3U60B

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
MITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 103
structure length 319
sequence length 319
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u60B01
4LV5B 5EXTA 4PC6A 1EFTA 3QEJA 4BFYA 4LOAA 3WNDA 4PZZA 3QPUA 2ZRFA 2OHFA 2ODWA 1DO2A 4LUCA 1GZSA 2OILA 1G8YA 2GCOB 2GF0A 3OIUA 4JT4A 1ZD1A 4CW7A 1T9HA 1QDEA 2QE7A 2GCPA 2BC9A 2OBNA 1WB9A 3C16C 5HCNA 1G16A 1D8TA 2FX3A 2GA8A 4LBVA 4D25A 3KX2A 4DCVA 1XEWX 5E3HA 3QE0A 1TTTA 3M1IA 4Z8YA 5DI3B 1KY3A 1G291 1OXXK 1OXTA 1HUQA 2ZS8A 1IN7A 4ASUA 4TMTA 3RHFA 3LV8A 1WBBA 2KRKA 2VBCA 4URWR 2NO9A 4MA4A 3VQTA 1M7HA 4P4TA 4PC1A 2RGNA 3DHWC 4ZI3A 5CDFE 3L43A 4V0OA 2WKQA 1CR0A 4CT4B 2IBMA 4Q47A 2DWPA 1DOAA 4ABYA 3EPHA 4G0NA 1J8MF 2RAPA 2IYZA 2OZEA 2QAJA 3NG1A 4DHEA 4C2UA 2C9OA 1KO5A 1JPJA 1EG7A 4JLMA 4B3FX 1E2QA 5FOSA 2WAXA 2NZ8A 1GUAA 1IY1A 2OE2A 3FYHA 5FBLB 4II7A 3RAPR 5KU1A 3UMRA 5KDOA 1NBMD 1UADA 3HWSA 1AQUA 2QI9C 3FE2A 3AGPA 5DNYB 2XXAA 2VHCA 2H5EA 2CK3D 2J7PD 5CIQA 1DADA 1MT0A 1GWNA 4EUNA 4QFMA 2AWNA 2WWGA 3IPXA 3E2IA 4KFUA 3SJCA 4B48A 2IYXA 2ZRCA 1G21E 1QHYA 2NO6A 1XF9A 1N6OA 1SXJC 2BV3A 3BH7A 3PEUA 3TLXA 1GFIA 3WYAA 4QHTA 3CW2A 1NVUQ 4FMCB 2CHVA 2IF0A 1S0UA 3BH0A 4RZUA 4LGMA 1ZW6A 4JBXA 4AK9A 2ZSEA 4TYNA 1E94E 1A1VA 2CL0X 2ZETA 2GJKA 5D3MA 1EX6A 4V0LA 4EDHA 4QOSA 2PJZA 1AS2A 4N1AA 3T5DA 3RNLA 2B6HA 4PAOA 5LB4A 3VU9B 1W36B 2O8CA 2FSHA 1T3SA 3K70D 2IUSA 4OYHA 3NWJA 1G17A 1NRJB 5IK2A 3HP1A 1FP6A 1U9IA 1DTSA 1MR3F 5K8LA 4MRSA 2X19A 4OK3A 1J70A 2QORA 1DAKA 1QVRA 1DELA 1Z0FA 4CT5A 1E1QA 3SI7A 1OLOA 2J87A 2I3BA 3GLGE 3SJAA 3C8UA 3VX3A 2GZDA 3T1OA 1VG9B 5C4GB 2QY9A 3TSOA 4URYR 1P75A 1XMIA 3ETLA 1W5TA 3TSZA 5AK0A 1KOFA 2P0EA 3SEAA 2HF9A 1P60A 3ZGXA 2FJUA 2RKOA 3KTAB 1HYQA 1Q3HA 3QVUA 1R8SA 2ORIA 1FUKA 4DXAA 3HYRA 4TSFA 1CXZA 4RD6A 3ZIAD 721PA 4QGFA 5FTLA 1ZCBA 2XJ9A 4K8OA 4P33A 3NHAA 4C0JA 3U3OA 2BEJA 2WWYA 4GITA 5DLQC 2NZJA 4YMTA 1Z63A 1GDDA 1MKYA 1YZGA 3NVAA 3SJBA 2BMDA 3AVQA 3HPRA 3SZRA 2GZAA 4AG5A 3FHOA 2ZRGA 3THYA 3DEFA 3DOEA 4CEIB 1W4RA 1KDPA 1XD2A 5J4LA 3FMIA 1G3MA 1AM4D 2TMKA 2CJWA 2RGXA 3BFVA 1IHUA 4I81A 3B1ZA 3K9HA 5AJZA 4EPTA 2PZFA 4H1VA 1RRPA 4V0KA 1OH6A 1QHGA 1JEEA 2ZR9A 3KKQA 4TLEA 4Q9IA 4X8MA 3OFNA 1CLUA 2JIZA 2ZJOA 2QGZA 5E95A 2CE2X 3CF2A 4A9AA 1DAHA 1OHHA 4OQNA 3PCRB 5JMTA 2VQSA 4B3XA 1FP7A 4YQFA 1AGPA 3FKQA 1YZNA 4OQFA 4Q9KA 2I1QA 3UWKA 1G3IA 2EVWX 3WMEA 2VHTA 3VKHA 4DB2A 1SQ5A 2OXCA 1GVNB 1C4OA 1VPLA 4FW9A 5FUWA 2AK2A 3GEHA 1F2UA 3F0TA 1S9HA 2WKPA 4W5HA 4FINA 4P4UA 4U5XA 3HJNA 2ZANA 4DDWA 1FL9A 2WMNB 4HDCA 5DO9A 5K8TA 4LJ7A 2J3EA 4A3VB 4Q19A 5C46F 1M7BA 5FOVA 1BKDR 3KJEA 1AQYA 4E07A 2XXAB 2QMEA 4C0HA 4MGIR 2BBTA 2IHYA 4DDTA 1VCNA 4CRWB 4E03A 1Z8FA 1NVXQ 1YQTA 3Q72A 3THOA 2CBZA 1KGDA 4Q7MB 4D4KA 3KB1A 1XPRA 4TQUS 2MMCA 821PA 2HXSA 3E5HA 2DVWB 3A8TA 3I8XA 5DHAA 1JR3A 3I61A 4A15A 5AJWA 4WVFA 2FEOA 4DZZA 1SVMA 4HAXA 5JEDA 1XTSA 3VHLB 1HY3A 4BE7B 2OUKA 2B7BA 4LBWA 3LRPA 3QBTA 1XD9A 4JLKA 5J4VA 2JAQA 4R9UC 3SOPA 3CRMA 2B21A 4ZDJA 1M74A 2ZYUX 1U90A 5KSZA 5D3MB 1CEEA 1E9FA 3LBIA 4QKQA 4A0HA 2JLXA 1NKSA 3FMOB 4LC1A 3RS4A 4JBYA 3TQFA 4URXR 1U8AA 3QF4A 5GVRA 1E2HA 4AKGA 3SE0A 1RFLA 3IIMA 2CL6X 4MYHA 2IYSA 4M9QA 4MKGA 1Z5ZA 4B33A 5HTKA 3A36A 5J4KA 3TUIC 3CX7A 2F7SA 2IEZA 1W0JD 5FTKA 1COWA 3NH6A 4NBSA 1N0WA 3PR1A 3LW8A 4WOPA 2Q9CA 3PEVA 3QKSB 4MKHA 3JZMA 5BN3A 4FMCF 1QHSA 2EWWA 4YMUA 4POAA 2VF7A 4A36A 3U3JA 2J1LA 5JRJA 2BBWA 2VSXA 3WYGA 2X2FA 3D8BA 1V43A 2QROA 4JKYA 5F98A 3VR6A 1ZIOA 2YNMA 1NG1A 4M1SA 1Z6YA 3UK6A 3I3SR 1JQJC 4ZIRB 3AVXA 4LRTA 1S4QA 3Q7QA 4C3ZA 2W0MA 3A1WA 2VRWA 2OM2A 1ETUA 4AKIA 4TYYA 1RW4A 1X8JA 3ZVNA 2BIFA 3W3ZB 1TADA 1W47A 4DSUA 4AKHA 3OZXA 3BWDD 3EZ2A 1KSJA 4GMXA 3G5UA 1XEXA 1DE0A 1Q44A 4NONA 4DVGA 1YJ5A 4ZCIA 2VHQA 5TMPA 3C5HA 2XTMA 1G5PA 4MITA 5HKKD 4V03A 4DLTA 1R7RA 4XOIA 3THYB 2WWHA 4N3NA 3TQCA 2FN4A 2EFGA 1E0SA 1XTIA 4JLBA 1SVOA 2JJ2D 1AZSC 3CX8A 1KDOA 1KI7A 1MV5A 2CJWB 1VYVA 2OCBA 2F1HA 1G8FA 4A0GA 1H8HD 3EZFA 5F9FA 2RGDA 1T0HB 3RRZA 2REXB 1BMFA 1E1RD 2W0SA 1IN5A 1W5SA 1G7TA 3SHFA 1UBCA 3HU1A 2QG6A 4QBFA 3EAQA 4HAZA 1JNYA 4PXAA 4ZPXA 4IEIA 2PJRA 3J81k 1KK1A 4Z54A 1G64A 3CF6R 4HDOB 5FTJA 3VLFB 1D2EA 1P7CA 2IYLD 1IXZA 2ZR0A 3I72A 4LPKA 3LAWA 2O0KA 2CLCX 4EJSC 4QG7A 1AIPA 1F2UB 1SZPA 1N6IA 1XMJA 3I1FA 3LH5A 3SDZA 1E69A 2F55A 4XVUA 1ZUIA 4Q21A 2RB4A 4W9MC 2FSIA 1FZQA 4BFZA 1WMSA 3QKRA 4HLUC 3I5XA 3DMDA 1UKYA 4ZCMA 2ZYTX 4U02A 2GRJA 3QBVA 2WOOA 3V00A 4RZXA 2XAUA 1HQCA 1KJZA 1G3UA 1XJQA 1HT1E 1IONA 1SKYB 3LVRE 4MGZR 4IXMA 3K0CA 4RSGA 4M0LA 3U3KA 2B92A 2YJTD 2GEDA 1OB2A 2IT1A 1I2DA 4IJMA 1T4GA 1FNNA 1KO7A 121PA 2Q3MA 1ZC4A 2R9GA 1E96A 2QQEA 4B74A 1KK3A 3HU3A 3LW7A 3ZVRA 3EW9A 3TRFA 3NKVA 2IF2A 1CR2A 3SFZA 2AXNA 5KOYA 1LV7A 1R6BX 2IYVA 4UXHA 3RSOA 3PUYA 1EWRA 2JLQA 1W36C 2R6AA 4BUJA 5DH9A 4NKRA 1UKEA 3KJHA 4FWIB 1G19A 3LQQA 2ZI4A 3ZS8A 1FPMA 1FUUA 2RHMA 3RS0A 3TJZA 1LFDB 5KSPA 1SGWA 5JS8A 3ZH9B 4CGZA 2BEKA 3GJ8A 1N5JA 2JLRA 2XNDD 4DSTA 2GXUA 4DCSA 2DHRA 3MAAC 