 5FTLA 1ESMA 5JWOA 2PLFA 4S35A 4F4IA 5CK5A 2F55A 1WF3A 2GCNA 3A1WA 4A2PA 1ZNZA 5JS7A 4AIIA 4LHVA 4HAVA 2VF8A 2CEAA 1JR3E 3JVUA 4D2IA 1OH6A 1R5BA 2FFAA 4RD6A 1YZKA 1M6NA 4Z51A 1AZTA 2P65A 5DE3A 2J5XA 1OYWA 3ADBA 2WJIA 4FMDF 4LRSA 2J46A 1G41A 2FE4A 4M0LA 1P73A 4TYPA 4A4DA 1VIAA 2QMUA 3GP8A 4JZKA 5FI1B 1KJYA 3QQ5A 3TKLA 4OL0A 3A4NA 4LRTA 5C1BA 1E2PA 3L0PA 1J8MF 2CE2X 1NLYA 2I1VB 4IDNA 1D6JA 3UXMA 4YMUA 4HZIA 4Q4AA 2JJ2D 1Q0UA 4HAZA 2ZRPA 3IIJA 4EQ6A 1HY3A 2D74A 3ZIAA 3BH6A 4D4JA 4Q4AB 3G82C 1NKSA 1WP9A 4EQ6B 1ZD1A 2QI9C 3MSXA 1RRCA 2GILA 4DUGA 4BRUA 4B35A 4KITB 3WHKA 3K1JA 1JI0A 1UBEA 2BCJQ 3K0CA 2W6ID 4ABYA 3KUDA 4YMSA 2V7QA 3TVDA 1XTQA 5BQ5A 3R9WA 3OIYA 2X19A 3U3JA 2V1UA 4RJLA 4EDHA 1PLKA 2C5LA 5EP1A 2IL1A 2REXB 1COWD 2ZREA 1E9SA 2CCKA 2IS4A 3PUYA 2UVQA 2F1RA 2OFXA 1C4OA 1GNRA 3QE0A 4KVAA 1IN4A 2D06A 4N0DA 4UJ3A 5HZKA 1EGAA 4RKEA 1GITA 5BN5A 2JLUA 1E0KA 5FTKA 3B7GA 4TMXA 2CLCX 1CR2A 5CK4A 3W90A 3AKEA 3ZVLA 4NTZA 4FMCF 1W36B 2IXEA 1GWNA 3KZ1E 1IAQA 5J4VA 3CRQA 4Y0AA 1JEDA 1OW3B 3CLVA 3GLHA 3WHLA 2QGZA 2DYKA 5DN6A 2IF0A 2VO1A 1JPNA 1TQ2A 3WMFA 3GMTA 4P0TA 1R6BX 4M1MA 4KODA 1JAIA 5EE9A 5EZ6B 1US8B 1E9CA 3QNUA 5FOXA 1YZGA 4FINA 2W58A 2QQEA 3CRRA 5HKKA 4ZI2A 2G1KA 2GVZC 4GP6A 3C15C 3RYTC 5BWMA 1OH7A 4QFMA 2HDNB 1BMFA 4G01B 2Q9BA 1N0WA 1E2IA 4Q9KA 5B64A 4Q66C 2BOVA 4CVNA 4LYAA 3CIOA 3ZD6A 4HLUA 2J7PD 4LCBA 4DLUA 3SBDA 4DDVA 4KHZA 2ZE7A 5JI2E 3PUZA 4B3CA 3IQXA 2C9OA 2J3EA 3RS4A 4Q4HA 3VQTA 1LS6A 2JLVA 2GXQA 4ESHA 2FV8A 1GSIA 3TQFA 5GADl 2HXYA 2OHFA 3LY5A 3ZZUA 1LV7A 1BYIA 4Q4HB 4RY2A 5GVSA 4FCTA 2G9NA 4B47A 4BLOA 1BO6A 1ZU4A 3T1TA 2FSHA 5FUWA 3OAAD 4AKGA 2V55B 2F6RA 2YWFA 2ZEJA 3WNCA 4MYUA 4ZDKA 4E22A 1DAHA 1YR6A 3LNCA 2H7VA 1P60A 1P9NA 3K70B 1Z6GA 4LHZA 3TAUA 3ZVNA 1I4DD 1U98A 4KV9A 4RCZA 3T1QA 4QOSA 3N2EA 1KO1A 4BFUA 1AGRA 1T3LA 2ZI9A 2WM9B 4DIDA 4D0LB 1F6BA 1XD9A 4CT5A 4M1SA 3FB4A 1W4BA 4FIDA 4MGYR 1E4YA 5H8WA 4Q7LA 3TW4A 3AF1A 2AFHE 2Q0HA 3AVQA 3H84A 5BYJA 1E98A 2A78A 2JLZA 1EFCA 1GFIA 4Q4LA 2HV8A 3KXKA 3ZVRA 2MSCB 2AL7A 3NEYA 4TMKA 1CJKC 2P67A 3ONWA 4JN6A 3VFDA 1CJTC 1A7JA 1H8HD 4WZ6A 2J1LA 2QPTA 2N46A 2DFKB 3AF4A 4OK5A 3THYA 2VP2A 4LV8B 2JLYA 2ZRBA 4B74A 1OYYA 1QZXA 2NG1A 3GQBA 4A3VB 5DIFA 2HUPA 2GJSA 4LOAA 4PANA 3THYB 5FUXA 1XEFA 1YE8A 2YC2C 4KLNA 4PO1A 4B33A 4QKQA 4UNQA 3QKRA 3UWOA 5EXSA 2C99A 1ZNWA 2PJRA 2D62A 4JLJA 5CLQA 5AJYA 1Z0FA 1EFUA 1OXUA 3MHVC 1P5ZB 2VEDA 1SVKA 3BBPA 3QKTA 3OIWA 3RABA 2XZPA 3T61A 2VHCA 3QKRB 4AWXA 4C2UA 3R7WA 2QM7A 5JCZA 3VTKA 3UANA 4B2LA 4NYJQ 3SR0A 2F9LA 1QRAA 4CYMA 5TXGA 4U00A 3R7WB 2ZVPX 2BV3A 3I8XA 4YC7A 3K53A 5IHPA 1NJGA 1FUKA 3TRFA 1E4VA 3VKHA 3OZXA 1X3SA 1TF7A 4KU4A 3C41J 1DAKA 1KK1A 2H16A 1Z6TA 4I1OA 3ZZTA 2NOAA 1N5IA 1ZUHA 5JCPA 2HLDD 2JIZD 2VL7A 3U5ZB 4JLAA 4M53A 3NDBB 4GDFA 3D7MA 2W6JD 5KNDA 1NL3A 1Q1BA 3LVRE 3UMSA 4D82A 2QG6A 4QG7A 1OKKD 3U7HB 2C77A 1XFAA 4JLVA 2ZRGA 1D2MA 1W0JD 3CNOA 2QROA 2CK3A 1G19A 5FH9A 1P72A 4DXAA 2D7DA 5H1YA 1ZIPA 2V3CC 3DOFA 3FMFA 3CUEF 4PC2A 3RS2A 5KSZA 3FKQA 3T12A 4A36A 3ZVMA 3QKSA 1F2TA 1XTJA 2QP3A 4Q1EA 2IYTA 2ZJBA 4MYTA 5FI0B 4F91B 4L8GA 4ZI3A 4V0LA 3QKSB 1S3GA 3A1UA 3MFYA 1F2TB 5K8TA 4YLGA 1E79A 4Q18A 3X1DA 4D4KA 3HDTA 1VHLA 3KJGA 2XITA 3KXIA 1XB2A 1YQTA 1KY2A 5KO2A 4HLCA 3GLFA 4B71A 3CF6R 4DSTA 4QGHA 4PPNA 