3U60B

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
MITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 103
structure length 319
sequence length 319
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u60B01
3QPVA 3LBHA 1OFTA 2GK6A 2PZFA 1DOAA 2GZHA 1EWRA 1T3HA 2IYSA 2REBA 1YZTA 3AP3A 4LHZA 1F2UB 1W0JA 1E2JA 4LBWA 4BECA 1XWIA 1EFRA 4NH0A 1GKYA 3BE4A 1G21E 4YXWA 5LDDC 3IIMA 1KI2A 3NXSA 5TV2A 2VP5A 4ZDKA 3FKQA 1Z6TA 3FDIA 1J99A 3SJAA 2VSOA 2OHFA 4X8OA 5AJXA 3SEAA 1E96A 2BM1A 3TUZC 1N6HA 1UBGA 1Q1ZA 1CULC 2Q9CA 3OESA 4NTZA 4P4SB 2DCUA 5EP4A 2RGXA 1KNQA 4GSYA 1VMAA 4BE7B 1HT1E 3IGFA 1D9ZA 4QJ4A 3TK1A 1KMHB 1AKEA 1ZU4A 1K6MA 3NH6A 4B6FA 2O8DA 1C9KA 2BMFA 4LCBA 1F6BA 4JYCA 1EFTA 3PR1A 3RWOA 1S1CA 3IDQA 1GIAA 2DFLA 4TN1A 3DDCA 4DB4A 3AEZA 1UM8A 4NL4H 4YLGA 1G7RA 3QKRB 4FCVA 4MKHA 1DAKA 1KO7A 1MKYA 4ZDWA 4QBGB 2QMHA 2GVDC 3AKEA 4C9BA 3UMFA 5FPTA 1KK1A 1BIFA 1YRAA 3KKPA 2NO1A 3GJXC 3KTAB 3R9WA 2ECKA 1XRJA 2QAJA 4D0NA 4DB2A 2GETA 4OQLA 1Q21A 3F5FA 3CNLA 3RS5A 4OJQA 4JJKA 5G3YA 3KJHA 2O8EB 2B6HA 4ITRC 2WV9A 5IT5A 2X19A 2UZ3A 2DFTA 4KVAA 2YWHA 4A8JA 2V8OA 2WIAA 3VR2A 3B78A 5EZ6B 2ZR7A 5JWHA 5L3QA 4AY2A 2AK2A 1T6NA 1KK2A 4FMDB 2IYXA 5EXSA 3KX2A 5GVSA 3OIUA 1MOZA 3CR8A 2P6RA 4OHYA 2PEYA 4YDSA 4C7OB 1PUIA 1NSTA 4IVPA 5B57C 2AD1A 4B32A 2V7QD 3TAHA 1IN7A 3M4YA 3FHTA 3P26A 3IPYA 1OW3B 1KTVA 1CP2A 1QZXA 2CL6X 2ZETA 5BYJA 3V00A 1XMSA 4P31A 1II9A 1T9HA 2V9PA 3BD9A 1COWA 3VLFB 2W6JD 5EXTA 3L43A 3UIEA 4DHEA 5BN3A 2PX0A 1G5TA 3I4LA 5CK5A 3T61A 5J5CA 2ANBA 3W34A 1NY6A 1OF1A 3PJRA 4C2UA 1KJZA 4KVGA 5FUWA 1XCMA 2YOHA 2GRJA 5FUVA 3ETLA 2RHDA 4Z8XA 4FIDA 3ZD6A 5KHOC 4TYYA 1N0WA 2GZDA 4CRWB 1AM4D 2A5DA 4TL6A 2FMXA 4TT3D 2IF2A 4TMZA 4UXIA 2C9OA 1G18A 2YHSA 5JS7A 1KDRA 4URVR 4Q9HA 4CT5A 3MAAC 1D6JA 4WVFA 4NCJA 1RZ3A 3QUSA 2A7QA 2VHCA 2O8CB 2ZI9A 2HJVA 3TR5A 1GL6A 1RYHA 4K8OA 4RZXA 4RCZA 