4A2QA 2PEYA 3GJ6A 4Q4AA 2XSZA 5CIWA 4NYJR 2QUZA 1TPZA 2G83A 2Z83A 1W44A 4BEBA 2AD1A 1NVVR 2N46A 3R9WA 4WIAA 4RVCA 3W5IA 4H1UA 1XPOA 4Q1DA 4C9BA 4TZ6A 4ZDIA 3KJIA 1Q1ZA 1XCMA 2G0TA 1W36D 2ZIAA 4MH0R 4OBEA 3W90A 3GJXC 5CB6A 4LY6A 3ND8A 1ANKA 1QHXA 1QZMA 2V9PA 3AVOA 3QEOA 2KI5A 3EC2A 3K09C 4CVNA 4UQOA 3RRYA 1OYYA 1G1MA 4HLQB 4IEEA 1NP6A 3DZ8A 5AJXA 4AC9A 4KCGA 3RC8A 3P32A 1VYTA 4JIMA 1WP9A 3B1YA 3CONA 2NO7A 4OK6A 3D31A 2IW3A 2ZREA 3AUYA 4LV8B 4TMZA 3RYTC 2IYUA 2KSQA 3U7GA 3BJIC 2CNWD 4RCZA 4YMVA 3AB3A 2WWXA 4OQXA 3FTQA 3A4LA 4TMVA 1P2UA 4G5RA 3WXMA 4B73A 1XEXB 5CLQA 5HPYB 3QF7A 5FH9A 4S2EA 2VP0A 3THXA 2JATA 1PLLA 4F92B 3B5JA 2BBSA 1OJLA 4PAQA 4TMWA 5G40A 1FTSA 3ZDQA 2QL6A 1X37A 1E9DA 2J46A 3W34A 4U7DA 3HR8A 2D4HA 4LYHA 5JHHB 2ZRAA 1NN0A 1LVGA 1NLZA 3MLEA 2BM0A 4HYYA 2VL7A 2IYWA 3IBGA 1SKQA 1GTVA 5JJIA 4FCWA 2GBLC 5CM8B 2Z6VA 2AR7A 2XZPA 3BRWD 2NTYC 1W46A 2V55B 1F5NA 1G4AE 1PLKA 4HZIA 1N0UA 1W49A 4MRNA 3MWKA 5BYJA 3P4XA 2QA5A 2BCJQ 1D9ZA 1VMAA 2IXEA 2QE7D 3U6KA 4GL2A 5GJBA 3NEYA 1WXQA 1E2DA 4BFXA 3KQKA 1ZM3A 5FR1A 5GJCA 3BGEA 1OF1A 4KBGA 5JLJA 5KDDA 3FVQA 1RPZA 1JJ7A 1XMVA 5CLLA 1JEDA 1G4UR 1T3LA 2W6ID 1NVMA 1YR9A 1KNXA 1ZNWA 2WIBA 5B64A 4MKIA 2A9KA 4D4LA 5K8IA 5JWRA 2W83A 5KHOC 3AVPA 1KI1A 3L0IB 3QJYA 4A8JA 1E2LA 2HF8A 4ASUD 1KMQA 4BRWA 2RGEA 4M1MA 4KFTA 2DZNB 1I4LD 4V02A 1GNRA 2WJGA 4JL6A 4RCYA 1DEKA 1Z22A 3AVYA 3AVTA 3QKRB 3SBDA 1F60A 1YR7A 4OK5A 2J0UB 2NQ2C 4GP6A 5SZIA 4LJ5A 4DRZA 3GFPA 4OI0A 1X6VA 3AKDA 3U3MA 1ZD9A 1US8A 2ZSDA 3NH9A 4X8LA 3CPHA 3AQ4A 4OJQA 4HAVA 5L3QA 1CS4C 4KHZA 2YWFA 4RD0A 1E2KA 4DCNA 4PO9A 1XPUA 2PT7A 1GITA 4EPWA 4LBYA 4C0AC 5TDHA 1HE1C 1NG9A 1Z2CA 4PHHA 2ZYWX 1Q3TA 1NMYA 1GNQA 5J40A 2ZJBA 3HR7A 1NN1A 5C4MA 2ATVA 2G77B 1R5BA 1JAHA 1GOTA 2GXAA 1NJFA 2O8EB 2WMOB 2IYRA 4I99A 4AWXA 1W0KD 2R9VA 4B2IA 1N25A 5H1YA 1ZD8A 2AHOA 3X1YA 3BXZA 1XXHA 4P4SA 2GZHA 5BW8A 4IDPA 3R20A 4BZXA 3B6EA 4TL9A 3VFDA 4TTQA 4G3XA 4IOLA 4TMKA 1XZQA 1NKTA 2MSDB 1EWQA 3GLHA 1U9IC 1S96A 4QBGB 3ADCA 3GJ0A 1ZNXA 1EFHA 1IJEA 3IIKA 4LYAA 5LD2B 4GRAA 2VTKA 1U8YA 3ONWA 4UNSA 5FOWA 3SQWA 4F4CA 1DPFA 5JBQA 2ZTSA 2J9RA 3KKOA 4G01B 1II9A 2BMJA 3MRSA 4HAUA 4KLNA 1JXMA 4DLUA 3SBEA 3WRYC 4C0LA 3VHXA 3WMFA 1KMHA 1VDZA 2BMFA 2YWEA 4K46A 2V6ZM 1XB2A 3EZ7A 4Q01A 3ZQJA 5IK2D 1E3MA 2XJ4A 2GK6A 5DN6A 2F1RA 4DKXA 3U7FB 5AJYA 3RS5A 5LDDC 2DWQA 2QBYA 3IHWA 3SYLA 1Q1BA 1E1QD 1DVRA 1KI2A 3KKPA 2ANCA 4Q18A 3NC1C 4PSAA 3NXSA 1WCV1 1Q1EA 1X8KA 1RKBA 1OIVA 2QAGB 3VNUA 3VTKA 3LNCA 2R6GA 3TGPA 1GRNA 1RJ9A 3CUEF 4A4DA 2RGBA 3P27A 4AURA 3THXB 1AZTA 3FPAA 4B6FA 4RY2A 3GJ7A 2GVZC 3S1AA 2QP3A 1D2NA 4TSFD 3JVVA 3CX6A 5TVKA 1NIJA 2QNRA 2Z0MA 4Y0VA 3A1TA 3MG9A 4QC2A 3U2QA 5EXXA 2HCJB 4RKEA 2ONKA 2RHDA 3TSWA 5L3VA 1N5IA 1KZ7B 2REBA 2O5VA 4QHYA 5IDVA 4D26A 4B43A 4FMDB 4B2LA 1OSNA 4QGHA 2ZRIA 1VECA 1KHTA 4M8NE 1R0ZA 1Z6TA 3FFAA 1E2PA 3IQXA 1WF3A 4HB4A 1CU1A 4Q4JA 4XD7A 3P1JA 1N6HA 1OKKA 2F6RA 1B0UA 1LS6A 1E79A 5AJVB 4KODA 3A37A 1MO5A 2R62A 2GVDC 5FOTA 2D7CA 4A92A 2OLJA 1HEIA 3C7KA 3PIRA 1U99A 4QJ5A 3BB4A 4XVRA 3LO5A 4DBLC 3OFND 2JIZD 1R5NA 4A2WA 1NF3A 1TAGA 3KKMA 4IVPA 2AN9A 1C9KA 3H4MA 1TNDA 1OHHD 2WJYA 3UATA 1TQ4A 2EFDB 4A8JB 1KKMA 1OYWA 4PO1A 3TIFA 1LW7A 1NY5A 3SYKA 2BJWA 4WBSA 1P9NA 2R6FA 1CR4A 4LHXA 3TW4A 2YYZA 2H16A 5JCPA 4V0MA 2N42A 1UJ2A 1VHTA 5BN5A 2GEVA 1GL9B 2CXXA 3L0PA 4NCHA 1XJ0A 2JCSA 3IBYA 1HH4A 1AA9A 5SZKB 5L3QB 2JDIA 3K70C 1IY0A 4ZCLA 5JWHA 1XTKA 2R65A 1Z6XA 2ZUDA 1AK2A 1MO3A 3I92A 2FU5C 4IKEA 5DYIA 5FUYA 3RS3A 3SR0A 1Y63A 4LYFA 2H1LA 3EPKA 3UG6A 3IQWA 1W1WA 5B30A 5H68A 2CLDX 3IGFA 4C0KA 1LTQA 3DZDA 3LY5A 3EX7C 3C15C 4IVQA 4Q9LA 3CPJB 3X2SA 5G3ZA 1BO6A 2V8OA 3X1WA 3GMTA 4Q03A 1G7SA 1XXHB 1GIAA 2QRZA 4M9ZA 1CULC 4P4SB 3TW8B 3WP0A 5KSOA 2PH1A 1JR3D 2J7KA 2K5UA 3BS4A 2IA5A 4UJ5A 5HR5A 3HPQA 2XX3A 2WSSA 1VYUA 5G3YA 1K8RA 3TE6A 3GLHB 1MH1A 4YLGA 1Q0UA 1VCIA 3K0AA 4URZR 4WXRA 3WY9A 4BZQA 3GJ4A 1N3BA 4B75A 2QU8A 2IS4A 3BERA 3B60A 2IYQA 4CEHA 4MDEA 4XTRA 3O8CA 5FBVB 3ADDA 3KKNA 4R71A 4XTCS 3EIEA 4URVR 2D2FA 4PQRA 1S8FA 2WKRA 3QPWA 3FFBA 5LPNA 1NMZA 2HT6A 3KQHA 2C96A 2ZI5A 5EE3A 2PMKA 3KL4A 1H8EA 1S2MA 1TQDA 2ZU6A 2YINC 3B13B 3EZ6A 2OCAA 5FL7A 2QSYA 4URUR 5K8UA 4JLOA 3O47A 1KMHB 1VG8A 3QUSA 3OF5A 2X1VA 5KYKA 5JI3E 1E99A 3AVVA 1ZU5A 3ICEA 1COWD 2FNAA 2ZR7A 1IY2A 1UEIA 1PLJA 1G41A 2HDNB 1HV8A 1EGAA 4Z51A 2Q3FA 1ZBDA 4ZKDA 2FZ4A 2KBEA 1CJUC 4PC7A 4AD8A 1Z29A 2QBYB 5FPYA 4M9XA 2IEYA 1XJCA 2LWIA 4LJ9A 2NG1A 1ZYUA 2FOLA 2WJIA 3PVSA 4AKEA 1E9RA 2GHIA 3O8RA 3PEYA 4JYBA 1TUEA 1R2QA 1F3OA 4BGDA 1ZUNB 3CRRA 4R2IA 1L4YA 4NCIA 3RABA 4GT1A 1O87A 4B76A 4QBHA 1OXUA 4M1WA 1DBSA 4DSNA 3B8HA 1KI3A 4C30A 3ZVMA 5IF9A 1J7KA 3S1AB 2IK8A 2ZI6A 4FWDA 2H17A 2ZRMA 4DLWA 4G5OA 4PQFA 1M6NA 3W3AA 3DKVA 1YE8A 2BMEA 3ZJYA 2QGNA 4QGAA 5TB5A 1SVKA 1G8GA 2JEOA 2V4ZA 5FI0B 5A4JA 2WJHA 2WPDA 1T91A 2F1IA 3CNOA 2UKDA 3BH6A 2DY1A 3NHBA 5G53C 4B47A 2ECKA 1YZUA 1K5DA 1SULA 4Q4JB 1TF5A 3U60B 2H7VA 5JI2E 4M9SA 3L0OA 2AFIE 2CVHA 1Z0DA 3NBFA 4WAUA 2OG2A 3QOFA 4BEJA 1XD8A 