4DSNA 3EW9A 1VG9B 3GLFB 2A2ZA 3IHLA 1MRNA 1W5SA 1II8A 2GVDC 3B1VA 4JL8A 2YHSA 3DEFA 4MKFA 4A1FA 5FTNA 1E9DA 2MSEB 2GF9A 2YOFA 1YU9A 4LHXA 2P0EA 1II8B 2JJ8A 1LY1A 2A5JA 2EW1A 4NMMA 1ZD8A 1AKYA 2J45A 2ATXA 5JS8A 2VSOA 2RGBA 3ADCA 3I8SA 4TL8A 4TLEA 1AIPA 4AK9A 4YDSA 1OT3A 3DDCA 3P27A 1Z6XA 1KY3A 2K5UA 1SXJD 4A0RA 2ZSAA 1ODFA 4PC6A 3RHFA 5E7IA 3QY0A 5K8UA 5CITA 1E2JA 1CXZA 1E9BA 1DAEA 1UEIA 2BJWA 3W5IA 4ILEA 1OB5A 2HJGA 2O5VA 3FVQA 4G5RA 4DRZA 4RD2A 2VSXA 1ZNYA 1G17A 4PHGA 4TTPA 2WVJA 1IXZA 2XB4A 5TDHA 3KJIA 3X1ZA 2FWRA 4A8JC 1HE1C 4QJ4A 4R98A 2DY1A 3AGQA 2FNAA 2H5EA 1G7CA 3MMPA 4HAUA 4KLZA 1VMAA 4TLBA 3SE0A 1C9KA 3CRVA 3MWKA 4IDPA 4IHQA 3BB4A 1UKVY 1M2OB 2OCPA 4IOKA 2ODNA 1IN6A 1R0WA 4NYMQ 1EESA 2FFBA 2WWHA 1CULC 3GJ7A 1NRJB 3QEOA 2CNWD 2QRNA 3E2IA 4CGZA 3EZ6A 3WP0A 2IWHA 4I4LA 2NO9A 1EFTA 2Q9AA 1E0SA 1KK2A 3PUWA 4IOMA 5L3QA 4POAA 2NGRA 3MWLA 1XEWX 1Z08A 1XMSA 1E1RD 5L3QB 2IX3A 1O87A 1ANKA 2GF0A 3I72A 2FGJA 4C0LA 1N5JA 4IW3B 4LWZA 2V6IA 4L9WA 2R62A 1E9RA 3OEED 2LWIA 2N1BA 2CCGA 4XTCS 2ZAMA 5B30A 5EJEA 2ZTSA 2PZFA 2J0QA 1OJLA 3QI2A 4Q1CA 2QENA 1XEWY 2QUZA 3LLMA 1OHHD 3VAAA 2FFQA 4I1VA 4IDHA 2HJVA 2I4IA 5EE0A 4AYXA 1MR3F 1Z0JA 2PEZA 2BMFA 2DVWB 4UKDA 1NIPA 1P9RA 2DPXA 3W8NA 1K5DA 1FP6A 2KSQA 1YR7A 3B1YA 4PO9A 1M7BA 1OFHA 4DB4A 4FWIB 2Q3FA 3VR2A 5EXXA 1JPJA 4OK6A 4AY2A 2AKAB 2QSYA 4GOKA 4A6PA 4M9XA 1XTIA 3VR5A 1ESNA 1S3SA 4LDJA 1K5GA 3AVPA 1RE0A 3FGNA 4QBHA 1CU1A 1E0AA 3A1TA 4P4SB 2J0UB 2ANBA 2Z5FA 3IDQA 1RFLA 4OHWA 2AXNA 4DBLC 3AP3A 1A1VA 2F1IA 1VCNA 1CRQA 1B0UA 2R6DA 1JR3D 5GJWC 2ZR7A 4JJZA 4O25A 1E1QD 4KYUA 4CF7A 2D7CA 1W7AA 1R7RA 3MG9A 3MD0A 4D4LA 3DM9B 2IYQA 1S0UA 2JIZA 4JVMA 1T8TA 5A5GA 1G7TA 2W6JA 2UKDA 1I4TD 3X1YA 2P5SA 2JLXA 4OHVA 1VYUA 4A82A 2ZIAA 4NZYA 1KKMA 1S9HA 3WYGA 4TSFD 3FHCB 3EA0A 1GVNB 2WBLC 1G4AE 1X1RA 4U5XA 4DEXA 2G3YA 3RAPR 3BH7A 3AVYA 1G291 2YINC 4N3NA 1CR0A 2X2EA 4QL3A 2EFEB 4BLTA 2IS6A 1EX7A 1UKYA 4EFNA 1VG8A 1Q1QA 1DPFA 2FMXA 2VA8A 3S1AA 1YZUA 1Z63A 4PAMA 2I3BA 2DHRA 2F1JA 5F3WB 5A4JA 3FKSA 3TLXA 3C5HA 3EIQA 3S1AB 5LBIA 2A5GA 3P4XA 3TH5A 2XNSA 1P62B 2V4ZA 2RAPA 2GTPA 4DLVA 3E70C 3MWJA 1NMXA 1R10A 1W1WA 421PA 1SHKA 5J40A 3KJEA 1E2KA 2VQSA 5KSOA 3VNUA 2HT1A 2BKUA 5JWHA 3LA6A 3EIEA 1Z0AA 2XOKA 3PEUA 1E2EA 4Q47A 5JLJA 4IXNA 1CRPA 3IPYA 2GAAA 2OFWA 5CDFA 2V6ZM 5IK2D 1LF0A 2F7SA 3HR8A 2FX3A 4TTRA 2DBYA 1Q20A 2IEZA 3KB2A 1D8TA 1R8QA 1ZM2A 5EZ5A 1TQ4A 5AR1A 1KSFX 2W2VA 1FX0A 3K0SA 1F60A 3B8HA 3QG5A 3ZJYA 3EARA 1ZRHA 4CDGA 1Q22A 3GJ5A 5BXQC 2ZRLA 4B3XA 4U02A 1LW7A 2EQBA 4BEJA 2PMKA 4GMXA 1XNJA 1X8LA 1J2JA 2HF8A 3NC0C 3ZD7A 3AJIB 1DO0A 1G8HA 3KQNA 1P2UA 1E2LA 1P4SA 1KDPA 1E2NA 4N1AA 4PQYA 4EPRA 2QQ0A 2QE7D 4NCHA 5DI3A 3RWMB 1R4AA 1E2FA 2OT3B 1BOFA 4V03A 5DNYB 1N5LA 4QBIA 5DI3B 2VF7A 1HE8B 3LBIA 3EZFA 1TEXA 3A4MA 3AEZA 4LYFA 4TYNA 3BJIC 1T5IA 4CEJB 4PFSA 5DO9A 1E9FA 3DOEA 5IRCD 2ZQ5A 1GL6A 3IBGA 5KHOC 4D0GA 3GJ3A 3CW2A 4MA4A 1AS2A 2DFTA 1QVAA 3U7GA 1LVGA 2GXUA 2CNWA 4K81B 4WXRA 5F9HA 1GKUB 4MDEA 1XF9A 3WP1B 2XXAA 1G9XA 2GJKA 2JASA 4M9SA 4OI2A 1NF3A 5CB8A 2ZU6A 3GLIE 1SKYB 2G1JA 4M1TA 4Q1AA 1AGPA 2XXAB 1KNXA 5JEDA 3ASZA 4DSUA 5AK0A 1T0HB 3SHWA 3AH8A 2RGXA 1RKBA 4Z1MD 2D2FA 1KHTA 5AUQA 4XWOA 5TMPA 4IRUB 4AURA 5K8LA 3U7FB 4KVGA 1TU3A 1IXRC 3L8ZA 4MRNA 4A0GA 1ZMXA 4PC3A 