1HUQA 1VCOA 2HXSA 1NSFA 2CE7A 1NN0A 2JLSA 2PMDA 3IHLA 1B0UA 3GJ4A 4IDNA 2OCYC 3D7MA 3OF5A 2GAOA 4LYJA 2LCFA 3K9HA 2NGRA 4LSGA 3RLFA 4U02A 3RC3A 3WP0A 3W8NA 4U00A 2OLKA 1UBFA 2YWFA 1W49A 2AWNA 3KFXA 4GI7A 4O0MA 3U4QA 2EWVA 4MYTA 2W6IA 2WIBA 1N5LA 1PLJA 1P4SA 1W4CA 4X8MA 4IVRA 3QJYA 1MRNA 2BBWA 5HE8A 4RD6A 4HAUA 5JRJA 4LJ6A 4AYTA 2ZSBA 1XTJA 2AN9A 1E2HA 2V3CC 4W5JA 2ZRPA 2B92A 3LH5A 4URYR 1UBEA 1ZAKA 1KI7A 2JJ2A 4D4JA 4EFLA 1JB1A 3AVUA 1I2MA 2UVQA 2RGAA 5L3SA 4LX0A 1P73A 2ZYVX 2RGDA 1NG9A 1W4BA 1KDOA 4DLXA 2D3WA 4R2IA 1N6IA 2F3TA 2FNAA 1H8HA 5J4HA 1HA3A 2ZJ8A 2HYDA 2NO9A 3X1ZA 2KBFA 4OHVA 4M1YA 3QKSB 2R2AA 3W6OA 4XD7A 2GBLC 2XEXA 2ZQ5A 4DEYA 3QG1A 3SHFA 1HT2E 3CPJB 1TQDA 3W8RA 1P62B 1P9RA 4GT1A 1EG7A 3BWDD 1XPOA 2Z6VA 4B33A 2FGJA 1YE8A 2NOAA 2QGZA 4HB4A 2D62A 1S9DA 2H92A 3VR1A 1G9XA 1N0UA 1NVWQ 4NCNA 4Q7JB 3WYAA 3REGA 4B3CA 5IF9A 1XMVA 3MSXA 3CPEA 3PEVA 4IDPA 4TL8A 1TL7C 1NMXA 2GEVA 2KB0A 4G0NA 3WY9A 4ABYA 1DPFA 1E9FA 4TTPA 3L82B 4PO8A 3EPHA 5HPYB 3CF6R 2FPLA 1Z6GA 3VNVA 4PC7A 1NRJB 2XAUA 1XXHE 2O8FA 4QBHA 1W5SA 2ZJYA 4FWHA 2G1KA 3B1XA 3TR0A 1Q44A 5DIFA 2WKQA 2QPTA 1CRPA 3BFVA 2A5FA 421PA 3AVVA 3IO3A 1ZM7A 1AN0A 1O87A 4M9XA 3ZIAD 2JCSA 3WBJA 3D3QA 3A37A 2GJSA 3GFTA 3K0EA 4LOAA 2RGEA 5JJIA 4HUQB 1CJKC 3BERA 2ONKA 2NQ2C 2WSMA 4V0OA 1NVMA 1P61B 3HU3A 2OV2A 1G6HA 2Z0MA 1BYUA 1CJMA 1E9SA 221PA 2BVNA 1GDDA 4OHZA 4FWDA 4CF7A 2P65A 3TUJC 3IEVA 3TSZA 5B30A 1A82A 3SDZA 4IFEA 3EARA 2BKUA 1XDBA 4WXRA 1D8TA 4Z8YA 2ZROA 3A1WA 3EA0A 4ZCIA 1Z6XA 4RKEA 1WRBA 1HQYE 5EUQB 2ONJA 4ARZA 4P32A 3PUXA 4ZIRA 3UG7A 4OI0A 2QZ4A 1X1RA 4JLJA 4Q18A 2RGBA 4TYQA 4A36A 3K70B 1TADA 2WPDD 2IS6A 5F2EA 2ZRBA 3CH4B 2ZVPX 3GLGA 4CDGA 2LWIA 3FE2A 3ECCA 4DLTA 2IEZA 3C7KA 1W47A 4W5WA 2F1RA 2QTVB 3BFXA 3VU9B 2VP0A 5DH9A 3AV0B 2PH1A 1OHHD 1VKJA 1YU9A 2W6JA 4HAWA 5SZIA 2ZREA 4MGIR 5GJVC 2WJJA 3OE7A 3CR7A 2HF9A 3B13B 