2FG5A 4CEJA 4LRWA 1SKYE 3UANA 2P6NA 4LHZA 2VP6A 1GP2A 1N6PA 3N2EA 4ON9A 1BMFD 1JQLB 2J5XA 3LXRA 4K81B 4LJYA 1KAGA 1N0VC 3OESA 1NBMA 1R10A 1X1SA 3L8YA 4LCBA 2B8WA 4Q9JA 3EG5A 2W2XA 2QN6A 1RVDA 1XX6A 6Q21A 1JR6A 3PFIA 1JR3E 4G1UC 2XTNA 2OXRA 3GEEA 3OAAA 2WBLC 4YC7A 1Z6GA 4LV6A 4FMDF 5FBWB 2XB2A 3WRXC 2WZQA 4X8HA 1P2VA 3CRQA 1DAGA 1KI6A 2IUTA 4JZKA 1PVOA 2PEZA 4IOMA 5DE3A 2JA1A 2ZAOA 4NYIR 4BFWA 4AIIA 2Z4RA 1ZAKA 1ELOA 1PZNA 4I1OA 4PZLA 2VLIA 4WZBE 3IILA 4NTZA 2QT1A 4F4JA 3LQRA 5EE9A 3CBQA 5ANRB 2ZRJA 1T3HA 4RKFA 3RRNA 1X8LA 1R0YA 1RE0A 2P65A 4KLZA 2HXYA 4PC2A 4CDGA 4DIDA 3K53A 3QKTA 3H1TA 4TT3A 4YMSA 4DIEA 1FW6A 4Z8XA 3SQXA 1TQ6A 5LD2C 1G8PA 2O8CB 1SXJA 5JHGB 1A2KC 3U4QA 3NBYC 2DZOB 1NLYA 5C2JB 1ZM2A 1VKJA 1ZM4A 2ZRBA 3QSYA 2UVQA 2YOHA 2QM8A 4KFRA 2IXGA 3I8SA 3PUWA 5GADl 1OFIA 4TWZA 4LHWA 4BECA 2ORVA 2ZAMA 3K0AB 3WNCA 2PLFA 5D3QA 1YU9A 2C77A 3TK1A 3VNVA 2X77A 4CEHB 5C18A 1XDBA 4PQYA 2QEQA 3AM1A 1XBTA 2ZSFA 4FCTA 1KI8A 4EFLA 4LI0A 1GAJA 5BQ5A 3CO5A 2FDCA 3F5FA 4LRSA 4JVLA 1UBEA 2KJQA 3QPVA 3DVLA 3SHWA 4HAWA 1FMLA 2XSZD 1IOZA 1BH2A 3GQBA 1E0KA 3TMKA 4AI6A 4TZ0A 4L4UA 2P67A 2A5FA 4KYUA 3PITA 4WZ6A 3C14C 1G20E 2C03A 4MKFA 2QAGC 5HZHA 4HB2A 4NHOA 4JVNA 1GSIA 1Z28A 1E0JA 2AK3A 4TLCA 4F93B 2HEIA 2Z4SA 3Q5EA 4JMPA 4B3CA 1KDTA 4KXFB 3R8CA 1K6MA 1G9XA 1AGRA 2XEXA 2NPFA 4Z1MA 3WHKA 2HJGA 3IUYA 4P3YA 5FPTA 3QVVA 3U7EB 1ZNYA 1KAOA 3QXHA 2YV5A 4I1VA 1XD2B 3NDPA 3RWOA 1NN5A 2DWZB 4MQBA 3PUZA 3KXLA 4BLSA 3KQLA 1RRCA 4Q48A 4O3MA 3MHVC 5ELXA 2H57A 2VF8A 3VR2A 1WDTA 1Z47A 1VG0B 2WICA 1F2TA 1ZU4A 3BD9A 4KV9A 4P32A 3K9NA 3GP8A 1KSFX 1Z0KA 2WHXA 1UEJA 3LLMA 4HUTA 3AKCA 2V3CC 2Q21A 2O8DA 3KFVA 3LDAA 2ZJZA 3GLFA 5HZKA 1GKIA 4MUBA 5KPJA 2EFCB 4MGYR 5HE8A 4DUGD 2F3TA 1IN6A 2WV9A 2CEAA 2GCNA 1E32A 2W6JA 5L3SA 3EIHA 2ZRDA 3QXXA 2A5YB 2IWRA 3CRW1 5EXPA 1DAIA 2A5DA 3CB4A 3LX5A 2ZRHA 3OIYA 4QXAA 4BFSA 2ZRPA 5AUNB 4CEJB 1TU4A 2ZUCA 4XJXA 3F8TA 2FWRA 5JFGA 4X8OA 1JPNA 2P5TB 1XCPA 1N6LA 4Q7JB 5KUTA 1GILA 4KAXA 1LNZA 2A2ZA 2F1JA 3MMPA 2J41A 4EPXA 4O25A 3GD7A 3X1DA 4HZUA 1AN0A 1LS1A 4FMBB 2CL7X 5FPKA 3N2IA 3RVBA 1KNQA 2BVNA 5JWOA 4U00A 2VP5A 4JVSB 2DFNA 1YVDA 1GKYA 3CPEA 3T06B 1G7RA 4OHXA 4FXPA 4D82A 1GL7A 3CWQA 1KI6B 1OH5A 1UBFA 1P2TA 4R98A 1UAAA 4DDUA 4GP7A 1IAQA 5DGXA 4MYUA 4A1FA 5JZVA 1Q1QA 5B2ZA 4L16A 2CDNA 2VYFA 3PJRA 3V4FA 5FPSA 2BOVA 4WZAE 5JJLA 3C41J 4BFVA 1W4BA 2JLZA 1UF9A 4DT1A 5KTYA 4Q1BA 5EE0A 2BKUA 1T6NA 2CE7A 4KITB 1KIMA 1N5KA 1ZVQA 3TAHA 1KZGB 2DFTA 3WBKA 4FWTA 3TUZC 3AH8A 3AF3A 1TQ2A 2NO1A 1H65A 4PFSA 3K0FA 2C9CA 4DLSA 4JLNA 2QM7A 1OPXA 1GRRA 1ZM9A 2A78A 3QF4B 1X1RA 3NIBA 4QRHA 4UNRA 2GDJA 1W0JA 1SXJB 3L0SA 3U4QB 3QI2A 4M53A 5DSZA 4LDJA 2YWHA 1KK2A 4M4SA 4PHGA 4D6PA 3GJ5A 3T1QA 1BS1A 3AP2A 4YONB 1I2MA 2AFHE 2ZJYA 1ZCAA 1EK0A 4IDOA 4ESHA 1W48A 1WQ1R 1ZUHA 2G1JA 3FKSA 3LLUA 4F38A 3D6TB 3KB2A 4PZYA 2ZRLA 3B82A 1VIAA 2QP4A 2C9YA 1ZNZA 3AF2A 3T1VA 5M04A 5EQTA 1G5RA 3AP3A 3OEEA 4AYXA 2MSCB 1TL7C 3UPUA 3MFYA 5AUOB 1W4CA 2FV8A 2V1XA 3G82C 4MYTA 3QXJA 4JT2A 2ZRNA 1MOZA 2OFWA 4UNPA 2WVJA 3H86A 5H8WA 3WHLA 4KSBA 1RRFA 4QJ3A 3W5JA 2E9SA 3ZYCA 2GETA 4B3BA 4BLTA 3MWYW 2EYUA 4US0R 4EKDA 5HCIA 3AKYA 2GJAA 1M7GA 1KJWA 4W5WA 2DR3A 3IKJA 2IUUA 2ZXUA 1RRGA 3FHCB 4D4JA 2QPOA 2Q9BA 4NL4H 2O52A 1CJKC 4JL5A 1BIFA 4Q1CA 4QL3A 5EUMA 4C0BA 4EPRA 1E0AA 4IW3B 2GXQA 5EP2A 4KU4A 4OQMA 1A5TA 2JJ2A 3DM5A 4OL0A 3B1VA 4FI3C 5DN6D 5KNCA 2L0XA 2VHJA 2ZE6A 4JBWA 3CF0A 2FPMA 2OFXA 1CP2A 1GM5A 2HJVA 3DOFA 4JLJA 3OHMA 4M1OA 3EARA 4HLDA 2ZVQX 2EWVA 1F2TB 4PPQA 5EZ5A 4N0DA 2NMVA 3EWSA 3KW6A 2AKAB 3OEHA 1E6CA 2RGNC 2MSEB 2FH5B 4JLAA 2O8DB 4Q7KA 3AF0A 2ZVPX 5EZ6B 2ZQ5A 2GTPA 2ERXA 1L7VC 5F2EA 3GLFB 4B44A 2ZSAA 1U81A 1ZM7A 4M1TA 4NMMA 3CR7A 5DYGA 1TX4B 3K8YA 4HSEA 1OFHA 4R2HA 5L3SB 2V54A 1P5ZB 1A82A 2FGKA 1OW3B 1P72A 3GLIA 5JS7A 2JLUA 2REOA 1K5GA 2ODEA 1D5CA 2PCJA 2OESA 3UG7A 2PZGA 3CRVA 4MYCA 1E4YA 4HB3A 1XMSA 2R6CA 1AKEA 3AVUA 3I4LA 3WBJA 4C0QC 1M2OB 5UKDA 3DL0A 4XD7D 3VX4A 2OV2A 3E1SA 3BB1A 3ZS9A 1OKKD 1VG1A 1E79D 4GZMA 2DFLA 2GXSA 1YR6A 4HI0E 4HZUB 4IOKA 4TL6A 521PA 1XP8A 2QPAA 2R8RA 4G5QA 3B85A 2C99A 1EFRA 1CJTC 4RFVA 2CHGA 2N1BA 2IS2A 1OFUX 4ARZA 4JSYA 5FOXA 3ZZ0A 4EJSA 3W6PA 1Z83A 5FFMA 1RC8A 1XXHE 2WAYA 1ZC3A 4C0SA 3B78A 2FFHA 1AS0A 4HLUA 3T61A 1LF0A 3NC0C 4NH0A 2BBOA 2QMHA 4E5UA 2HT1A 1PJRA 3GLHE 2E1RA 4UXJA 1P9RA 4DT1B 4RD2A 5FTNA 2V7QA 2XITA 2QTFA 3F3YA 1JXOA 2Q0HA 3QENA 5FL3A 3R9XA 1ODFA 2EU8A 1E2JA 2CCGA 3DKPA 5E4FA 4TL8A 4M22A 4Q4HA 4N0EA 3TVDA 2JDID 4JN6A 2F9LA 2JLYA 3KXIA 2ANBA 3K0FB 5TV2A 5AUPB 1VHLA 1II8A 2P3SA 1L2TA 2I4IA 4P0TA 1GRQA 5EP3A 5BN4A 2PLRA 2XOKA 2X8AA 1E9AA 4OHWA 4Q4AB 4BLPA 1XEWY 4JL8A 4MRVA 3ND9A 2VA8A 4R7ZA 3PG5A 3U7HB 3KZ1E 2OO7A 4LC0A 1ZJ6A 3A6PC 3VU9A 4QM7A 3RDPA 2QMOA 4QM6A 4I4LA 5CK4A 2ZITA 3IEVA 3NBZC 2GJ8A 1FOEB 621PA 1TUIA 3FHTA 3VAAA 3Q3JB 3X1ZA 2WSSD 1OH8A 2OBMA 1R5OA 4B32A 3T35A 3ZZTA 1IN8A 1BOFA 2PZEA 1UKZA 3H84A 2QZ4A 3SC3A 2X2EA 3UIEA 1P3JA 1U2RA 1PUIA 2IX3A 1W4AA 2IL1A 3P20A 4EPYA 1OXVA 3OIWA 3T12A 1CBUA 