3CONA 5TV2A 1KNQA 2YKGA 2VHQA 4JJKA 2EWWA 1DTSA 2CBZA 4QHTA 1FMJA 3AVVA 2CDNA 2OFOA 1KSGA 2ONKA 2RCNA 1DBSA 3P20A 3VU9A 2QAJA 2BM0A 2V9PA 1TEVA 2WWYA 2HCBA 1S96A 2NPIA 4G1UC 1W44A 1VDZA 1PV4A 3QPWA 4A15A 2GBLA 3VU9B 1AQYA 3N5CA 5AJWA 3KKNA 3PV0A 4A6XA 2WAYA 1V5WA 4PZYA 4M4SA 4Q7MB 5EP4A 1AKEA 4GFDA 4Q02A 5E4FA 2GAOA 3H4MA 3UMRA 4PZLA 3RNLA 2B8TA 1NNEA 2CVFA 2IYZA 4DCNA 2EWVA 3ND8A 3U3RA 1D5CA 2JDIA 5G40A 3UIEA 4EJSA 2O52A 3HU1A 3W8RA 2ZROA 1KAGA 5JSZA 2WV9A 1CIPA 4I1UA 4QBGB 2OCYC 3QEJA 4RFVA 4EJSB 1KI6A 2O0KA 4WZAE 2J9RA 4MITA 2DR3A 3K0CC 1IJEA 5TB5A 5JSZB 5TVKA 2E87A 2YOHA 2WICA 5B57C 2ODEA 2GEDA 3SN6A 3ZQJA 3VLFB 4MQBA 3MJRA 4OK3A 2ZAOA 3BRWD 3EZ9A 3TUJC 1JB1A 3GLGE 2IK8A 4ZKDA 4R2HA 4OQXA 3HU2A 3L8YA 4A2WA 1U94A 2EFHB 4XWAA 1G8PA 2BBSA 4B43A 3KKPA 5H68A 1W36C 2MMCA 3RVBA 3CF2A 2DCUA 1GOTA 3BD9A 1JALA 4B76A 5JJKA 2A30A 4XSGA 4DVGA 3TGPA 4M2LA 1Z6YA 4DLRA 3L2OB 5DHFA 1JNYA 3IPXA 3SHFA 1NJFA 1XMVA 1YZTA 2HYIC 2C78A 4DWJA 4PPGA 3SJBA 4LJ7A 2WSSD 1SVOA 1XCMA 4Q9HA 2XGJA 3PUXA 2Q6TA 5HPYB 5EE1A 4BASA 3R8FA 1E2HA 2ONJA 1OXSC 2XSZD 4QM6A 4JBWA 2C8VA 2ZE5A 4RD1A 3FMIA 2XJ4A 2ZJ5A 1G3MA 5K8IA 2R44A 3KXLA 4KSBA 2OEPA 3JZMA 2LCFA 4NCJA 1OIXA 4NYIQ 2AXPA 4HLUC 3LRPA 1UKZA 4OJQA 5FPTA 4JLNA 3A1VA 4JS0A 5B2ZA 2P6UA 4JT2A 2ZJ2A 4GNKA 5FR2A 4GI7A 4RZ2A 1GKYA 1U9IC 2QBYA 4DEYA 3EC1A 4PZZA 3WRYC 4QGGA 2AK2A 3X1WA 4I1SA 1FP7A 3UATA 2XB2A 5IK2A 1NP6A 2ASEA 3ICEA 4H1UA 5JBQA 3LX8A 1OV4A 4JKIA 2QBYB 3AVOA 2AN9A 1FZQA 1H8EA 4PC1A 1EX6A 1FPMA 1N6RA 4PTLA 4EPVA 3AF3A 1IY1A 4FD2A 4FW9A 3T06B 4CT4B 3K70C 2ZM5A 3KFXA 4GITA 4BZQA 1AM4D 5JEEA 4TL6A 3N70A 1GKIA 4URWR 4BRWA 5G41A 3CWQA 2ZXUA 1KI3A 2H1LA 1EWRA 2WKPA 4LC0A 5CJ2A 5CB6A 4BGDA 2PX0A 4TYYA 3BAFA 1NN5A 4NYJR 3KQKA 4MYHA 1US8A 8OHMA 1SGWA 4BFYA 2CVHA 2QE7A 2VYFA 3BORA 2LKCA 1L4UA 2CHQA 2ZYVX 3EA5A 3MGCA 2YWGA 3LDAA 4LYJA 4F4CA 2FGKA 5EE5B 2RHMA 521PA 1DADA 3OIUA 1SZPA 3DVLA 1EFRA 3SZRA 4MUAA 1N0UA 3BE4A 3T35A 1A82A 3KB1A 2IF2A 1N6OA 4BQSA 3W5JA 4KO8A 4OI4A 1CEEA 1XTKA 2QEQA 4JKYA 5F2EA 2X8AA 4IVPA 4LJ5A 4YXWD 1DAMA 3KQUA 5CYOA 3SBEA 1XMJA 2PEYA 3QENA 3EIHA 4E5UA 2ZSEA 2IA5A 4LYHA 1E99A 3U61B 5DSZA 3N2IA 1DE0A 3AP1A 3Q9LA 3SC3A 3GLHE
chains in the Genus database with same CATH superfamily
2JA1A 3KAQA 3RBVA 2CVQA 2Z5VA 4DG8A 5LXTF 4MGIE 2FMKA 1Z4MA 2WKWA 4TYMA 3HWX1 5D7NA 3G9QA 4EF6A 4NU8X 3CLTD 2CXOA 3TTTA 2Q6KA 4PV7A 3UFXA 1GAQA 2QNJA 1SY7A 1GAJA 5JMTA 2DRIA 2HMWA 3KK0A 3K9CA 4QU5A 1WR1B 4WJZA 4GUAA 3JAMA 3Q3JB 4HL6A 5BW5A 1Y5IA 3WAJA 1JL3A 4ZCIA 3CF0A 4YRIA 1P7CA 4QGAA 4AJIA 3G0GA 1QHNA 3IAEA 3Q2IA 2CKDA 2P4HX 3D6HA 1CDDA 3T3EA 1GN9A 3QXJA 5COAA 2ZUDA 4P53A 1QFYA 2O9JA 2YQ4A 2QB5A 4JR2A 2DMRA 1JDSA 2OCAA 4FYVA 4HNSA 1X1TA 3U37A 4AJHA 3HHXA 1R0SA 3AR7A 1Q39A 1ULBA 1KQFA 5K6AC 2LNDA 3JD4A 1JEAA 3RTDA 3TGWA 4ZXPA 2A1TS 3DO6A 2WTEA 1T1GA 1TYBE 4HNTA 2BM9A 2A9RA 3C3PA 4P31A 3UJ6A 1YULA 1CFZA 5FYDA 3ZC7B 2AMJA 2QMHA 3BWDD 4AECA 3K72B 1JDTA 2JGNA 4OHRA 3HXMA 2RJNA 1XJ0A 2G0TA 4ZMBA 4CHGA 4FKMA 3HXQA 4ZIRA 3INYA 4C0BA 1HTWA 1E3QA 3RADC 5IJ9A 2VDVE 1T5TA 3LUFA 3RC3A 2PCLA 5C1IA 1W75A 4FYJA 4HWPA 3VA7A 4NONA 2FH5B 1YHNA 1VYVA 3AERB 4HBZA 4JBLA 2VTEA 4RVDA 4E14A 2ZYUX 4CLRA 2ZJ4A 4I1PA 1WBDA 2QZSA 3KE9A 4ATNA 4YRLA 1XX6A 3F5FA 1Q50A 1E60A 2HLHA 3ZWXA 2QMOA 