4F4CA 3KQNA 5M04A 4ZKEA 1Y3AA 1D5CA 2V4ZA 4DSTA 1GP2A 1W48A 2CDNA 2FE4A 1FUUA 3I72A 4HAXA 4S2EA 1GTVA 5FPSA 3R7WA 4QGFA 1E32A 3PQCA 4TT3A 2WWXA 2QEQA 2GHIA 5FPHA 5TY0A 1R8QA 3WNCA 2QN6A 4QBIA 5JWOA 3B5JA 1XBTA 3L0OA 3LY5A 3ZS9A 1E0AA 3RSOA 1C1KA 1X3SA 3DOFA 1XEWX 2BEKA 2X77A 4DJTA 2JJ1A 3VR3A 2WZQA 1D2EA 4OI2A 1EESA 1T91A 5G53C 3KUDA 1IOZA 1TQ6A 1YR7A 2HLDD 3QQ5A 3RRYA 2JASA 3C41J 3GJ5A 5HKKD 4EJSA 1FX0B 2EU8A 3LQQA 4V0NA 2ZJ2A 3CRW1 1GL7A 4HLCA 3M0EA 1U9IC 2FSIA 2GF9A 4JLKA 4MDEA 1T8TA 5GJCA 4AKGA 4PC1A 4MYUA 2G0NA 2WAXA 3T5DA 5CM8B 3AVWA 2ZJBA 2JLWA 2ZPTX 3CRRA 3CBQA 3QBTA 4CW7A 4BEJA 5JHGB 2MMGA 4JVLA 3KJIA 2G9NA 3FKSD 5FBWB 4FW9A 4XJXA 3EC1A 3T1VA 5JECA 4ASUD 1R5BA 2CXXA 4QJ5A 1KSJA 3RS0A 3MJRA 5DNYB 2XZPA 1K5GA 1E2PA 5CYPA 2ZSFA 3PITA 4Z1MD 2N46A 2IXFA 1U9IA 4BFWA 3P4XA 1IJEA 1U98A 1DELA 1OXTA 2HDNB 3QEOA 3EPKA 4KFSA 3CNOA 4L8GA 4GL2A 2FGKA 4URUR 5CIWA 4HZUA 4LJ5A 4R9UC 4O2LA 5TMPA 4DLYA 1FNMA 1WB9A 1HYQA 3T5GA 1XNJA 2VEDA 2ZJZA 3I62A 4JVSB 3THXB 1P7CA 4X8HA 2NG1A 821PA 1EX7A 2MMCA 3QI2A 2IWHA 2IYWA 2VPPA 3CIOA 3RABA 4P3YA 1KSGA 4KO8A 5IRCD 4F93B 1NVUQ 4FMBB 5IDVA 2FPKA 3U7FB 4LV8B 3GD7A 3SQXA 5LD2B 2VF7A 1P9WA 3TMKA 1QZMA 2EFDB 3EXAA 3WBKA 1NLYA 3UKDA 4JLMA 2F9LA 1JR6A 2HEIA 1J8MF 2JIZD 4KFTA 4P0TA 5SZHB 4B3DA 4RFSA 4M1KA 4XWAA 2ZITA 1M6NA 2CHGA 3DEFA 2C5LA 4LV6A 1MABA 4Q4HA 3CWZA 1ETUA 1SKQA 1E3MA 1Z0IA 1NIJA 2OE2A 5AUOB 1PUJA 4ILEA 3OIVA 1GRNA 3DZDA 4Y0VA 2JJ8A 4KLZA 2ZUBA 5KPDA 2FV8A 5L3VA 2XNDD 1IXRC 1YR8A 4V0MA 3U7GA 4D82A 1P75A 3U60B 4KLNA 1DAGA 2J9RA 1R2QA 3EZFA 2J7KA 4WBSA 1BO6A 1ZM2A 5H70A 4D0LB 5EE1A 8OHMA 1XJCA 1Y63A 4CT4B 4OHWA 4UXJA 4PQRA 1IHUA 4C0QC 1X1SA 4Q00A 4C0HA 4LJ7A 2IS1A 2IXEA 5KTYA 1LS1A 2R9GA 4DSNA 1ZJ6A 4XVUA 2IYUA 3N2IA 3GJ7A 2DY1A 1R10A 2CBZA 2UKDA 3U2QA 2ZU0C 4LI0A 1QHIA 3HDTA 2FSHA 3I8XA 2WPDA 3U44B 4TQUS 5FI1B 4A0HA 1XU4A 1G7CA 1JR3D 1Q1BA 