3IO5A 1CJMA 5CYOA 2J0VA 3OE7A 4O0MA 2XZLA 2DWOA 3R9IA 1H8ED 1O3YA 1IBRA 5FL7D 2DFKB 4M1KA 1P73A 2PBRA 1QHNA 5FTMA 3IDQA 3RC3A 3CNNA 2G0NA 1Z0AA 1TF7A 1GKUB 2A3RA 4YMWA 4NU0A 1E2EA 4F4IA 1Z3IX 4GZLA 2LCFA 3SS8A 3BK7A 4JJKA 5TXGA 3DPUA 4KJZA 1JALA 1XU4A 3PEWA 1ZMXA 2B8TA 3DDCA 3VR4A 2FA9A 2ZJ8A 1WRBA 4NYMR 4CEIA 1M8PA 4ESVA 2NO0A 3ZD6A 5DIFA 3DO6A 3BIFA 5IT5A 1NLFA 4E09A 4KVGA 4TYPA 3I32A 2GJSA 1G18A 4W7SA 2P6UA 1YRAA 3EZ9A 1U98A 3IHLA 2W6IA 1Z08A 3BGWA 3K0EA 3VKWA 1N5LA 4XSGA 2WWFA 4NZYA 3U6BA 3B9PA 1D9XA 1U0LA 3RANA 2ZS9A 2RMKA 4ZO4A 1T5IA 1TU3A 4PPGA 4B34A 4V0ME 3GLIB 4OJKA 2WPDD 3EASA 4D0NA 3Q9LA 3QY0A 4L15A 2GBLA 4DJTA 2HLDA 4IDQA 2QTVB 5CB8A 3SNHA 1Z6AA 3A1SA 3Q8XB 4YXWA 3AJIB 5EUQB 1QVAA 2GESA 4B3GA 2Z5FA 1CF4A 2EQBA 2RGGA 3ZZUA 2BCGY 4Q1FA 1Z2AA 4UNNA 3H0KA 5E7MA 3BFXA 2G1KA 2EFEB 3N5CA 4PHTA 1A7JA 1IXRC 4Q02A 2F43A 1US8B 2H18A 2PMDA 4DEYA 2ZS7A 4XH9B 1I4DD 2VSFA 4ARZB 4JS0A 5CDFA 1DARA 3NTUA 4EJSB 1JAIA 5FBRB 4XWKA 1EESA 2ZROA 3B1WA 3A1UA 3QG1A 4TQAA 2JJ1A 2YC4C 4BASA 4QBIA 3OAAD 2V1UA 4DSOA 4BWYA 5KO2A 1VTKA 3CTDA 3PENA 4BPBA 1DS6A 1S3SA 1M1YE 2HYDA 3EPLA 1W0KA 2MMGA 4L5BA 2P6RA 3AGQA 3WNBA 3K0SA 1KDRA 3A4MA 4KI0A 3AKEA 3BB3A 2YHSA 3AVWA 4C7OA 2C5LA 2DBYA 3U44A 4G5GA 1C1KA 4A0FA 4V0NA 1E2IA 2JJ8A 3BORA 4Q4HB 1T8TA 4MUAA 4OI1A 3B7GA 3VR1A 5FR2A 3CZPA 3PQCA 5J4HA 3AEZA 4LYJA 4CF7A 1P4SA 1II8B 3MD0A 221PA 4JSTA 2ZJAA 4TYQA 2ZPTX 2IYYA 4TL7A 1P9WA 1E9EA 3QXSA 2D2EA 4OI2A 4QNRA 4OHZA 3U3RA 3T15A 2UZIR 1D2MA 1XTQA 4TT3D 1QHIA 4EIWA 3R7WA 4LX0A 2H8KA 4TQ9A 1OH7A 2QP9X 2CVFA 3IIJA 4NCJA 1W2HA 1SXJD 2ONJA 3LVQE 1KSHA 3CNLA 5AR1A 4Q4LA 1QHHA 2CCKA 2NOAA 4LZZA 3QKSA 2CLSA 1QG2A 1P6XA 1SVIA 3U5ZB 4JVMA 2DCUA 1FX0A 4GI7A 2ZI9A 3FGNA 3R8FA 4D2IA 4Q1AA 2F3RA 5C1BA 2KWIA 4ZIRA 5FOUA 4XIGS 3QIAA 4NYJQ 2ZM5A 3W6NA 2YZ2A 1G3QA 1RJ9B 4JLPA 1JI0A 4B35A 4HAYA 3W6OA 4D81A 1NVVQ 3TKLA 4IDHA 1QF9A 3GLGA 1UDXA 4IFEA 1KK0A 1J99A 2FE4A 2QTHA 2GAAA 5KPDA 1NY6A 3JVUA 3CKLA 5FUVA 3M0EA 1YZTA 4O2RA 4HLCA 3ICQB 1E2MA 1MABA 2A7QA 3PV0A 4A6PA 3KXKA 1HT2E 3LBNA 4EQ6A 3THWA 1UPTA 3RLFA 4Z1MD 5L3RA 1GG2A 3WMGA 4DDVA 1NBME 3QKUA 4L9WA 2FEMA 3LBHA 4NDZA 4L8GA 3TNFA 3KJGA 2W2VA 3ZVLA 4FIDA 5HKKA 1OB5A 2OAP1 2VP2A 2ZI7A 2EFHB 4YDSA 1U0HC 3M6AA 1KY2A 4XVQA 5GVSA 2QMUA 2D74A 2IC5A 1QRAA 2P2LA 3ADKA 4RZ3A 3QNUA 1VIYA 4KSCA 4Y0AA 4LJ4A 1U8ZA 4KVAA 4D4MA 3FWYA 3D3QA 1KJYA 4C2TA 5E7IA 4MGKR 4PPFA 3LFUA 2O8FA 2HCBA 2C78A 2EYQA 4RFSA 2CK3A 2NIPA 2GF9A 2RH5A 2J7PA 3CZQA 2W6JD 3MJHA 2BDTA 2E87A 3K0CC 2JLSA 1LF5A 3PXGA 4ERNA 1TF2A 3AUXA 4TLDA 1CKEA 1NN3A 1S9DA 4BFUA 2OAQ1 2ZU0C 2EW1A 1E2FA 5IHPA 1NJGA 2FFBA 2F43B 4PO8A 1RIFA 1WE2A 3BBPA 4PSKA 1Z0IA 2WIAA 5GJVC 1DG1G 3UXMA 2SHKA 1XRJA 4HB0A 3RWMB 4D0GA 1RYFA 2RCNA 3IO3A 1RZ3A 1IM2A 4KFSA 1ESNA 3DMNA 4DLZA 2ZJ2A 3EA0A 1SXJE 3GJ3A 1PUJA 2OLKA 4LJ8A 1SVLA 2C2HA 2BJVA 3X1XA 1LB1B 1G6HA 2GK7A 4LSGA 3LXXA 4LJAA 4JKIA 4F7WA 2AL7A 4C7OB 4RJLA 4RZ2A 1EXMA 3IPYA 3ASZA 3U44B 1NNEA 4KYIB 2JLWA 1L4UA 1B23P 1TMKA 3CH5A 3KDSE 1ZRHA 1CRQA 3K9GA 3WP1B 4GBMA 2IHBA 4MRPA 2JLVA 1G7CA 3K1JA 2PL3A 4BLQA 2WJVA 2RGCA 1KKLA 4C4PA 5HE9A 3KQNA 1LY1A 1A4RA 4BZPA 1JBKA 5J47A 2OFOA 3D7MA 3JZAA 5EJEA 4OKSA 4B71A 1UKVY 5EXSA 4A0RA 2G9NA 1FNMA 2B7CA 1XWIA 4M21A 2QQ0A 4F91B 5KNBA 4KBFA 2GAOA 3A58B 1UM8A 1L8QA 1UBGA 3R7WB 4ZDKA 4AYTA 4RD1A 3VR3A 3T5GA 4S35A 4A6XA 2PX3A 3SJZA 1E4VA 5J4YA 1HURA 3PUXA 1II0A 1G5TA 4PTLA 1QHHB 2FPKA 3ZIAA 2KE5A 4B3DA 2WWWA 4JLDA 5A0FA 4WW0A 1KYIA 3FDIA 3HDTA 4GFDA 5CITA 2D06A 5AUQA 1FX0B 1Q57A 3FKSD 4B2PA 4ZKEA 4HEJA 2A30A 1N2CE 2J45A 2IWHA 4XWOA 1IXSB 2FGJA 3O8DA 1KO4A 1U0JA 3OEED 4AYWA 5F3WB 1R4AA 5H70A 3W9YA 4LJ6A 3REGA 1E9BA 3ZQ6A 1FQJA 4DC9A 3ASYA 4AG6A 5CYPA 1QG4A 1S1MA 3GLFE 1YZQA 2ZUBA 2KB0A 4TTRA 4A2PA 1DAMA 3TVTA 3TR0A 4Q1EA 3VKGA 3GLGB 1Q12A 3EC1A 4AY2A 2IYTA 4GOJA 1Y3AA 4J0QA 1G3RA 4QNMA 2VH5R 3RS7A 4PR0A 5G41A 3A1VA 4HATA 4FWGA 4GOKA 4NPHA 5CJPA 5A5GA 3U61B 4CYMA 1MABB 2V6JA 2OEPA 4M1YA 1CRPA 1JB1A 4FN5A 3BAFA 4H9GA 5BXQC 1TEXA 3TAUA 2R6DA 4EQ6B 3THWB 2ODNA 4OHVA 1X3SA 4RD3A 1WBDA 1DAFA 4ZI2A 3ADBA 4US1R 2VP4A 4G5SA 1SHZA 4ZDWA 4DCTA 4HDQB 4ZV4A 4D0LB 4NP6A 2YKGA 1YKSA 1OT3A 1W7AA 4LPSA 2C98A 2WTUA 2CMKA 2ZEJA 2ZJ5A 3EIQA 4A8JC 4IFBA 4FD2A 1MO4A 1UDWA 1XFAA 1KO8A 3OEHD 2BHRA 2KBFA 1ONBA 2D62A 5AWFC 4BQSA 4ACBA 2GKSA 2A5GA 3LA6A 4PANA 5E7JA 4IVRA 1Q22A 2QENA 5JSZA 2NGRA 1BYIA 4XWAA 4DCUA 5BYKA 2R44A 2O8FB 4RFSB 2D7DA 4PC3A 1AKYA 2QT0A 1E2NA 4KO8A 1Z06A 3EPJA 1ZP6A 2J0QA 1RYHA 5B58C 2FFQA 4NYMQ 3GFTA 2V6IA 2XZOA 1OE0A 1YR8A 4A82A 3I5YA 1FFHA 2NPIA 2AKYA 3KFXA 1DAEA 4CZ2A 2ATXA 2P5SA 3BE4A 2FSGA 3LWNA 2OCPA 2XNSA 3NDBB 3MWLA 2J0UA 2LKDA 3T1TA 2HV8A 5DISB 3W8RA 1ESMA 4LHVA 3L2OB 5FI1B 3TBKA 3V9PA 1V5WA 1BYUA 1F6BA 3BOSA 2W00A 4TMXA 2VSOA 1NVWQ 1Z07A 1E9CA 2ZI3A 3MSXA 1HE8B 4OI4A 1EFRD 3SN6A 3ZLJA 3L8ZA 1J2JA 3REFA 1C1YA 3CH4B 1ZINA 5L8VA 1OIWA 1XZPA 2I1VB 2HUPA 2GWHA 4WXPA 2RGAA 3I73A 2Q9AA 1R0WA 2BM1A 5SZHB 2O8BA 3EXAA 1NSTA 1N6NA 4DB4A 2BKEA 4PX9A 2ASEA 4FWHA 4JJZA 4TLBA 