4FS8A 4DCSA 1M2GA 4D81A 1T0UA 3SLRA 4NBSA 3G0BA 4UZSA 5H4HA 3WWPA 1X6VA 4IFBA 2VJDA 1KDTA 4B3BA 3WBBA 4RQAA 1J7JA 3EE6A 3FWNA 4G36A 5JC8A 2X22A 1GQSA 5FPQA 4RIIA 5FL7D 1HFJA 2Z3XA 4GBMA 1DKPA 1GZ6A 2XODA 1BMTA 2JGDB 4H59A 4PNPA 4HDMA 3F3SA 4BN4A 4IY1A 2D7HA 5CLFA 1YIAA 5L45A 4P6VF 2PYIA 2A0WA 3TR5A 4DCOA 1N3BA 2J5BA 2F48A 2FDXA 4Y7DA 3PK0A 3O2NA 4L6CA 4QUKA 2GPWA 3PE4A 1LH0A 3KPJA 1KJIA 3QU9A 3RFFA 3UYKA 2PUWA 4Q15A 2O8DB 4LJYA 2GPYA 2AJDA 4A92A 4BO1A 5JVDB 2V7QD 2G82A 1YBFA 4J1NA 4IS2A 1SHLA 4YYEA 5KQLA 2I4RA 3KHUA 1QE0A 3IP1A 1X2EA 3EVNA 1QHEA 3AY0A 2EZ4A 3DEKA 5AI6A 1TCVA 1R9GA 5DGTA 1UMBB 2Q2QA 4ME6A 4H1TA 4Q9AA 1C4KA 2IUUA 1YDMA 4A0FA 4EKYA 4V2IA 4ARAA 2H57A 2QRKA 4NU5A 5IT5A 5CA1B 4B7ZA 1H2YA 4OUDA 3GMSA 4I5EA 3WMXA 3PHBE 4EHJA 3TAXA 2GTIA 4D8XA 2R6FA 1T25A 1OH5A 4HNRA 2O8EA 5T7BA 3PGJA 4DT1B 1LI4A 2Q4EA 4JJ8A 1JG2A 4GLFA 1ZMUA 3V8EA 1FCJA 3M6XA 4MGIR 4OP1A 3D1LA 4ITVA 3QYAA 5AIBA 2ZYSA 1U2PA 4QDOA 4JVNA 1CJUC 1V6SA 2C82A 3V7UA 3ZE1B 1A9YA 4G4SP 1NW4A 4C9BA 4EBFA 2OBNA 2IZ6A 4ZT2A 3KEMA 4E1BA 4JI3M 3LSTA 4P3XA 2E1RA 4DB2A 3DVRX 3PEYA 3N0RA 5A9TA 4GP7A 4C5CA 5JNSA 2QU8A 1U8AA 4YP1A 1WBJB 2FW0A 4ZEVA 5CRIA 1T2EA 2JHGA 1L2DA 1JQKA 3PRKE 3GVHA 1ZW1A 2QN8A 1OXKB 2JLRA 3GUVA 4RTPA 4QBTA 1JUDA 3BFKA 4S0XA 4CLXA 2FCRA 1IQUA 1GZ3A 1AO3A 1JXOA 1PFGA 3AXTA 3IG5A 1GGJA 2CP8A 4HTFA 1CYDA 4PSCA 2XA9A 3C6MA 1Y7LA 3LBHA 1H2RS 3PC2A 5C3UA 4ARIA 3A7EA 3CCFA 2C1ZA 3B5IA 3C5WP 1I7QB 2O7QA 2ATEA 1V1MB 1E32A 2D54A 1DCKA 2QMEA 3C5CA 4P08A 1EB8A 2HJHA 5D3MB 1C7YA 1B6GA 4PSVA 5JT1A 3E1KA 4Z54A 4HLQA 1IZ9A 3KCQA 2OO5C 3O38A 1JECA 4FZVA 3NORA 4RIEA 3KOWA 3I4LA 3X1MA 3LPNA 1ISMA 2IDKA 3PNYA 1YR9A 4GOOD 3KOUA 1CBUA 4Z7NB 5AOVA 5LQJA 4P9NA 3DBHB 4BNMA 3TE6A 3LUPA 1FP4A 4HQFA 3EUFA 2XWSA 4QXRA 3MM4A 3UK6A 1ULZA 4L8WB 3CUVA 5DMHA 4HS4A 3RE8A 3ZXIA 1J4AA 3J80S 1YS4A 2IRWA 1V96A 1DX9A 3JWGA 3TXXA 4CFZA 5LQUA 3FCCA 4EPXA 3BEOA 4CDNA 3TTYA 5DM4A 1IK4A 5TJ9A 2UUAB 3OPXA 3H5LA 3PFFA 2V4MA 3B3AA 2GBIA 3IUJA 3TBFA 2FMIA 2QVGA 1W59A 2KW5A 2QD5A 2GAJA 3GZ4A 4X8HA 5DBOA 4FJ1A 3KVRA 2JAPA 2EP8A 3AIKA 2W4QA 1E66A 3DEZA 3KSXA 2YN0A 3KSBC 2EZ9A 5AUOB 3IEUA 3DLHA 1YB6A 4BB5A 1UZMA 3CRZA 1X37A 4MAAA 1IEXA 1QGZA 5K2MA 1GA1A 4MQ4A 5GONB 3RWBA 3ZDFA 1KF0A 1VSVA 3KDSE 4F6RB 1NDUA 3KQTA 3IIMA 3EXHC 3HXOA 1U7UA 3CY6A 3ZZNA 5AVSA 4XR9A 3NDRA 3AU8A 5EINA 4W5TA 3EPKA 2MJLA 4XFJA 3W78A 4JEIA 3SF0A 1RQGA 1M8FA 3TWMA 1KEUA 5IVHA 1N5OX 4ZCLA 3HLTA 3DV2A 3PDCA 5AVUA 4AYWA 3CKKA 4IIEA 3SASA 3IAM1 4Y2PA 3THXB 1I32A 1GPWB 1MD9A 5DV9A 1FJXA 2OYSA 1YWGO 2WMOB 1XTSA 5HRCA 3HCFA 4DUPA 1JT2A 1LGYA 1PNTA 3DDHA 1OIVA 2MWMA 3PL5A 1FDUA 4NBUA 3F5DA 3D5EA 4PX2A 2DU8A 1XD8A 4MKRA 3R4VA 1A5BB 4EGCB 5F78A 5GIPE 4QDUA 1YVDA 4A8TA 1AUOA 1V8FA 1RC0A 1WHTB 3EVDA 4IBBA 5CEFA 3A58B 1KZGB 1P75A 1A9TA 1FRNA 3PA6A 5FFNA 4GL2A 1DKRA 1U7WA 3N87A 4UTNA 4OP2A 1A8QA 4LV5B 3VZBA 2QTGA 1PHRA 4IWNA 1H65A 1JXQA 4RFSA 4TL7A 1ZQ9A 4D6PA 3OPYI 3SVTA 2FI1A 2WJYA 4YDRA 4W99A 1FLNA 2JZNA 2EA0A 3AB7A 2AOTA 4AZ0B 1QHHB 4U7GA 2ZYIA 3L28A 1JDJA 1FFDA 2PS0A 2G6BA 2Z7JA 3EAQA 4RQUA 4K8OA 4N9QA 1ISJA 3KOOA 4JBHA 3OQPA 3KC2A 4B1FA 2VBCA 3I3OA 3OX3A 1KO7A 2I6SA 1I1HA 1N32B 2PZLA 1JAYA 4YCAA 5DFLA 3DPUA 2ATVA 2JIMA 3EUWA 4WZAA 2VNHA 4D8TA 2FPOA 1M1ZA 1M6YA 3GO8A 4I99A 3C6QA 3O92A 