1KI6B 2YOFA 4E5UA 3IUYA 1ZP6A 1IY1A 2RKOA 1LF0A 3W9YA 4L15A 1W0JD 4RZ2A 3G5UA 1TU3A 4BFSA 4R71A 3PUWA 2RGCA 2J0VA 3P20A 5G41A 1OHHA 4CEIB 4LBYA 3D8BA 1ZCAA 3BS4A 4MRSA 4YXWD 2O52A 4EQ6B 4H9GA 1GFIA 4KFRA 4D4LA 1NN1A 3Q5DA 1Z22A 721PA 3L8YA 4IOMA 5D3QA 1OSNA 1GNPA 5E7MA 2DFNA 4FCWA 1QHYA 5IK2D 3QF4B 3B2EA 3QIAA 5SZJA 2H8KA 1DEKA 5GJWC 1W5TA 4N3NA 1Q3TA 2XXAB 3TBKA 1Z8FA 2FG5A 3DKVA 3RRZA 2ODWA 3CZQA 4PAQA 2BMDA 2ZEJA 2K5UA 2L0XA 5TB5A 1YVDA 4GPTA 2OO7A 1Z2AA 1RKBA 2VHUA 3D31A 2GILA 4LHWA 2HLDA 1VYTA 1ZMXA 1Q12A 5UKDA 3CX8A 5JMTA 2BHRA 1OFHA 4A0FA 5HKKA 4MGZR 3FHCB 3LV8A 4KITB 2ZE7A 1G3RA 3I61A 1NKTA 1Z63A 2XOKD 2GWHA 4KODA 1ZD9A 2BCJQ 4UQOA 4B34A 4E09A 4DIDA 2WMOB 3UMRA 2ODBA 2WWHA 4GOKA 5KU1A 5CDFE 4FMDF 5C4MA 2YWEA 3TVTA 3FKSA 3QXJA 1CF4A 1GRRA 1N3BA 3EZ2A 2ZXUA 2DFKB 2OUKA 4PPGA 1Q20A 1CR1A 2BBTA 3PUYA 4PZZA 1IM2A 3K0AA 1QDEA 3THWA 2DWZB 1UDWA 3G82C 3KQLA 2JDID 4GNKA 4Z1MA 1JAHA 4Q4AA 3ND9A 4AKEA 4FMCF 2D06A 1LFDB 5JEDA 1VG0B 3MWJA 4C0SA 3SYLA 4FD2A 5FR1A 2ZAMA 3SN6A 1IONA 1CR0A 1KY3A 1F2UA 3TW4A 2Y8EA 3CF2A 4B75A 4DLWA 2QAGC 5KPJA 4KJZA 4Q02A 3VFDA 1NVXQ 1RW4A 3K0CC 4GP6A 3RS3A 5K8LA 4A9AA 2QBYB 1ZBDA 3EC2A 2KSQA 1M7GA 1U0HC 4GOJA 5A4JA 2QW6A 2ZSAA 1RRFA 3DO6A 4P4SA 4PZYA 1NLFA 3PFIA 3KKQA 3ADKA 1KMHA 3ZGXA 2C9YA 5JI3E 2NO6A 4NKRA 4CYMA 4UKDA 1TF7A 5IHPA 3VR6A 4DC9A 4DLRA 4Q7LA 1H8ED 3U3OA 1QHGA 4HLUC 4M9ZA 2PCLA 1RRPA 2Q3MA 2JIZA 2QAGA 2P2LA 3W3ZB 2IX3A 1E2MA 4HDQB 3B60A 3ZQ6A 2WWWA 2ZRFA 3SC3A 1XCGB 2ODNA 1EFUA 2CNWD 1LV7A 3KTAA 1GZSA 3VKWA 5C46F 4S35A 5CLQA 2IS2A 1G3UA 5JCPA 1VHTA 4QNMA 4V02A 4LUCA 4HLUA 3A1VA 5FFMA 2O8EA 2W6ID 1G5RA 2H5EA 4LC0A 2YC2C 2RGNC 1G7TA 2HT6A 3PEWA 1J7KA 2R6AA 3MD0A 3VKGA 3GP8A 4GZMA 4LHXA 621PA 5L3RA 5J4LA 4RD3A 3KXIA 4GMXA 4UNQA 3CNNA 3HJNA 2O8BB 1SVMA 2AK3A 3NBXX 2FX3A 4J0QA 3ONWA 4ZCLA 2CHVA 2QT0A 2C9CA 1KSHA 2JJ2D 2GESA 4C7OA 4IEIA 