4LWZA 3FOZA 2O8EA 2HYIC 3SYNA 2YWGA 4IOJA 3K70B 1KI9A 1KO1A 3FB4A 3RSLA 2GNOA 2G6BA 2F9MA 2ZE5A 1AJEA 3A4NA 4NCNA 4UKDA 3VMFA 2V7QD 3AV0B 3RS2A 4Q7LA 421PA 2QSZA 4OQLA 5CJ2A 4HUQA 2ZE8A 2VEDA 2PT5A 1YHNA 1NIPA 1IN4A 4US2R 1TEVA 1YZLA 2IXFA 5DI9A 2PCLA 4DLRA 4EFMA 4MDFA 2UZ3A 3GEIA 3C4JA 3QQ5A 2G3YA 3MWJA 1NMXA 3GCGA 2XOKD 3TR5A 4QGGA 3T34A 2C95A 5KDLA 4WA7A 1G6OA 5FPHA 1G8HA 1UFQA 2AWOA 3L82B 3UWOA 4GDFA 4Q9HA 3RRMA 5EP1A 3TH5A 5P21A 5TY0A 3MJRA 2WWIA 1J90A 1WA5A 1CIPA 2J59A 2W58A 1VCMA 1S1CA 1XCGB 1T0JB 1XTJA 3N70A 4Q00A 5BWMA 2DYKA 4O2LA 2IS6A 1E9SA 4BFTA 2A5JA 3VR5A 4IXNA 4TN1A 2YC2C 3KUCA 1EFUA 3B9QA 2LKCA 5SZJA 2BWJA 2W2TA 2WM9B 3KUDA 1H8HA 3CIOA 1IQPA 2WJJA 1T5LA 3B1XA 2QAGA 1E1RA 3FMFA 1EX7A 2QPTA 2Q3HA 3OE7D 2GCOA 1N6KA 2DPXA 3O8BA 3P4YA 3BFKA 4DLYA 3KQUA 5F9HA 4LBZA 3H2YA 3MGCA 1CJVC 3GLIE 1MRSA 3DM9B 2XGJA 3GFOA 1P2SA 4DLVA 2YVUA 4GNKA 4DUGA 2QRNA 2VO1A 1HQYE 4CIDA 2FFAA 4GPTA 2G88A 3HYTA 1JECA 3AP1A 4PPNA 2ZYVX 4ACAA 1R0XA 2O0HA 5DI3A 4NE2A 1FTNA 1YRBA 2FZLA 1QZXA 2FPLA 5JRZA 5EP4A 4IHQA 2FMXA 2JGNA 1NSFA 5JEEA 1JJVA 4LHYA 2VP9A 4GOXA 5CK5A 5EE5B 2AD5A 3Q7PA 4E22A 1KTVA 5JECA 1EFCA 1P61B 1OXSC 1GL6A 2AX4A 5JJKA 4GMDA 5TARA 3FMPB 5GJWC 1SVSA 1YZKA 5LBIA 2YOGA 5JSZB 1W2GA 2FF7A 3K9LA 1P62B 3NBXX 3GPLA 1AS3A 1CR1A 1GNPA 3I62A 3B2EA 3CR8A 2J0SA 4L9SA 2OCYC 3NEJA 2WSMA 3QG5A 1NL3A 3QXCA 4NCKA 3CLVA 4P31A 3UMFA 4B6EA 5KNDA 1E98A 2GJ9A 2ERYA 4DEXA 1J8YF 4FCVA 3SFVA 1NI3A 4EPVA 1OV4A 2VIIA 1R8QA 2HLDD 2OBLA 3TUJC 4JLVA 3V4RA 4YXWD 3MCAA 4BLRA 4M2LA 3OIVA 4TLAA 1Q20A 3E70C 4JYCA 4UJ3A 8OHMA 3LX8A 2ORWA 4QJ4A 1KSGA 3WYFA 2GILA 1FQKA 1OIXA 5EE1A 2XB4A 1Z0JA 2Q6TA 3IEUA 4MRRA 1PV4A 3BC1A 4BRUA 2Y8EA 2C04A 3SU8A 4PSVA 5IRCD 4TYWA 1I4TD 3Q5DA 2JASA 2XNDA 4TTPA 4GSYA 1IJFA 1XNJA 1FMJA 2O8BB 3HU2A 4I1UA 1DG3A 2O0JA 4I1SA 4DWJA 3M4YA 1F48A 2JJ1D 1X86B 3P26A 5JCZA 1KI4A 2IS1A 4ILEA 4QHSA 2Z43A 2H92A 1U94A 2OSBA 4IRUB 1S3GA 2CCJA 1VCOA 4UXIA 1SVWA 2D3WA 5J5CA 3LD9A 5KSYA 1A2BA 2PX0A 2ZSBA 2OT3B 4RD4A 3PUVA 1XTRA 4NYIQ 1QBKC 5LB2A 4HUQB 2DB3A 4OHYA 5DHFA 2R2AA 1MRNA 2VPPA 1XEFA 1OFTA 4UNQA 1Q21A 4XSHA 3G0HA 2GEUA 1CTQA 4W5JA 4DLXA 2ZE7A 1E2GA 3ECCA 3EWAA 5CM9C 3ZD7A 2WOJA 3W8NA 1T8UA 1N6RA 1D6JA 1SHKA 4Q5IA 4BLOA 3Q85A 1DO0A 2FSFA 1HA3A 2VHUA 4D80A 2CNWA 1ZIPA 2ODBA 3C5CA 4IDNA 4ITRC 4Q66C 4YDHB 3AF1A 3CWZA 4EAQA 5FBQB 3UMSA 2AXPA 1M34E 2C8VA 2YOFA 3MUFA 5B57C 3KTAA 3EA5A 4EFNA 3UKDA 2QW6A 2CHQA 2ZRKA 4LK2A 1MO6A 4PHFA 3K09A 1HTWA 2XTZA 3AF4A 5FUXA 4PAMA 3CM0A
chains in the Genus database with same CATH superfamily
1CYDA 1DDOA 4BFYA 2QAIA 3QOYA 3QPUA 5DMHA 1R6DA 1WB9A 3C8DA 3GGDA 4DCVA 2O01F 4QRDA 4OLAA 4KR2A 3NTOA 2KRKA 2NQTA 3K2LA 3WADA 1KVSA 1CR0A 4KXUA 4F71A 3O21A 3HUDA 5A62A 5LU8A 4G86A 4C6SA 1E2QA 4RZSA 1JDUA 3U56A 2OLEA 4CM9A 4DG9A 2H2GA 4WESA 3CNQS 3NTVA 1DTWB 1GJRA 3MVEA 3UJBA 1LBEA 1KVUA 4XWWA 1OFGA 3BH0A 4LDQA 2OGWA 1WD5A 1T0UA 4NECA 4EDHA 3LLVA 4AXXA 1FS5A 1AS2A 3AM4A 3T5DA 5CX4A 4EVRA 4ZALA 1NRJB 5GQSA 4JGIA 1C9YA 2G5GX 2X19A 1J70A 1Z0FA 2QTGA 3F4LA 5C4GB 2XQJA 3LSTA 2P2GA 3S5JA 3IR6A 2RE8A 1IULA 1ZIYA 4D4HA 1P60A 2RKOA 1HYQA 3IVRA 1CXZA 1PWXA 1Z63A 1HNZB 2NZ2A 3SJBA 2TMYA 2GZAA 5J23A 2SNIE 4ZT7A 4EI8A 1RZVA 1C1HA 1MHTA 1JEEA 2RC6A 1O6GA 2JIZA 4IJUA 4NARA 1QCYA 3FZGA 4AROA 2NP7A 1PNTA 1TH3A 1WUTA 4Q9KA 2YHAA 3C3CA 3MM4A 4OLBA 3ELUA 4MW4A 2XCIA 4H18A 3ZDBA 2QUJA 2R11A 3OKPA 2WMNB 3C7DB 4IIJF 1NP3A 4YRIA 1BKDR 4WESB 3MUNA 2QMEA 1YB4A 3SFTA 3ZCPA 1SKMA 3ORYA 3EVFA 2CBZA 2C5HA 3B38A 1Z3CA 4EG1A 3U4AA 3IOBA 1QIEA 1HY3A 3F1LA 1QORA 5IVPA 3EXEA 1JZSA 4NFSA 2GD1O 1HE4A 1AKQA 4ZHSA 1C9DB 2F3QA 2ZB2A 1VGVA 3GBPA 3ZWOA 1R37A 3KHKA 4FNGA 2X8WA 4KBYA 4E32A 4OP2A 5DHRA 2Q4EA 4KQHA 2EC5A 2BBWA 4J0CA 4XDHA 2Z58A 1Z6YA 4UFPA 3I3SR 3PNBA 3GPIA 3L49A 1LD3A 4CR7A 5A2QA 3LDGA 3KWMA 3U80A 5DIZA 3F98A 4JUIA 2VQDA 2XTMA 3G2KA 3U7IA 1I9CA 1N2EA 4ZCRA 5BR8B 1GL3A 1MV5A 3NHYA 1G8FA 2Q5EA 1VPVA 4QGBA 1T0HB 2QV7A 1TZJA 4CLEA 3FF1A 2BGNA 4QBFA 2ECFA 1PFGA 4Y1GA 3CZMA 3KZOA 1G64A 1S89A 2ST1A 4DPKA 4UTPA 1NVFA 2QE6A 3OPYI 3OHPA 1M0EA 2ZBEA 3N2YA 2I55A 1G3UA 1XJQA 1WCXA 5HUJA 2Z1DA 2IT1A 4M7PA 2VYND 1I0ZA 2QQEA 1N34B 3HU3A 3WIDA 1UPUA 4W8HA 3LPLA 3EXEB 3U9TA 1W36C 3KJHA 1DJNA 1BHSA 2K7FA 2I22A 3ZH9B 4HTFA 1XQ9A 3FMVA 1K08A 1MH9A 3UO8B 5A1JA 1NVVR 1HE5A 4TZ6A 3DMPA 5F35A 3U5TA 1HDIA 1HNWM 1GR1A 2CNOA 2NM0A 1A88A 4JQCA 3KSMA 2DUNA 1XAIA 4TMZA 2KSQA 1OUMA 1C7FA 3ELBA 3FLBA 5FH9A 3PHLA 3V97A 3B6JA 3E9ZA 5G40A 4MVJG 3WIEA 5CFRA 1QNFA 3D4OA 5JU6A 4LZPA 4NZPA 2POCA 4W9RA 3FUUA 2VL7A 3KYIB 4PLPA 1ZESA 4RNAA 1N0UA 4JNCA 2X8JB 2DAPA 3P4XA 1YKGA 3SBXA 2VHXA 1GLVA 1E2DA 4H3HB 2VZ8A 3LDFA 1B1AA 3E35A 2W6QA 3OY2A 3SGLA 4MW7A 3WAJA 1XZNA 5C7IO 1YR7A 1UBUS 1WMAA 1QQTA 4BNVA 1RJGA 1O5OA 1P4GA 1U1DA 5ALEA 2WG0A 1ZNQO 2GXAA 3HCDA 2IOQA 2C2MA 3O7MA 1UMBB 5IAAA 5EHXA 4Z4QA 4HTFB 3CTPA 3C8MA 4GZ6A 4LYAA 1PNOA 2HMAA 2BKXA 2BMJA 4HAUA 4J4HA 2IY7A 5A6VA 1S3IA 5T4EA 1VZ2A 1O9HA 2AMJA 1Q1BA 1MVLA 1QIDA 3HI4A 1WNFA 1X8KA 2IGTA 3ZCTA 3VNUA 