1N5KA 1DUVG 1DMSA 1RAHA 5AVTA 2R60A 3Q7SA 4WOBA 3PT5A 1JEYB 3HJBA 3OUTA 2ECKA 2VA9A 3VX3A 4D3DA 1A95A 4N8DA 2WAXA 2BH2A 4CV3A 1U81A 1K0UA 4JI2B 4EW2A 1LPOA 1Q12A 4AAYA 1JJFA 4CDRA 4EPWA 3CB4A 2JIDA 3E53A 2WP0A 1Z7GA 3ZUGA 3R3VA 3STUA 3Q4GA 1Y7IA 1IXYA 1R5BA 2BGNA 3KPWA 4O4IA 3G6KA 1P73A 4LRSB 1KJYA 3TKLA 3AUSA 1TT5B 4YJKA 4CODB 1NLYA 1N7HA 2WSBA 4HAZA 1Q0UA 1NZFA 2G09A 4EQ6A 1H0KA 2HK6A 3E46A 4JD5A 3GARA 3KZXA 1I24A 2PQ6A 5KYUA 1P1FA 4Z49A 1D1QA 2WJAA 3R9WA 4AJ2A 4EDHA 4OX9M 4RTQA 3OJOA 3MELA 2IL1A 4LZJA 4WCVA 2RC6A 5KWJA 5CK4A 3B7ZA 3KZ1E 1GWNA 4KQWA 5T57A 1YZGA 1PX0A 2G1KA 1O5OA 4M1QA 5ARCA 4Q9KA 3ZDRA 2IV2X 3BSYA 1P80A 1CIVA 4BQRA 4JB8A 4MO9A 4OJNA 1ZR2A 4Q4HB 1G0NA 1LEHA 4DMHA 3S6JA 3KAPA 2WE7A 4ZDKA 3NHYA 4HCJA 5F12A 1OAIA 3VPGA 1USKA 5J1SB 1PE0A 4UHKA 3K6SB 3ABZA 1NQWA 4D0LB 3WK4A 4JAVC 4FIDA 4AN1A 4RZQA 3ZC3A 2BFMA 3NHFA 2A78A 1O9GA 4BO7A 5A5FA 4KE6A 5BWNA 2XGMA 4JN6A 1A7JA 4DA9A 4TZTA 4H4DA 4C22A 3LC1O 4B74A 4BBAA 2GF2A 2W2KB 1C41A 4JLJA 4RF5A 1SVKA 2O23A 3RT9A 3OWXA 4HEA1 3GGCA 4JKOA 1ORRA 1QRAA 5IASA 3UA4A 1ATIA 5TXGA 2HMSA 1PJ4A 1DRVA 1GNLA 1Y5MA 5HDQA 2I34A 4GM0A 2JIZD 3WAGA 4LGCA 4CGYB 4INAA 4F21A 1XZ8A 2C77A 1ZKDA 1NBIA 4CG0A 4JI5M 2QROA 2KXEA 5FH9A 4LF7B 2POQX 3QW4B 4B82A 4G1FA 1GZ7A 3MTDA 3ZVMA 1U1GA 1UEXC 4ZI3A 1BVRA 4EUFA 2QMZA 4MW6A 1BROA 1JLMA 3I9V1 4B71A 1LI7A 4KH1A 3L18A 1W5SA 5LP6F 3NV7A 4CG3A 4Z7OB 5FWYA 3FPBA 3JTMA 4HP8A 1ZD8A 4INJA 4WGGA 1FRFS 1CB0A 1B0PA 3H19A 2O6HA 3UHOA 5K8UA 1L5SA 4LFBM 5CITA 1E9BA 2JLCA 4YJ2F 1YB7A 5B5SA 3FVQA 1NTRA 4LMAA 2VBGA 3C3WA 3K73O 2DP4E 3GFVA 1JU4A 2IDZA 1FSPA 2E2WA 4OO3A 3ZDEA 3E2IA 4POAA 2NGRA 1XEWX 1Z08A 1EX1A 2FGJA 5JIBA 1I7NA 3OEED 5T5QA 1JDVA 1Q11A 2J0QA 2PZFA 3F71A 3F4LA 3MB5A 5AD1A 1OHHD 3JPWA 5ALTA 3L8CA 3E61A 2RD2A 3E4RA 2Q3FA 2M32A 3PC6A 1LX6A 3HB0A 4JP1A 4GAEA 3KZNA 4R8SA 5C8YA 3PR3A 3MD0A 3PP8A 3HVJA 2GHTA 2JFBA 2EP5A 3GRYA 1GVNB 2Q4DA 1H3NA 1AKRA 4ZICA 2VRCD 4JH0A 1Q1QA 1WIVA 2Q3JA 8CATA 3MFQA 5NULA 1M10A 3TLXA 2ILVA 5LBIA 2X42A 1LNQA 1HRDA 1SHKA 4D9NA 2BYTA 1TRKA 4FPXA 4MB0A 1E5VA 3IPYA 2H1FA 3OM0A 3KB2A 4LQDA 4O4HB 4DJ5X 3ZE6A 3GJTA 5C34B 1Q22A 3PI7A 1YUBA 2HF8A 1E2NA 4EG5A 1Y5RA 1Y9EA 2OT3B 4KMOA 1DRUA 5BV1A 1DIRA 3G2LA 4CV1A 4TYNA 1XHBA 4G09A 1LDMA 1UM9B 3QAUA 1QVAA 5B7PA 1KMIY 2JY8A 2FS1A 2JASA 4OI2A 5CLJA 5CB8A 2UYCA 1HKHA 2JGAA 3FIJA 2PXCA 3BMOA 4BX2A 2HIMA 2CC2A 4G4JA 1TU3A 1GKLA 3PQEA 4DYHA 5IJZA 3A26A 3T1NA 1P7PA 3VDMA 2H0AA 1NFQA 3R3JA 1CHNA 4ENUA 1E7RA 3EGDB 4A15A 4M37A 4K6GA 2WIJA 4Z4CA 2LHCA 5EP4A 1AKEA 3U4IA 2PRZA 2A9OA 4ZQCB 3X3HA 4EF4A 2Y0EA 2O5EA 2G40A 4B8YA 4MGEA 4BVAA 5I3ZA 4QBGB 1NYLA 1K66A 1VZ3A 1M72A 1E6WA 5AW6A 3V1KA 4MQFB 5ERGB 5EMMA 3PHLA 3TUJC 3HDQA 1SPBS 3L8YA 3KP1E 3CF2A 2I1WA 1YQEA 2PV7A 4EGJA 4M7PA 3AY3A 4M2LA 3DMGA 3SHFA 1CHDA 3QWLA 2PVPA 1SU8A 2VTVA 4GBJA 3SDBA 3SBJA 4JBWA 4RD1A 2FQYA 2QV7A 3TL4X 1UKZA 3NONA 5AKZA 1V9LA 5B2ZA 2P6UA 4W8HA 4GOND 4HDSA 1GKYA 1U9IC 1V8BA 4QGGA 2ZIEA 2ASEA 2QBYB 2F3QA 1FPMA 2GYWA 4EITA 5EWMB 4X85A 1AQJA 4XPZA 3IA7A 2WRZA 2W37A 4OM7A 3BAFA 3SIRA 2AEJA 1GPYA 1AA6A 5GOZA 1BU8A 2RHMA 2QVXX 5E2BA 1N0UA 4DR7B 5ICMA 2QEQA 4Q3EA 3CVUA 2X8AA 1M2JA 1PX2A 1XELA 5TMDA 3FGPA 3OFKA 5A4IS 4ERNA 3IO5A 4CL0A 2R6ZA 3GRKA 1JLRA 2XTAA 5LDDC 1J0DA 4MKZA 4YECA 4YRJA 