4DCUA 3WHKA 4DLVA 2E1RA 2O0HA 1P9NA 2F6RA 4A15A 2ZS7A 4M1TA 1X8JA 1M8PA 3CZPA 3RANA 2OFOA 3TSWA 4PSKA 4TMVA 4F4JA 1ZNZA 1VPLA 3W5IA 1NKSA 3LXRA 4KCGA 2IW3A 2ZVQX 2WJHA 1JR3A 4XD7D 1QHXA 4RZUA 4EDHA 3A6PC 4M53A 3TJZA 2Q9BA 2YJTD 2HT1A 1CJVC 2N42A 4G1UC 1GRQA 3IKJA 4YMTA 4WZBE 1E2FA 2X2EA 3GLFE 2ORWA 4PR0A 1ZNWA 1ZNXA 3AF2A 2G1JA 2ZRJA 4RD2A 3SFZA 2WM9B 1P2VA 4ERNA 3BGWA 4QM6A 4TQAA 3UXMA 3DVLA 1YR6A 4EPYA 1W7AA 2LKDA 3R8FA 2JA1A 2DB3A 3PIRA 5JZVA 2YVUA 4OQFA 2O8CA 5FTLA 4OBEA 2YKGA 4XH9B 2CCKA 5IK2A 3IQWA 1TF2A 3A4LA 4AK9A 3UPUA 2ZR0A 3O8BA 5HZHA 1RJ9B 4LHYA 4G5GA 2G88A 2FPMA 3VTKA 5AJZA 1TU4A 1LF5A 3H86A 1HURA 3LA6A 4F92B 3BK7A 1V5WA 3PCRB 3MUFA 3DL0A 1OIVA 1TEVA 4A8JC 3ASYA 1NNEA 4CZ2A 1D9XA 1VCNA 1XXHB 3HU2A 1E2KA 1UFQA 2H17A 1KMQA 2QTHA 1Q1EA 1OJLA 4DDWA 2Z83A 1OXUA 3VR4A 4ZPXA 3Q3JB 2HUPA 2V1XA 2X1VA 2RGGA 3AQ4A 4BLTA 4MUAA 1ZUIA 2XOKA 4WZAE 1E94E 5EZ5A 3EWAA 1YQTA 4I1VA 4JLVA 1HQCA 1N5IA 4KI0A 2R62A 2A78A 2YC4C 4HUTA 1RC8A 4U7DA 4Q9IA 5HCNA 4E22A 1KI8A 4QJ3A 2J0UA 2QRZA 5HR5A 3MJHA 4IRUB 4BZXA 1EGAA 1G17A 3L2OB 2EYQA 1AS3A 4WAUA 3RVBA 4K81B 1E1RD 3PUVA 1G8YA 1G4AE 2IWRA 2RMKA 4B6EA 3CW2A 2FF7A 2WOJA 4F4IA 2GTPA 5DHAA 3FMOB 3WYFA 2JDIA 5J4KA 4PFSA 3GLHE 1GKIA 1DAIA 2QM7A 3I32A 4JYBA 4K46A 4G5QA 2C98A 1QF9A 2IEYA 2ZUCA 3C4JA 1PJRA 2O0KA 3H84A 2GXAA 1ZUHA 1Z2CA 4Q1FA 4FMCB 1VCIA 3BBPA 3NIBA 4A6PA 2HJGA 3I73A 2R8RA 5A5GA 1CKEA 2DPXA 1EFCA 2OESA 1KI4A 3AKCA 1GL9B 1FPMA 2J1LA 4HYYA 1UEJA 3BAFA 2YINC 4FCTA 1UPTA 2BCGY 2DR3A 4W7SA 3OE7D 1NBMD 3Q85A 3AUXA 3T1OA 2H1LA 2ZI3A 5JJLA 4BASA 3T1TA 1FTNA 4LJ4A 2KI5A 2Q9AA 1RPZA 2YV5A 3EZ7A 4DZZA 4XIGS 3CO5A 3AVTA 2CLDX 1DAMA 2ZE8A 4JLDA 2R44A 1XMIA 1D2NA 2ZS8A 1AZSC 2ERXA 4DLUA 1H8EA 1QHSA 4XWKA 1XZQA 1U99A 4PPQA 2NPIA 5LB2A 4N1AA 4MRPA 3NG1A 2QM8A 2GKSA 2JJ1D 2PZEA 5FTNA 4NYJR 4E07A 5DSZA 3NEJA 4LJYA 1P5ZB 4HUQA 2ERYA 1OXSC 1T5LA 