3WSVA 1HDRA 2QP3A 2RFLA 1EVIA 2ADMA 2JHPA 1B0AA 4Y9RA 2XUFA 3KOYA 2UZ0A 3A9RA 4M8NE 3IQXA 2GOYA 5JYDA 3GFFA 3UMMA 1MO5A 4FWBA 5FOTA 4PVDA 3TL3A 3OFND 1TAGA 3FNRA 1KZ6A 3WLPA 1HEYA 2VQFM 3ZN2A 3IECA 2WU8A 1L5FA 1YI0A 4GH9A 2GEVA 2CXXA 2FWNA 3FVWA 3BDIA 2X9QA 4OF4A 4KE7A 1ICIA 4LN1A 1OGYA 2JVJA 4C1NA 3HP7A 4GEGA 2DULA 1VHJA 3X1WA 4NNJA 2JWSA 2IA5A 2I4TA 1VOTA 5KQGA 2QHOB 4F6RA 1NJSA 4MJXA 1N3BA 1S2GA 5COAA 4XX0B 2Q8PA 2WIFA 4RTNA 2ZDGA 3A2LA 3Q6NA 2WKRA 1VGQA 2KNZA 1S2MA 2W6NA 4DJFC 3DE7X 2DG2A 2C8JA 1COWD 1DQSA 2ZR7A 4U8GA 2HDNB 1HV8A 1EUQA 2Q3FA 1BW9A 4ZVNA 1TVCA 4KJXA 4BGEA 4N47A 2QCUA 1EB9A 1WUHS 3HCCA 1G8GA 3O95A 2Q3EA 4DMMA 2UKDA 1XKTA 3NHBA 2PM8A 4OJTA 1ZMVA 2L19A 3L0OA 1FS4A 1TR8A 3N2EA 4K81B 2D0IA 3OF2A 1RVDA 1L5OA 3S2SA 3L1IA 4G1UC 5HGXA 4XUCA 2XZTA 1NQUA 3HHEA 3G2NA 3PQFA 4K9QA 1R64A 1ZAKA 4H6PA 5IEJA 3I4VA 1LFAA 4EB0A 3QYAA 4DNPA 2YY5A 3H9UA 3D6VA 2R4EA 4MI6A 4Z2AA 3NBYC 1AHNA 3QSYA 1F6WA 2QM8A 3GJRA 4F6RB 3PUWA 3RLIA 2GQFA 5LDGA 1KI8A 1YL7A 1GAJA 2J31A 3F5FA 3X3HA 1FFAA 1RI4A 4HAWA 1FMLA 3TCKA 5TR9A 2A5FA 4Q05A 3C14C 1KYWA 2Q3JA 3K8OE 1BW9B 4PWZA 2Z4SA 3MHPA 4Z1MA 4P3YA 2OKCA 3IUYA 4TVKA 2BMVA 2HMTA 2ONCA 4L51A 2Q46A 1AVTA 4MIOA 4OW0A 1L5LA 4OSEA 1GPAA 3CVYA 1DQZA 3QPDA 4ZHQF 5HZKA 1BCSB 3HL4A 5K3CA 3MNFA 1V3TA 5EXPA 1FNBA 3V2GA 4BNYA 4F6LA 5A6SB 4Y2TA 2FWRA 4RDHA 1FSGA 3GJZA 4O25A 4IBBA 4U0KA 4GHAA 4JY7A 4DJAA 5FA8A 3WLRA 4FXPA 3VC7A 4I1PA 2WWTA 1V8FA 3AOEC 3IAS6 1RNLA 4JQSA 3FJYA 4D57A 4M4SA 5AESA 4ITVA 2O3UA 1UJ4A 1WQ1R 5G0WA 1ZUHA 5G0TA 4KKVA 4ND6A 2MSCB 4G0XA 3QHQA 5EMJA 2ZRNA 3C5EA 3BGIA 3HUUA 4G8DA 1JG1A 4F97A 4US0R 3E81A 5HCIA 3QE4A 1T6YA 1M6EX 4BTEA 4UREA 2FMKA 5KNCA 2NUBA 1V9CA 2DMRA 4X66B 4MAAA 4HLDA 4HXFB 3NHPA 5E1DA 3RFCA 4BKMA 4JI2B 2ERXA 3INRA 3PWZA 3I2IA 4RABA 5ECDA 3HNRA 3G2LA 4PX2A 4ETIA 5K3OA 3EIFA 1E5LA 3BXEA 5LZ2A 3Q8XA 5BNWA 3TQQA 4XD7D 1AMNA 5DHUA 4EITA 2OC9A 3UH1A 1PJ8A 1SWWA 3HCEA 3OT5A 4J0GA 3KB8A 3L5OA 3P2JA 4OL9A 1JDBC 3WJ7A 4YT5A 3AIKA 1E3TA 3LCRA 1J5EB 3M1YA 2PJUA 3I9FA 3K1ZA 3MIZA 2EP5A 1GRQA 2XOKA 2OY0A 5GGYA 1HDYA 2J3JA 2P11A 3IEVA 2EGUA 1OH8A 3RSSA 2OBMA 3U5ZA 3NHZA 2WTAA 3H84A 5AD1A 3RVNA 1PUIA 1NR5A 3UPTA 4IRMA 3IO5A 1PFQA 3ISTA 2JKVA 5EVCA 1IBRA 3A14A 2QYHA 3KSUA 2I8AA 4AUEA 2WT4A 3RC3A 3A9UA 5IKOA 2ZUEA 1KDZA 1KFEB 1XYYA 3DS8A 5EKXA 1HNZM 1M34A 1GG8A 4ENQA 1P0CA 1XU4A 3PEWA 1IUNA 1JEJA 1J8QA 4B7HA 3E9EA 5C7YA 4K6HA 3NYWA 1XA4A 4NRWA 4B4OA 2QPLA 3W3AD 2WJZB 3E21A 1ZN7A 4ZO4A 2E4UA 4V0ME 5J5VA 3P9XA 3Q8XB 3RKUA 3UTCA 3Q88A 1QVAA 2HR1A 4WEOA 1U4SA 4LAFA 2BCGY 3BFXA 3DDOA 1US8B 2H18A 2BMWA 2M2IA 3PUKA 4JB2A 1SOWA 4ZAXA 1HBJA 2Z3XA 1EESA 3ONFA 3WA7A 3CTDA 2MMGA 3AJ9A 2R8OA 3D6NB 1XZEA 3WIVA 2ON6A 4G5GA 1FSPA 1K3WA 1GUZA 3NOOA 2IHJA 5J4HA 4LYJA 2ZBPA 1DXHA 2VG8A 2IYYA 1I1NA 2ZWVA 3VDNB 4AY5A 5K7SA 2N35A 4MUNA 3CUKA 4LX0A 3KBBA 1BKYA 5AR1A 4II2A 1GHTA 2V58A 2CLSA 4BNJA 3U5ZB 1Y5LA 2PRYA 1YR3A 2XD4A 2O3SA 1Y4ZA 4ZIRA 5FOUA 3I9OA 2H07A 5EJGA 1VI6A 3BFPA 5C52B 2C4HA 2HA3A 1KK0A 2GAAA 1NY6A 1KA9H 1M34B 4ZZ1A 2Q5QA 3C6ZA 3V1UA 2JY8A 1HT2E 4Z3KA 3VZDA 4CIWA 1V47A 4RE6A 1SD2A 3NPMA 1Z18A 3LBHA 4HWTA 2MOKA 3GFVA 4KPUA 3ZDFA 1DFGA 1L2DA 8ATCA 1QRAA 2NV2B 2VWPA 3AG5A 4Y0AA 3CE6A 3E8SA 3ENWA 2HCBA 1XAJA 2BDTA 1U3TA 1SCJA 1LF5A 1V6SA 3PSAA 2FQYA 2BUAA 3ZY4A 3AJAA 4CN9A 2WSLA 4D0GA 2J3KA 1RYFA 1RZ3A 4KFSA 1RQNA 1AA6A 4DLZA 1TKRA 4EI9A 2XB8A 2YCBA 1NJ5A 4N41A 2WM3A 1G6HA 1QBGA 4MEBA 4GC5A 4L22A 4TM8A 1N34M 1V5FA 4ER0A 2CLEB 2Y1EA 4ARUA 3AV0A 3AETA 1JBKA 5KAPA 5D86A 5EXSA 2JAWA 4D0RA 3Q7SA 2IHUA 4HNAA 3W5UA 2W8BA 4AYTA 3T5GA 2PX3A 2FMUA 1E4VA 5J4YA 2VRBA 3RVOA 2ARKA 3TTXA 1K7SN 3TNLA 1YO6A 2NPOA 4ZKEA 4G1MB 3QU5A 4CM7A 1EJ0A 2GFIA 1VLVA 3CPSA 2QUBA 2Q3LA 2H4YA 2V6JA 2R6DA 4U5QA 4BYGA 4GX1A 1QYRA 2XRYA 1VLZA 3JQBC 1VKOA 3EVZA 4RJ2A 4HDQB 4ZV4A 2CUNA 1QP4A 2MR9A 1MO4A 4DLLA 4KPUB 2J85A 2IH4A 1T36A 1Z5OA 2NVOA 4YP5A 1NJ2A 2OYCA 4A82A 2OQVA 4CV2A 2N3ZA 4Y9TA 4DV0B 1RM0A 2NN3C 4B83A 1FF9A 5FI1B 3V9PA 2CJFA 2FHSA 3OUZA 1PK7A 3LBAA 5KQPA 1Z74A 3CH4B 1UPFA 2BM1A 4NE7A 3ONDA 4CODB 4C89A 3RSLA 4MVYA 3FNEA 3AV0B 3AETB 3D1VA 2Z2XA 5JAQA 4RPJA 1NIPA 1IN4A 3C4JA 3MC1A 2W8BB 1P91A 1VXRA 4G0QA 3C5VA 1THTA 5KDLA 1C1XA 3DT6A 3G2QA 1ZLYA 5EP1A 4GMHA 1GGKA 5P21A 4K6GA 4QYTA 3OM1A 2WM8A 4JMLA 5H3CA 4IL5A 2WM9B 1X9HA 1AGYA 1CCWA 4J6FA 1PJAA 1BDHA 5KYXA 3WYEA 2CYBA 1WIWA 1P2SA 4BP1A 5AK5A 4GPTA 2J08A 3QWLA 4WERA 1RXCA 4R5MA 4LCJA 1P9OA 5AHOA 3TRHA 1JIXA 1JIQA 3E15A 5JECA 1HTTA 1OXSC 4O6VA 3HU5A 2HLHA 1JYSA 5LBIA 1T36B 1Z2EA 3Q7RA 1CR1A 1S7GA 2FUNB 3CR8A 4EY8A 4K03A 1Q83A 1NL3A 3WK8A 4F84A 2XA9A 4NLLA 2BSQA 1DEOA 1R8QA 2VIIA 2VYNA 1CUKA 1MV8A 1DX6A 3OIVA 5DJ5A 1JG3A 3VSEA 2GYVA 3WYFA 4B4UA 1FQKA 2DFPA 1Z0JA 4RH1A 3LCCA 1RLOA 2C04A 2ZT5A 1ZL0A 6ABPA 3LO8A 2Q2QA 3AO0B 3GLUA 4MJ3A 1FMJA 4RGQA 5CDGA 1JSXA 3WSWA 1GTMA 2IP4A 2AMVA 2G09A 3FYCA 3OLQA 1DV2A 1MRNA 2QZSA 1TXGA 3G0HA 1Q0RA 2WOJA 3QSGA 2OV6A 1C1XB 3RK1A 5EJIA 4D80A 3E3AA 3QFHA 3ZHUA 3HMKA 5ALQA 4BY9E 4IX9A 3PWSA 4PN3A 3IDFA 