3QFTA 1T9GR 1R64A 4DR3B 2R2AA 2HGSA 2DTEA 4X93A 3OX4A 4V1CB 1F1JA 4UZEA 1AS3A 4QXMA 3UA3A 1PGYA 1IUNA 3Q12A 3KB8A 4ZVPA 2P9YA 4FKZA 5GGYA 4Y2QA 5KQSA 5FAKA 4P58A 5K8CA 3UVEA 2JNWA 3GOQA 1P2BA 3E7WA 1RLUA 3SKVA 3HYSA 3JAKA 1IXSA 4UUNA 5CEJA 4QAQA 2L7IA 2WJWA 5I4KA 3B78A 2WKRA 3PX7A 4UNRA 3Q87B 4NV1A 3RG8A 3QVGB 3VPFA 1PR9A 2BMAA 1J8VA 4KO3S 2ZU0C 1U7OA 4GVLA 1M6VB 1VLQA 5AK6A 4BMOB 2R25B 1IQPA 5GIOE 2ZDQA 2VK4A 3GFBA 2GN9A 1KSJA 1K8YB 3HHEA 2ZT8A 3L7LA 3QLUC 1SD2A 3KS8A 1Y0BA 3LD9A 2O5CA 4OBBA 4MGZE 3IPLA 5LLDA 5FFMA 3OOEA 4HQKA 1UKBA 3CV3A 1NVTA 1VPDA 1RQ7A 1FU4A 3E58A 2D5IA 3MS7A 1WO8A 1GTSA 3P52A 1J25A 5DGCA 1UIMA 5ALXA 1F6DA 3K15A 1AU9A 4ZYYA 3D0RA 1HQCA 2LKDA 4KQMA 4GVPA 4IDBA 4PAQA 4Y8VA 3ESDA 1RBZA 1Y8GA 1PNRA 1AHHA 3UB4A 3HCBA 4ARZB 2ZBEA 3L1JA 1IBMB 3UCEA 3KTFA 1KTVA 1NMZA 5JZMA 1XMQB 3GDGA 3PXEA 4L4SA 3GJ0A 4HWRA 1VDMA 1TH3A 2GCPA 4MWSA 1CR4A 4R54A 1F0KA 5CNIA 4PQRA 2O3RA 2YN2A 5F23A 3PRHA 1V7ZA 4YCSA 1VJ1A 1PLLA 4P4SA 1ZC3A 3R8XA 3UGKA 3ASYA 5IC6A 3F7MA 5ALMA 1ZJ5A 3CLSD 1ZAKA 3OT1A 1N7GA 4C4TA 5EJ7A 3O8OB 3VPHA 3WGIA 1JQJC 1WKVA 2ORVA 1GIAA 2Z43A 3RHSA 1CD5A 1IOVA 1OKKA 4BIMA 1K75A 2V45A 1CUKA 2QM3A 2DE0X 5HIKA 2X9GA 4PD2A 4DR2M 2YNMD 3A05A 4JI0M 2O2YA 1RHMA 4Q1BA 1T6BY 1DGFA 1DC5A 5DHUA 2AG1A 2OESA 3DCIA 2FJUA 2BCEA 2O48X 1YQUA 2X3UA 5AH0A 3DBRB 5I9TA 1Q19A 1GDDA 3BMCA 1E5QA 2IV7A 4GQAA 5LSAA 5L53A 1J8YF 1Z0DA 5ES3A 4EHAA 1GUZA 1N3LA 4UUPA 4WKGA 3IOYA 4YJ3B 3P0EA 4WXHA 2KEBA 2EYQA 4Y7CA 2OCBA 3L41A 2IHZA 4L9AA 4LC1A 1JIJA 1THZA 1N33M 5BPVA 3W2FA 3B82A 2YV5A 1P45A 4UQOA 3M7IA 2GASA 3LXRA 3VR3A 3LQQA 3WISA 5T8KA 3NDPA 4ZVVA 1KI4A 4DV3B 1WMDA 5H0IA 3PNSA 4Q01A 5AW9A 5I6DA 9GPBA 3FIUA 4YJGA 2V7TA 3HR4A 1Z0SA 2DUJA 5BV0A 5EE3A 2OCXA 2QJWA 5KJCA 1DAPA 3RYIB 3RRFA 3P9KA 3I9KA 2XQIA 3K0EA 3E27A 2X4AA 1DB3A 4DCMA 1Z4PX 5J5VA 4L5AA 3L05A 1PR0A 2H2IA 4S1TA 1EKXA 2BGJA 3DPIA 1E9AA 2F1HA 4TSFA 3S2FA 2PWZA 3JQAB 1NUQA 4FYMA 1K3XA 4BQQA 3AWIA 5CVEA 2PZKA 2BKEA 1KC3A 3PFNA 3I28A 2WT8A 4RD3A 4KAJA 3DEIA 1A4XA 1TMKA 3N9IA 3MJTA 3R5TA 3OZRA 1WABA 2P4SA 4FOTA 2Q4RA 1W25A 1JMVA 5L7YA 4AMGA 2XWPA 5EZYB 3NH6A 5IAOA 2QW6A 2V9CA 2XZUA 2HA2A 4ESEA 4CIBA 2XYPA 3A9UA 1MT0A 4QGFA 4FOPA 2C3OA 1EVEA 5B1SA 4OMUA 4RY8A 3I1YA 3DKKA 4DUZB 3PQCA 4BLPA 1T4GA 5TLSA 3F3MA 1V41E 1HURA 4ALIA 3SU8A 3OUUA 1Q0PA 1QGDA 1QQBA 3SYTA 1OLOA 1FY2A 2C96A 1CS0B 1QRRA 1SBQA 3JQ9A 1HO3A 1MOPA 3PPXA 1T4CB 4Z3DA 4B3JA 3T5DA 4IH1A 3EDQA 2PMWB 3SLKA 2MIIA 3R7FA 2WWVD 1ZISA 3BGOS 4X91A 2WSLA 1OBCA 3KHKA 4QXQA 3V32A 3D6FA 4LFAB 3B12A 2GAFA 1DBRA 5JNWA 1ZJ6A 2J3HA 2PTHA 1K89A 2RC5A 5EIOA 5CM8B 2VP4A 4QT4A 2QA5A 5JFGA 1KAQA 4YV2A 3RRZA 1T2VA 1IBRA 4IIHA 2D8MA 5ITYA 3T54A 3WLHA 4LXYA 4BE4A 3F0TA 2QT1A 2Z9CA 3ELDA 3HP4A 1TCUA 4IJKA 2DWZB 1DIBA 1DG3A 1U0LA 4O1IA 3DE6X 2Y2UA 4I55A 3KSUA 4IGKA 2AW3A 4G3OA 1H1LA 1L1QA 3H5VA 2VJQA 4EVQA 2B35A 5TF0A 2VPZA 2BSXA 4HWKA 3DD1A 1KPIA 1MCZA 3NYWA 2KJQA 4IS3A 4FVTA 4IG9A 4Z2YA 2VT3A 4I2NA 3H1EA 4RDXA 4OQLA 2O8CA 2QR2A 1YS1X 2JJ1A 2QVCA 1A9QA 4AMZA 5FEMA 4F8YA 5MFPA 4IINA 2IXGA 5IWAM 2C2BA 2JP7A 4C6TB 1UXJA 3CUTA 3HWSA 2PO5A 1EUZA 3S3TA 4ZV9A 4CRWB 5A9SA 3KTAA 2DR2A 3OLZA 4HB3A 3SQDA 4QUDA 1TKBA 2XOKD 1GNQA 3EDOA 4X7MA 3CCCA 1B23P 4RFLA 4OQ4A 5TPWA 4DV2B 3K1YA 4NOOB 4PQFA 2MTBA 1P19A 1UEJA 