2CNWA 1CRQA 3ZDQA 5DYGA 4CIDA 1ESMA 4Q4LA 3GFOA 3THOA 1HE8B 1I2DA 1KI1A 3BXZA 2WTUA 1G64A 5AK0A 3DPUA 3QY0A 4KBGA 3VHXA 5EJEA 2VH5R 2QE7A 4NMMA 1YJ5A 3BORA 4M4SA 1X37A 2C95A 1P3JA 3LO5A 3LNCA 5FOUA 1G3MA 1CIPA 1L4UA 2IYTA 3NH9A 4FWGA 2O8DB 4Q7KA 3BJIC 1W1WA 3CWQA 3P27A 4BLPA 1E2NA 5FUYA 3THYB 1S1MA 1XPRA 5FI0B 4TL7A 1Q22A 2F1JA 2PX3A 3GCGA 3CB4A 1XD8A 5JCZA 3ZS8A 4FWTA 4EPXA 5AUQA 2MSDB 1VDZA 1VG8A 4N0EA 2FEOA 4JKIA 2ZU6A 3ZZ0A 1UKVY 2DWQA 4IDQA 2IYRA 2A5YB 4QC2A 4JZKA 5FR2A 1NLZA 1CJTC 1S8FA 3VU9A 4BGDA 2ZRCA 1B23P 3DMDA 3VQTA 5AUPB 3IBYA 1YZLA 3I1FA 5JEEA 3GPLA 5CM9C 1NN5A 2D7CA 3G0HA 2QPAA 3GLIE 3TKLA 3OEHD 1UKEA 3NBYC 3VMFA 4C0LA 4GDFA 4KYIB 5CB8A 2HXYA 4HAVA 2RCNA 4DCNA 1R7RA 3K9GA 2DBYA 1FP6A 3R9XA 1BS1A 4F91B 2RHMA 1P72A 4DT1A 4EPVA 2G6BA 1FTSA 2I1VB 2VF8A 3U6BA 4NU0A 1JBKA 4JN6A 1E98A 2A2ZA 3BH0A 5EUMA 3L8ZA 4MYHA 1GVNB 4EAQA 2PZGA 3EWSA 4JBWA 4HAZA 2PLFA 4TQ9A 4OQXA 3OAAD 4ON9A 3B6EA 2IK8A 1MV5A 1XD2B 1A5TA 5E3HA 4NYMQ 4FN5A 4C0JA 4B2PA 2ZRHA 3BH7A 2QQ0A 4B3GA 1VCMA 5LB4A 4TZ0A 4DLZA 4A6XA 3RNLA 2KE5A 2IBMA 1SKYE 1FX0A 1U8AA 1VG9B 3AP1A 1LVGA 3SYKA 4E03A 2FU5C 1CU1A 3U3RA 2OEPA 2VP4A 3AF4A 3W3AA 5DE3A 4BZQA 3KDSE 3C15C 2GEUA 4NCKA 4MKFA 1F60A 1H65A 4DKXA 2Q21A 2DVWB 5DHFA 3KZ1E 2FN4A 2IYQA 2C04A 4OQNA 1RFLA 4F7WA 3GQBA 1E79A 4B43A 4XTCS 2QSZA 5J4VA 5CJ2A 3VKHA 1XEFA 2QG6A 1M7BA 1WCV1 2F1HA 2GXQA 5DISB 1IAQA 4ESVA 1OE0A 2ZYTX 3TGPA 1M74A 4IXMA 4M2LA 3EPJA 3VAAA 1E1RA 1HY3A 4L9SA 4YDHB 5CYOA 4Q1BA 2GXSA 3IIKA 2ATXA 1AS0A 2PT5A 1YZKA 2EFHB 1AGRA 1M34E 2EYUA 2RH5A 1N6NA 2QENA 2IYVA 1OXVA 3WYGA 3CRMA 2F55A 1WBDA 4HDOB 3T35A 3THXA 4PPFA 5G40A 3KB2A 4ZI3A 1CR4A 3NDBB 3A4NA 2YNMA 2OBNA 3GEEA 4MA4A 1DS6A 3AVQA 1AQUA 1OV4A 2WJGA 3O8RA 1BKDR 2AXPA 4RCYA 5BW8A 2OFWA 3ZVLA 2V6JA 4IW3B 1J70A 4KXFB 1SXJD 2VP9A 3PXGA 1JEEA 1T3SA 1NBMA 4W9MC 1NI3A 3SJZA 3FOZA 4IOKA 1V43A 4EJSC 