4IYJA 5MFZA 4ENRA 2ORED 3EIWA 4AJJA 1D07A 1QDEA 4Q3EA 3KWFA 5FULA 4BU1A 2QN7A 3QE0A 5FRDA 3M1IA 4UU0A 3EPRA 2MINA 3CQ9A 1DKOA 4P4TA 4B81A 5CDFE 1JU3A 3L43A 4ABYA 3M33A 2PKRA 1AXGA 3I1YA 3UMRA 1BAPA 4PONA 16PKA 3FE2A 2VHCA 1W94A 3AV3A 3KO8A 1DADA 3H9QA 4CCAA 2Z5VA 1OMOA 1BN7A 3FLMA 3VJMA 3E2IA 1SOMA 3PI7A 1FXSA 1GFIA 5F7ZA 4QHTA 3ESBA 3BQNB 4RZUA 4O4JA 2BHSA 2XMQA 4I50F 4MLCA 2ZETA 2PSFA 3IXLA 4MHOA 1EX6A 1SZCA 1R12A 5CMLA 3KZKA 4Z4CA 1D4ZA 4GXRA 1PL7A 4I6JA 2M1XA 4LGCA 7MHTA 2E49A 5K8LA 2ACWA 1O5TA 1OLOA 3JQ9C 3T1OA 4MP8A 1XMIA 2DRIA 1KOFA 3ET4A 1VEKA 3ZCBB 2QTZA 4MICA 3U3OA 1F8FA 1MKYA 3ZEAA 4MYRA 1ZAYA 2QRGA 4B6PA 1JFFB 3RGPA 1BA2A 1ZMWA 3H04A 5ADVA 2WMYA 2JC3A 2QRJA 4EGSA 4V0KA 3INGA 5M7EA 3OFNA 2G67A 1LDNA 4M9UA 2MINB 4IBEA 2VQSA 4B3XA 2L6OA 4YQFA 1AGPA 5BO5A 2PY6A 1G3IA 3WLFA 1WZ2A 1R18A 1SQ5A 2YXLA 2UZ1A 3CINA 1D4AA 5GONF 4YCLA 1YI8A 2WAOA 4GYYA 4ZGBA 1EFKA 4UVDA 1F8XA 1T3GA 4Q19A 4E07A 2HI0A 1CEXA 4DCGA 1NLMA 1ORTA 4D4KA 1XPRA 4FFVA 2HXSA 3E5HA 1TJ4A 4UHDA 4LNUB 3VYTB 1GQFA 1L7DA 4Z4HA 4O4JB 1MTZA 2QUIA 3SOPA 1M74A 3IDZA 2I99A 3EWIA 4JIGA 3TB4A 3W2EA 1OFUA 1PTJA 3B20A 2H5IA 3Q5GA 2OGSA 1H0HA 2RGRA 4AKGA 4AN0A 2HJSA 4PTZA 2QUKA 2XAAA 1COWA 1I7NA 1XMQB 3PR1A 4LJKA 4CL2A 4QQKA 2XGGA 4TS3A 5DYNA 1C4XA 2QSUA 2J32A 4EHFA 2R96A 3ZX4A 3DKKA 3A1WA 3NBQA 4AKIA 3ZDXB 1X8JA 1KMCA 1UC4B 4PGAA 3MOGA 1R8JA 2WYWA 1TK3A 2Z4TA 4Y98A 2ZIXA 1VFPA 1JA0A 3OD5A 2VRNA 4QGSA 3VR5D 4JLBA 4X66M 1CY7A 3N0VA 4OPMA 4WFKA 5F9FA 4ODIA 4BL5A 4UAUA 1YBAA 2F67A 4G24A 5K45A 3AINA 5ALYA 1D2EA 2Z98A 2UZ1B 2QMYA 3MERA 4EJSC 4E4YA 4BO7A 1K5PA 2D5BA 2XAUA 1MJHA 2BDEA 3HCOA 1V5IA 1IVYA 3BWXA 3RODA 2DQYA 2GEDA 4GPD1 4AX8A 1E96A 4CL0A 3TRFA 1OD6A 3RSOA 4BHTA 1S01A 1EWRA 1CJCA 1J5EM 3VYWA 3ZS8A 4Y2YA 4IDFA 1WMBA 3SF0A 5K6RA 2VQ3A 4O5AA 6NULA 1ACLA 5MDHA 2I4MA 3QW2A 4NYJR 2REQB 2I2WA 5JD3A 2N46A 4RVCA 4Q15A 1QFJA 3TOXA 2O23A 3O4HA 3W90A 1URPA 4LY6A 2OFFA 1IY8A 3K09C 1GGVA 4OK6A 4Z6KA 1CZOA 3PHBE 4RCZA 4HAIA 3BL8A 3A4LA 3H19A 1H22A 3L4BA 1HMPA 4G4QA 2ZIXB 2MSWA 3IAHA 3VPSA 2ZRAA 1P81A 2W43A 4UEWA 2IYWA 3FTFA 1EP2B 3WL4A 2PU5A 4K05A 1PHRA 2JCYA 4RS4A 3MWKA 1D9ZA 2C94A 4NOOB 1QF6A 4RPCA 1QR2A 4RH0A 3FVQA 4P7GA 1XMVA 4KG7A 3D9QX 4U7HA 2EZ8A 3K9FC 4RAQA 2OHOA 3AVPA 3ZQKA 1LBSA 5E2IA 3UMYA 2BR5A 3R76A 1USVA 4L8WB 3AVTA 2NQ2C 2YWDA 2X3UA 3Q7TA 8LDHA 2HB6A 1P3QQ 1HL7A 1PT7A 5FHQA 4DQKA 5KWVA 4INJA 2EHJA 2GO1A 3MTQA 1IBLB 1GNQA 2DLDA 2IIBA 1BG6A 2RHLA 3VPFA 3HUTA 2VK8A 1RQGA 1MAAA 4KNWA 3AR4A 4IXDA 3LP8A 3EUAA 2OGTA 2ECPA 2ABWA 1BH6A 4GRAA 1H2YA 1IDN1 3A0RB 1QANA 3EZ7A 1E3MA 1RLMA 1EZ4A 3N2ZB 1FDOA 1NTOA 1L5HA 2FWPA 1RJ9A 1AQIA 2QRUA 3KPYA 4ZOLA 4AECA 3P9CA 3M9LA 2H0QA 5BW4A 1KE2A 1KHTA 1Z6TA 4HB4A 4XD7A 1JHOA 3JQ8A 1CUEA 4JUFA 1NNJA 1J06A 2Q49A 4HPXB 3LO5A 2FSVA 1NF3A 4YIKA 2BFFA 3P0FA 2Z9DA 2A4MA 2WZCA 4R2KA 1G9SA 2LNHC 1LW7A 3FYSA 1P9NA 5EZYF 4A16A 4O0LA 1UK8A 5BN5A 4YCJA 4MCJA 3KSAC 4DZRA 4AIRA 1ECPA 3AERB 1U9ZA 2HK9A 4DCJA 1GPNA 1W1WA 5B7GA 3HNOA 3P7MA 5ITZA 4Z3DA 1TLFA 3BULA 5IKEA 2H1OA 1JIUA 5JNWA 3ND5A 3L2AA 3LTEA 3MT0A 2LBCA 5G3YA 4YLGA 4RIIA 1OZGA 2QU8A 2FH0A 2IYQA 4ZO7A 1AURA 4PS0A 1U2QA 1L4HA 3LQ2A 3VPBA 1C41A 2C96A 1LUAA 3H5RA 2JJYA 3B6IA 4FOSA 1YOBA 4M54A 4IS2A 4URUR 3A1EA 1T1JA 4XZ3A 1ZU5A 3ZU3A 3I23A 3H9BA 1CFZA 3QELA 1CJUC 1VDMA 1C7IA 1ZYUA 3B74A 1L5HB 4HJRA 4DLAA 4KXXA 1Y7IA 2GUGA 4DLWA 1YTUA 1M6WA 3Q0EA 3W3AA 2GBCA 1FLVA 2V4ZA 3H97A 5FI0B 1WXXA 4AT1A 4Y30A 4B1FA 1YZUA 3QFTA 5JI2E 2PUGA 2RB5A 1VGRA 3V4LA 5EQDA 2NXWA 5LZ4A 4YRAA 4CEJA 3GJYA 2P6NA 1I8TA 5C37A 3ZBUA 4E31A 4LJYA 3OESA 4Q9JA 2BFFB 1XX6A 4CXMA 4FCCA 3SZUA 3S81A 3KPUA 5BN5B 1W1IA 4DV0M 3SC6A 4C3UA 1ELOA 4PZLA 1NBHA 2PIDA 3LQRA 1PU2A 2ZRJA 1X1BA 1R0YA 4L3WA 5ITZB 1PD1A 2BY4A 2XIQA 3QHAA 3ETDA 3FI9A 1YE3A 2ZAMA 4BQIA 4PQYA 3QW4B 5CLIA 4JDPA 4JXJA 1Z8HA 3GQBA 3GT3A 3QVJA 3Q9UA 3QELB 4JC5A 2PQ0A 4JVNA 1X7YA 2XOEA 1E0JA 4KQ6A 1A04A 5K0FA 5LYYA 4RFLA 4CKCA 3MHVC 4LDAA 4R3DA 1YBVA 1V96A 5KWSA 2WICA 3G5MA 4ZRNA 1FJXA 1UEJA 4HUTA 4ZP1A 1EWKA 1ZPDA 2AEFA 5HE8A 2GS9A 3RREA 5L3SA 1SU4A 2Z56A 4F4FA 5HJ5A 4CEJB 4DV7B 4CL3A 1IYZA 4F45A 2I6UA 2A2ZA 1X92A 1FE8A 3X1DA 2WQ7A 3N2IA 1JLSA 3HDGA 2DFNA 2B4AA 2C82A 3HCNA 3GZNA 1LPOA 1UAAA 3IYLW 3BSWA 4NX2A 2P9HA 3C41J 5TMDA 2NAPA 3E9NA 2XEDA 1P2DA 1LQ2A 2ZRQA 4FWTA 3JYLA 4KR3A 1PR5A 3V9AA 1YFKA 1TQ2A 1Z7GA 5KJ6A 1FNDA 1VLLA 4QQFA 3QVGA 1XGKA 1XJWA 3PUIA 2YWHA 1CUJA 4MCAA 3HI6A 1ZCAA 3NTLA 4PDGA 3SEQA 3STUA 1WXWA 2J30A 4JITA 2HWYA 3GQBB 5FCDA 3H9CA 4I5GA 4OVZA 5H8WA 1KPHA 2BF4A 2GQ0A 3I45A 2ECOA 4UD6A 4BJ1A 1X7YB 1JBEA 2ZJ1A 3VNSA 2O52A 1E0AA 3LWBA 3IUQA 4CKCB 1DL5A 1SBZA 3IEKA 1M2JA 3MJTA 3IFSA 1N3IA 1IJBA 3HB4X 1E6CA 2PXXA 2F8TA 1JEAA 3TOCA 4V2UA 1ZM7A 4EW6A 5L3SB 3MMSA 4J2OA 4ENPA 1EQUA 3B3AA 3UG7A 2PCJA 1EE2A 2PZGA 5I6DA 3QLTA 4JJFA 2PLAA 3RG8A 521PA 4IBIA 3TNYA 2H2AA 3ZE1B 1X15A 3GZNB 2CWBA 4YP1A 2WAYA 3KSZO 2O05A 2HT1A 1PJRA 1K66A 3QENA 4CBVA 1E2JA 4TL8A 4YRDA 3IBFA 2W2PA 4DYHA 5DASA 1O9GA 4ZQIA 2VK4A 5FTWA 3ZDDA 1P1IA 5HKLA 