3GFPA 4O1MA 3LC2O 1NY5A 2P9ZA 4WGFA 1XALA 3ME5A 3D4BA 1KBOA 2WD7A 5EUQB 4JENA 5JNVA 5H3CA 2ZJZA 1CUGA 1XRNA 3P32A 2N9UA 2N47A 1B00A 1M2KA 3QI7A 4CF5A 3CR8A 4CM4B 3EUAA 2B4RO 4KL8S 4IMIB 3TLMA 2G6TA 2MU1A 2MR6A 2V6GA 2A9PA 2VP3A 2CZQA 2J3MA 2QX7A 3B2EA 3HTXA 1A0OA 4TTSA 3PIIA 2D00A 3NC1C 1WU7A 3GP5A 2XRYA 2ZJ7A 5AYVA 4DAOA 4WZZA 2CNLA 1R6VA 1BVYF 1AHNA 3GELA 3PPVA 4RLSA 2QT9A 4IAOA 1U5BB 4OHKA 1QDLB 4LRWA 2NTEA 3K1AB 3WXMA 3BDAA 3ETCA 1IM8A 3BRCA 3NALA 3NS7A 1PSWA 3C4QA 4RL6A 3U6DA 3HYLA 3R1IA 3QUSA 3D3WB 4JP5A 4YRZA 3R23A 1YAHA 2FFHA 4X65B 4RHYA 1PUXA 3WZLA 3A3OA 4JXZA 2BFPA 4L50A 4M8SA 2HPZA 4C4XA 1FS4A 3AWDA 2KBFA 2YZ7A 1H9CA 5F4ZA 4OJKA 3PSHA 2B1QA 2GPBA 1SCUB 5CM2Z 1UQRA 2PVSA 2AR7A 5JDIC 2SKEA 4R0NA 2PIAA 4OYYA 1WHCA 2O06A 3DEHA 2QP9X 3T95A 5J59A 5DCLA 2OG1A 4TKLA 1DELA 1JHZA 2HPVA 4Q7EA 1QVVA 1ONOA 3LW7A 1DEKA 1GPBA 2RGNC 3ZBTA 3OP1A 5DHRA 4CMKA 3NKVA 3QMVA 3LT5A 1S8OA 1X7ZA 2ZIXA 2HC9A 3G0DA 4QSHA 4Z9XA 1NZDA 3NHAA 4RXTA 3EQ7A 5IARA 4PNZA 1WXWA 3C8HA 1VMEA 1C1XA 3CFYA 3F8WA 1V6CA 4QFDA 4LNAA 1N34B 3LTEA 2CDAA 2H4JA 3GR6A 2JBHA 2HMAA 3OOYA 4DR6M 4P84A 4O3MA 3LOUA 1M73E 2XBUA 4DSZA 4TV9B 2G28A 2OBYA 2JARA 3U7EB 3AR4A 2XVZA 5AJXA 4BKRA 1RPNA 3SY8A 2JFPA 2FN7A 3NUGA 2QU7A 3SQLA 2XUHA 5TJHA 3FYDA 3TQRA 3AX6A 3B9QA 4MM3B 3UHAA 1G16A 5FTLA 1OY1A 2R1ZA 3WWZA 3KFUG 4H60A 2EX1A 4KOEC 5EFZA 1TIKA 2J5XA 4E2YA 1OI2A 2WWTA 2XEPA 4IV5A 5DBFA 2I1VB 2VNJA 2WE8A 2YYYA 3UHPA 1RLTA 1MW8X 4HGNA 3VR0A 3DDUA 2QNBA 4I3FA 1QO0D 1WB4A 5ITTA 2B99A 1QHFA 3COZA 4Z3OA 1P31A 4RJLA 3RV4A 4FS3A 2I5PO 1N8KA 1CZHA 2REXB 1COWD 1E9SA 2UZ1B 1GITA 5FTKA 2FXIA 3JQRA 1OW3B 1P4GA 1DKLA 1DFGA 4UVIA 3SX4A 4M1MA 4KODA 1GPKA 5BSHA 4NJEB 3WA7A 2IOQA 3H05A 3NZEA 4X95A 2CYBA 2DC1A 1BEEA 1Y8RB 3SBDA 1VEKA 2J3EA 3RS4A 3AFNA 1CV2A 3KHTA 3RNOA 3GA5A 2W71A 2YHIA 4B47A 4BLOA 1I6KA 2PUTA 4TUYB 4LNUB 2UAGA 1ID8A 4UCQA 1P60A 3GT4A 3C39A 2Q7DA 5BQFA 3HDJA 1T3LA 2HDOA 1E6KA 7REQB 1UDCA 1D2CA 3AF1A 5CFOA 5A6SA 3OZDA 1JDPA 3KXKA 3SF8A 1V45E 4PNHA 4UEKA 1FXUA 2P67A 2VAMA 4PLFA 2QD3A 2CMDA 9ATCA 1Q5PA 3THYA 2VP2A 3H9BA 3UAXA 4MS1A 1TVKB 1OYYA 2J5QA 3G23A 4PO1A 4B33A 5AKGA 1PSDA 3QKTA 3RABA 1NU8A 2D7GA 3F96A 1KC1A 3PHJA 1O1YA 3VTKA 2PT6A 5CA1F 4KB5A 5DIZA 2HCFA 4C20A 4BWGA 2J31A 3HUTA 1ORIA 1PR2A 1DRKA 1M8GA 2TMDA 5FP0A 3ZZTA 1VP3A 1Q7GA 3PA8A 4BAZA 1QOZA 4U1RA 4BVBA 2ZM6M 4Q3DA 4UULA 1GCUA 5IM4A 1I1QB 2IH4A 2RAUA 5H1YA 4RJTA 2UVPA 4PC2A 5DDIP 3BCHA 3WAKA 5K0CA 5JYEA 1VHLA 1YQTA 3OT4A 3MS4A 4YMHA 2BR5A 1OPRA 5K3AA 1EHYA 2FP4B 1II8B 2JJ8A 1Y4SA 1GVHA 3FFWA 4XM1A 4GWKA 2RGBA 3P19A 2GD0A 1J6UA 4X61A 4MOWA 2H1RA 1OT3A 3ZK8A 2O7RA 3NTVA 3FF1A 2IP2A 4YGXB 2O5VA 3OJLA 1MFPA 4ZYVA 1ZNYA 3LY7A 4PHGA 4TTPA 2ZPAA 2PH3A 3BBZA 4ETNA 3D2LA 5LU9A 5EXDA 3WFIA 3IV9A 2BHTA 1QDUA 5IBCA 5IKPA 4BZZA 2VLBA 1QONA 2CNWD 3N8KA 4J03A 2YVAA 1VSQA 2NV2B 1CPYA 3RPEA 1XYGA 3KZVA 1E8MA 1E1RD 5B2EA 2IX3A 4PFJA 1N5JA 2UUPA 2BP7B 2HSDA 3GZJA 3EG9B 3TLAA 5EJEA 3QI2A 1YJXA 1FFXB 3KUUA 3BBLA 2B98A 3L77A 1XTIA 1ESNA 4DJFC 3RSSA 7MHTA 4ZHQF 2YBEA 4NJOA 1CUWA 2ANBA 2Z5FA 2NVWA 4BEVA 5B6PA 3QH4A 2C7VA 1IZ7A 2JVIA 2BL4A 4KYUA 3PTZA 1JEQB 1EFDN 1LSOA 4C6HA 4RPJA 2GZ2A 5G1OA 3SCZA 1Y3BE 2EJSA 1RS0A 2O2DA 5KOHB 3K3PA 2QRVB 4MUIA 4PBRA 1P1KA 3TM5A 1U9YA 5G0TA 4F72A 4N0QA 3CLUC 