5L3SB 1JR3E 4C30A 3GEIA 1S9HA 1E2DA 1PLLA 2OBMA 3LX8A 4EKDA 3QNUA 2ZI5A 5KDDA 2B7CA 2DHRA 1NL3A 5FPKA 3N2EA 1U8ZA 1KSFX 3QXHA 4ZDJA 2N1BA 1NY5A 4AC9A 4D25A 3E1SA 4B73A 2J46A 3MHVC 1US8B 3K09C 4B3BA 3QSYA 1SVKA 3U61B 1ZD8A 4YMVA 6Q21A 1MO5A 4QGAA 1G8PA 2GF0A 5KNCA 1W36D 5F98A 4B76A 4LGMA 2EFGA 4LHVA 1E0KA 4NYIR 2E9SA 2ZYWX 4XTRA 4DEXA 1AJEA 1L7VC 1UDXA 3SS8A 2GA8A 1E9CA 3EASA 1QHHB 5E4FA 5C2JB 5L8VA 3AH8A 2FH5B 3QVUA 4JBYA 2XJ4A 4LPSA 2P67A 3V9PA 4DBLC 1IN5A 2CMKA 3E2IA 2JLRA 2VYFA 1WP9A 1N5KA 5JSZB 2J7PD 1E2EA 3K09A 4PSVA 2GJ9A 2XTMA 2REXB 1WMSA 2TMKA 3EX7C 1YRBA 4TTRA 1WE2A 2IF0A 4Q66C 1VHLA 2Q3FA 1LS6A 1ZD1A 2FZ4A 4PC6A 3MGCA 1ANKA 1VECA 3BB1A 4LDJA 4BFVA 4B35A 3U44A 3FB4A 1CTQA 1P2SA 1KI6A 1PLKA 3KKOA 4Q4JA 2OAP1 4AURA 5B58C 4HB2A 5B2ZA 3KQHA 1E9BA 4I99A 3IHWA 2CVFA 3AVXA 1F2TB 1QRAA 1W2HA 5JI2E 1Z07A 4CEIA 1EFHA 4NCHA 4US2R 2VSXA 3OEHA 4EQ6A 3RC8A 2YZ2A 4EFNA 2IYYA 5JHHB 1G8HA 1FNNA 3VHLB 5HZKA 4JT2A 3QF4A 1K5DA 1XB2A 1NJGA 4MH0R 2GCOA 1G5PA 4DDUA 1XTSA 3KQUA 4ARZB 5EXXA 4ZI2A 1UADA 1S4QA 2V54A 5CK4A 4MITA 4WIAA 4ZV4A 3IO5A 2AL7A 4PC2A 2VHQA 2ZI6A 1R0WA 2AKYA 4G01B 3NHBA 4BFYA 5EP2A 1JQLB 1VIYA 2VBCA 2BM0A 2IC5A 3OAAA 4KBFA 3TQCA 1FMLA 1T0JB 4TMTA 1M2OB 1NJFA 2GNOA 2P5SA 2ZM5A 5CLLA 2BOVA 2GCPA 1IY0A 1W46A 1SZPA 1RVDA 1GKUB 3IILA 4DCVA 2XB4A 3KXLA 5HTKA 3VX3A 1C4OA 1E4YA 4WOPA 1NN3A 1VG1A 3A1SA 3SBEA 3DHWC 4UNNA 3CTDA 2Z4SA 3HWSA 4LYAA 1OFUX 1XEXB 4IOJA 1Z0AA 2F43B 2H57A 3NBZC 1TTTA 4BQSA 1G20E 2XZOA 2HCJB 2JLYA 2DWPA 3R7WB 2WWYA 4OJKA 3FMPB 5DI3B 2CLCX 2J59A 3T15A 3AGPA 4A3VB 3E5HA 2WKPA 3CH5A 2IUTA 3ZVNA 4QFMA 4TTQA 2WJYA 2ASEA 4AYXA 3L0IB 4KFUA 5BWMA 4C3ZA 1T4GA 1XJQA 1HE1C 1KHTA 1M1YE 2PBRA 3A36A 4OL0A 1XEWY 4QBFA 1U8YA 3KL4A 4LK2A 2W2TA 3K0FA 1BMFD 1SXJC 1G291 4N0DA 3JZMA 3PV0A 4Q1EA 4DUGD 3QVVA 3HR8A 3EZ6A 4XOIA 2BJWA 3AKYA 2QU8A 1G4UR 3T12A 3U3MA 3HP1A 3MFYA 