3BKXA 1U0EA 5IVKA 2GPBA 1TUGA 1FOEB 2GJ8A 1ZH2A 2HRCA 4IUBS 3HCAA 2PZEA 3SC3A 1IM5A 3T12A 5IT9S 3T99A 1SC1A 1P73A 2L09A 3ZHRA 5AVXA 4XUDA 4KRXA 5K9ZA 3IKMB 3KVVA 3UAOA 2O7NA 5CAEA 3M3DA 1V25A 1ODSA 4HEA1 1EK2A 4DBGB 1ORDA 1M8PA 4X92A 1UC5B 3PQ8A 2VDQB 2EP8A 4E09A 2GAIA 4HL6A 2C4UA 1DQRA 3M34A 4CMIA 2UXDB 4PQGA 3KVWA 1ZSYA 1SXQA 4TSRA 2D5CA 5GOTA 4OU4A 2RKBA 4QTXA 1CF4A 2EQBA 4ZOCA 4I55F 3KP0E 1V9SA 7MDHA 1U7WA 3TEFA 3PQEA 1P44A 2H1VA 3O8OA 2D3TA 3EPLA 5CLJA 2MJLA 4C2BA 4YPFA 2V8BA 3PE6A 4AO7A 2Y71A 5FR2A 1YXMA 3AEZA 5HZGA 3MD0A 4G8CA 4IIEA 4OI2A 4QNRA 3OKCA 3I1IA 1T1RA 1DMSA 1UXOA 3OQOA 3ME5A 1JHMA 3TIIA 3UHJA 1F1BA 1XMQM 4KQXA 1Z59A 3ZLUA 1TIPA 2NOAA 2YN0A 4FLEA 1QG2A 3DMTA 3WLOA 4KO2S 3R8FA 4RENA 4MQEA 2QSFX 4GZ5A 2PS0A 2KWIA 3E4RA 2D5AA 4XGQA 4E21A 4D81A 4MWGA 4BMSA 3CKLA 2G63A 5CAEB 2A7QA 4ND1A 4FX2A 5ALJA 3SEZA 4R7GA 1SQ6A 2FEMA 2B82A 1RHJA 3RFTA 4CMIB 1KY2A 5GVSA 3H5WA 3ADKA 1GZHB 1A5AB 3KPVA 4BP3A 5C8XA 5DCLA 2VYVD 4N48A 3D3QA 4ISCA 5JPCA 4TLDA 4ZCPA 1NN3A 2R7LA 3ICPA 3MTJA 1M5RA 2YH2A 4F5DA 2O8NA 4N5NA 3CT4A 2QN1A 1QK4A 3O8OB 2IZZA 1PUJA 3CZRA 2AG0A 3ZXUB 1BX0A 4ETMA 5CVJA 3NNNA 3ISJA 4HYTA 3ASZA 5EEGA 2JLWA 4LRQA 1OA0A 3OZRA 1YVUA 4QIHA 4OKSA 1WOYA 4UFNA 2B7CA 2B1GA 4NAUA 4B85A 3QTLA 2HWWA 2I2CA 4B3DA 2WY2D 3KYDA 3OC6A 1R8YA 1N2CE 3Q3CA 4MQEB 4YNBA 4AYWA 1U0BB 4FC6A 1UCFA 1N7IA 1L8XA 3K8QA 2QN8A 2KB0A 1IG0A 3CVUA 3TVTA 5KU7A 4TRJA 3FOAA 4PR0A 1RACA 2D7HA 5A5GA 4GVPA 1CRPA 3GROA 2ODNA 2WUFA 3F78A 2LVNC 4US1R 4C87A 4KWIA 4TV8F 4CLOA 3TZKA 2X8JA 3USES 3G0OA 2GKSA 5AHXA 3N1UA 1M1XB 4YP0A 4OH1A 4YRJA 2J0QA 1HEUA 2XZOA 2CXUA 3QVKA 2O2ZA 1DC4A 5JATA 4LDPA 1AK9A 1YDHA 3GG9A 3W8RA 2ZZNA 4YT4A 4ZICA 4EA7A 1T8SA 3MSXA 4AS3A 2BEUA 3W4IA 2HUPA 2PFGA 3N75A 3M3PA 1QFYA 1IBLM 2ASEA 4FWHA 3T7SA 3FRJA 1O57A 1NVDA 3H17A 1LTMA 4MW9A 1UMBA 1YQQA 2EKKA 1R2ZA 2Y67A 1QQ5A 1L5YA 5DI9A 4OJYA 3VGJA 3TR5A 4OO3A 1G6OA 5FPHA 2CNBA 3KYDB 4OSOA 1PQ4A 3TZQA 3TH5A 4U9UA 3R6DA 4EA8A 2HHJA 2XCTB 4BFTA 3VR5A 1GA1A 2PRIA 1ZK0A 2D1FA 4OGWA 7AT1A 3EEYA 2FETA 3JU3A 3QOWA 1CJVC 4ZXPA 1ZD4A 4L9AA 2FFAA 4UVEA 2C0QA 3CZ5A 1E20A 2P68A 3FTNA 5L53A 2PMFA 4CLOB 5JEEA 3KQWA 1XQYA 4G0OA 3N9IA 4IIHA 2RHJA 2SKCA 3T3EA 3WB2A 3C1UA 3NEJA 2WSMA 3RFXA 1MPXA 3QBJA 2GKGA 3N0XA 5I01A 3PHIA 4H0FA 1Q3KA 1J20A 5K03A 3DTYA 3CLUC 3JAKA 2BEUB 3IEUA 5K4GA 3LHKA 4TTPA 1DZ3A 1W9MA 4ALNA 4I1UA 1WVGA 5L6LB 3OICA 1S3GA 4DY4A 1BNCA 2C7BA 3H2KA 4UXIA 3HFRA 2GN0A 2OT3B 4NYIQ 2EIXA 4I4TA 4KL8S 5IM4A 2R2AA 3CJQA 4M1QA 3GT0A 3UICA 4XX0A 3UJ6A 2FPUA 2ILTA 3AF1A 3CWZA 5CEFA 2EO2A 1MX5A 1Q92A 4JBLA 1KHHA 1PEKE 1VFNA 5F3DA 1EDEA 3DWIA 3UKDA 2CW5A 4UTOA 1MO6A 2MT9A 2JRLA 7ADHA 2Y20A 3RNLA 1EFTA 1FYFA 4DJDC 1E1KA 2ZRFA 4OG2A 1E92A 3NR2A 4EFKA 4IBFA 4ZTZB 4L07A 5H59A 1DPGA 3V8VA 3BILA 2ZB8A 2B0JA 4D45A 3H9EO 1J97A 2O8VA 2FOIC 2YZNA 3FH0A 3FW1A 4AKSA 1IOWA 4DSZA 2J6IA 4MA4A 3BN3A 3CIFA 4NCXA 2WKQA 4CT4B 2BUBA 4JJ7A 3TJMA 2K2WA 4M0MA 3NCHA 3FPCA 3ZPXA 4YACA 5AVSA 4YDQA 2WWGA 3SJCA 4MUHA 4B48A 3JAKB 1QHYA 3RBZA 1NR7A 4GKBA 2EFYA 2Q6KA 1E94E 2AOTA 1WAMA 3OBIA 3GVXA 1E3WA 1CY8A 4QOSA 1EGHA 2R6JA 4JZYA 4I4TB 4KWHA 3SIRA 2DC1A 1I5OA 1DTSA 2DQ4A 4E3ZA 5EL0A 2YHIA 4Q3AA 1PTKA 2J87A 3DLIA 4MB7A 6ADHA 2IOFK 2P0EA 4DXAA 1WJGA 4RD6A 3ZIAD 1W59A 4C0JA 2WWYA 3F96A 3JYOA 4YROA 3UOGA 3HYCA 1KRWA 4HS9A 3RAFC 1Q15A 4O4LF 3P2YA 3QLVC 2DTEA 1Q3BA 5IDQA 2VAVA 2EDCA 4X8MA 4Y6QA 3LBFA 2RHRA 2ZJOA 4WLVA 1J39A 3CF2A 2CE2X 5JS2A 4YALA 5A9RA 4FKBA 5C51B 3SQLA 1BCSA 1NJ8A 2D0DA 3V3KA 2EVWX 5J2TA 1M8FA 1TCUA 1VPLA 3UY4A 4S0XA 5A6SA 2B37A 4DV7M 2M1ZA 3ESRA 2WKPA 2GMWA 3D5QA 3BMNA 3F3MA 1KFCB 4B5LA 2I2AA 5FEUA 5FOVA 2Q4OA 1BOOA 5EIAA 1AZWA 4N5HX 5A5FA 3JWEA 3Q72A 4LWOA 3IS3A 3G8AA 5LXTF 821PA 1P7ZA 1VBKA 5AJWA 2EBFX 3A0UA 3I4YA 3WMRA 1XD9A 3TTTA 2D2IA 2AOTB 1QPBA 5ALHA 4AMBA 1A69A 5FUBA 1E3WB 2XUIA 4WN9A 1QB7A 3HRIA 1C7RA 3WHPA 3M6UA 2IYSA 5J4KA 1L3IA 3PEVA 3K5IA 4JKOA 1T0BA 4CHTA 2YHIB 2FMHA 3UXYA 1K6JA 2Y3IA 1NG1A 2OVFA 3L3BA 2IV3A 3BWYA 3OOWA 3I30X 3UAZA 4KAJA 3SBJA 2LZ0A 3AFMA 5IANA 4JI8B 5ADUS 3GPUA 4XOIA 3TCXB 1ZRNA 3FAKA 2VC2B 2IZ7A 5WRFA 1SVOA 1Q7EA 1VYVA 4A0GA 3TLEA 4JR2A 5CNMA 2IZ1A 4YJ2F 4EJFA 2RGDA 5DLPA 1IN5A 1RZUA 4RF4A 1ZVKA 5EZQA 2C1EA 1L1RA 5J2TB 3SJUA 4MO2A 4KB5A 1V8BA 4ZK2A 3LAWA 4EGQA 5KYGA 1E69A 2G70A 1IXYA 3BMNB 4Q16A 3DMDA 3EODA 3QBVA 4KLCA 1GA6A 4AQ7A 1TFRA 5A5VA 3FWKA 2LCQA 5JMWA 3ST7A 1GSOA 1RBZA 1M66A 3U3KA 2H7CA 2LVAA 1WGLA 1SIOA 1T2EA 4HQOA 2GK3A 4X45A 3U6SA 4NBTA 4WN9B 2V7WA 3F92A 1S4MA 2QG9A 5CIWA 4POOA 2OWEA 3TLGA 4PLYA 1UXHA 4PAWA 4CHTB 4OBEA 1AQ6A 4LF7B 1QZMA 3QEOA 4QD3A 4DYDA 3LUCA 5JZMA 3B1YA 3SOZA 1NW4A 5L7TA 1NE2A 2JD2A 2Y0EA 3HYLA 1A9TA 3OIGA 4O33A 4Q93A 3CVVA 1XDSA 4ZVOA 3DB1A 3IP8A 1KWGA 3W34A 2W2NA 4EVQA 2ZUSA 2C4WA 2I29A 2FN8A 5ALWA 5FUMA 1QYDA 2XZPA 3GYBA 1SIWA 2CFTA 1SZJG 4P82A 3HJ8A 4YAOA 3NEYA 3EDOA 2UXDM 1DUIA 1XZBA 4E7PA 1RPZA 4GIBA 1HDXA 1YR9A 3HO1A 3KPWA 1LPNA 1JFLA 1XZFA 2W83A 2JI9A 3WQHA 1QYXA 4BNLA 2TECE 4GI1A 4R8LA 1EMDA 2VUTA 4NV1A