3W7BA 1ZMVA 2XMCA 1BGXT 1JDNA 2IXBA 1Z4OA 3KSZO 4FCCA 1QXSA 1R10A 1ZY2A 4KN9S 3DB2A 2VHWA 1MP0A 2VNIA 1PZMA 1HLPA 3V4OA 5K3CA 1D8TA 1QG0A 1K2VN 1WCYA 3V1MA 1RCFA 3LC7O 4OVKA 1J2JA 5H81A 3L26A 3GRAA 1E1LA 4DCJA 2HLNA 1QAMA 4WSOA 4QBIA 4Z9FA 2VF7A 2ZIFA 1TEXA 4LYFA 5MGBA 4MUHA 4WL0A 5IRCD 5E6JA 2LXEA 2SICE 1NJ8A 5HQ3B 1SKYB 4M1TA 2F59A 4G86A 1QGYA 4BVKA 3EXFB 1H6CA 1A7UA 2DQYA 2XYQA 4JJKA 1U6IA 1FMJA 2C84A 2CDNA 1GARA 2RCNA 1IFXA 1TEVA 2HCBA 4RAOA 1OZGA 4QDXA 1VDDA 1NNEA 1X9IA 2IYZA 2FX5A 1IDN1 4DCNA 1D5CA 4Y2UA 4EJSA 1Y33E 3DWIA 3GDWA 5D00A 2AEFA 5BPFA 4RFVA 1TPYA 1BXGA 5G4LA 3JS5A 2YOHA 3KELA 4V38A 4OK3A 2DXIA 1H1TA 3MXTA 3QYJA 2EFHB 1MA3A 2F1OA 4BBJA 3L9WA 4QASA 1KWKA 2EQ5A 2WM8A 2XMSA 2JH3A 4DVGA 1O0SA 3JR4A 3RSHA 4BVFA 4RE5A 1JMYA 4ZJPA 3ECSA 2Y05A 4RHXA 4BASA 4X71A 1F4LA 4XX1A 5BSTA 2AOVA 1EFPA 1T2CA 2HQBA 4AW4A 4NCJA 5CLIA 1F1BA 3HFSA 2FW8A 3HCEA 2FTKE 1SWVA 4OLHA 3LX8A 1OV4A 3AU9A 1PR1A 4RMGA 1Y6ZA 4PTLA 1VHWA 3H5TA 3IYLW 4FD2A 2ID4A 5EXEA 4TL6A 5LQMA 1LJUA 1OZFA 5HQJA 4B8WA 2NVUA 1ABFA 2GI4A 3B38A 3PNLA 4JEHA 2CHQA 4JI3B 2G8LA 3LPDA 4MUAA 1N6OA 4MP8A 3WK8A 4JKYA 1AD2A 5CT6A 2OUIA 4NJMB 3IUQA 3KQUA 5CYOA 5TF4A 4UBMA 1V4NA 2XRMA 3FX2A 1R0YA 2BIFA 3RRYA 4EPYA 1Z6ZA 2ZUBA 3GAFA 2ZJ8A 4URYR 4RMHA 4DQLA 4QTZA 4KXVA 3RRJA 2B82A 3FRIA 1R6DA 4HJXA 5DK6A 3O4JA 2HWXA 2WDZA 2EG9A 4PZAA 1I9CA 2AMLA 4M38A 3O91A 4Q03A 3UFXB 3BWYA 1GUAA 3WIOA 3PS9A 4FCWA 3V1YA 2P1RA 4AFNA 3DFMA 1XDUA 1Y98A 4B80A 3S2GA 3OPMA 1NQXA 2CMKA 2ODQA 3GT3A 1QRSA 3NH9A 4Q12A 2BR3A 4DLXA 3H1AA 1W49A 1RW4A 2A1IA 3PJFA 3S99A 1QSGA 4E2WA 1ILEA 2HQ1A 2M6LA 2V3WA 1E2GA 1SIBE 2KHHA 4HX2A 1S2NA 1TAGA 3LRXA 4DMGA 5I7AA 2YJTD 3G0CA 1WEHA 2J3KA 3Q2OA 4I8XA 2X6QA 5T67A 2GM4A 3WO1A 2GUGA 2B5VA 2YIJA 4K9NA 2E21A 1Z13A 2W70A 3A1FA 2AHRA 4CM5A 1ECPA 3BC1A 2Z8ZA 4WN3A 1YA4A 4HB4A 5FPKA 5ITWA 5EJMA 1T8WA 5H9VA 1S1CA 5IM5A 3R6TA 4Y2RA 1NVVR 1T91A 4MS4A 4M8KA 4BPBA 3GHYA 1VEJA 4KQJA 5JI3E 3IOEA 3E5MA 1UDRA 5JSYA 2GK6A 4M9QA 3BM5A 4F2WA 4CIYA 4XCQA 1QYDA 2OY0A 3KT6A 3L1IA 2VF4X 5CH5A 4WADA 1AUQA 1Q0LA 4ZIRB 2P5UA 4MP6A 3R5HA 5CVVA 1OPXA 1KERA 2DSNA 4PQEA 2A92A 5JSKA 2DT8A 5IJ9B 4ADSG 1SZDA 2HK8A 1ZVQA 4D3SA 4KRYA 1N57A 3PUVA 3MWFA 5ABPA 2NUPA 1MOZA 2WFZA 4QTXA 4RK4A 1VBNA 1FP2A 4EH1A 4ASUD 3ROFA 5HUHA 4IH4A 1N25A 4CLRB 3WL6A 4C05A 5F5XA 4RETA 3L7IA 3OTOM 5HRUA 4MXDA 1M75A 2GZDA 1ZX1A 3T3GA 3VPAA 2YWCA 1BWSA 5GM2A 3QE4A 1GEGA 2YJGA 4JIGA 1VHTA 5JO9A 3B6IA 3UV7A 3G8AA 4A10A 3E23A 2C8JA 3QJYA 4L72A 1QFJA 4FMCB 3Q6MA 4TXJA 3SLGA 2XCRB 4ZZ2A 3BXFA 2NMVA 3JPYA 1UM8A 3G1WA 5FWAA 4EKDA 1DBIA 3O6VA 5EC8A 1QVWA 2F5OA 1L3CA 4HDMB 3E7DA 4MO2A 2EX4A 3L8HA 1ZVKA 1JKMA 1PZHA 3OHMA 3U44A 1E5DA 3JZAA 5HHTA 3ENZA 1NVMA 1XDBA 3G9ZA 3WGJA 2J85A 1WXGA 2QSUA 1E3WA 5KDLA 2BEUA 5D84A 1T9AA 4IIBA 3WOHA 4KX3A 4HWGA 3CMCO 5H7XA 4M9UA 4ZP1A 5I7HA 4BKOA 3IHPA 4XR4A 3TNLA 5D3ZA 1ZO8A 1SBZA 2FQWA 1W36D 5LU8A 4PTZA 4PLWA 5BP7A 1TH2A 5B1YA 2A58A 1EGVB 3QRWA 1ZOPA 2VWPA 4OJTA 1QDRA 4LDAA 2WMYA 5EIXA 3LCMA 2XUGA 3T3PB 5CDSA 3DL4A 2I33A 2XT9A 1BMFD 4GE3A 3P97A 1WY7A 4HDOB 4JC5A 2GESA 4KAXA 1WXQA 2WEKA 8ATCA 1GGMA 3TBKA 4M0EA 1ZITA 4IX1A 3BIOA 3GQ5A 3VU0A 1D9XA 4PYOA 1WDTA 4OA8A 3EFOA 2WIAA 5HSGA 2H2FA 4QPZA 3OP4A 3UUWA 4W82A 3QE3A 1F0PA 3UY4A 3IX7A 2EEPA 1E69A 3J81S