2ZR9A 3B1ZA 3CPHA 2OXRA 2FWRA 1E0JA 1SHZA 2JEOA 3LD9A 2IXGA 5FL3A 4IOLA 2QBYA 4HAYA 4RZ3A 4AYWA 2JGNA 4D0GA 1RYFA 1E2QA 4IVQA 1II8B 4CEJA 4Q5IA 3A58B 4DCTA 3HU1A 3TW8B 1D2MA 2OILA 1G8GA 1SXJA 3U7HB 2X8AA 1UKZA 3LLMA 3QPWA 4ZDIA 4EPWA 1LB1B 2R6FA 1S0UA 4A2WA 4B3XA 4YQFA 2IS4A 1CJUC 1VYUA 1XCPA 1W36C 2CJWB 4PC3A 5FBVB 1XX6A 3CF0A 4ZO4A 4CEHB 521PA 2OCAA 2W0SA 4ESHA 2OAQ1 3GLFB 4BLSA 1IN6A 2DYKA 5K8UA 3AP2A 2V6ZM 2Q6TA 4TLAA 1FMJA 4LJ8A 3V4FA 3ICEA 1OYWA 3DMNA 5AR1A 1VYVA 3B8HA 4LZZA 3ADCA 2JLXA 1Q57A 3GFPA 5FBLB 5AWFC 3PEYA 2ZRDA 1II0A 1MR3F 2HF8A 2XSZA 1IXSB 3GMTA 5EP1A 4JBXA 4NPHA 4PO9A 4R98A 3WNBA 2BKEA 2IYZA 3LBNA 4A1FA 5KSZA 2C96A 3ZD7A 3S1AB 5ELXA 4TYWA 1MO6A 1IJFA 4MUBA 5AUNB 2ZSDA 3V4RA 4HB3A 2O8BA 3BB3A 2C03A 5J4YA 3NC1C 1AIPA 4URXR 1Z0JA 1R5OA 3U6KA 3C8UA 2W58A 3X1XA 1HV8A 4LYFA 1T3LA 2J7PA 1XTKA 5LPNA 5JBQA 1ZIOA 4PPNA 1J90A 5K8IA 4RSGA 4LPKA 4NDZA 4Q4HB 1Z0FA 4IXNA 3T06B 3SOPA 4A92A 1E99A 2AFIE 2QMUA 3EG5A 1SVWA 4Q9LA 1KGDA 2PMKA 1S96A 1OH5A 5E95A 4TLDA 1E1QD 1NG1A 1XZPA 2FJUA 3KUCA 4XSGA 4L9WA 2XJ9A 2KWIA 2ZI7A 1GUAA 1XF9A 4LV5B 3U3KA 4TYNA 1YZGA 4RKFA 4XVQA 1XD9A 3OIWA 2ZYUX 2V55B 5BYKA 3GJ8A 4D81A 3AGQA 5FPYA 3CX6A 1ZRHA 2GAAA 3GLHB 1U0JA 3RHFA 3I8SA 2BMEA 3F3YA 1R4AA 2WWIA 3C16C 4QHTA 3LX5A 2BMJA 2J5XA 3QXCA 4IEEA 2IUUA 1F5NA 4D2IA 1WQ1R 3FWYA 2J0SA 3MLEA 3FGNA 3TVDA 4QHSA 1L4YA 1I4LD 1T0HB 1ZM4A 4O2RA 1FL9A 4JSYA 1DE0A 1ZC3A 3UK6A 5EQTA 3GLGE 2BWJA 2IA5A 1RJ9A 2IUSA 1GITA 3K53A 3GJ6A 5EE0A 1EK0A 2ZANA 1S3SA 4JKYA 3E70C 2NZ8A 5C4GB 1Z0DA 3AKDA 3UANA 2AD5A 4BEBA 2CCJA 1T8UA 4JVMA 2A30A 1KO1A 5J40A 2OT3B 1Z5ZA 4JMPA 1AA9A 1WA5A 3QKRA 1XXHA 2JAQA 1PVOA 3ICQB 2AKAB 2WSSD 3K1JA 4D80A 2NO7A 4BLQA 2XGJA 4MKIA 3FYHA 2GJAA 5FBRB 5TDHA 4PZLA 1GWNA 1DO0A 2WWFA 1SVSA 1KO5A 3U3JA 4B2LA 2XB2A 2C78A 3NC0C 2QE7D 4MYCA 2W00A 1JXOA 3IBGA 4MDFA 3KB1A 3EIEA 2HCBA 2OCPA 2OXCA 5FOWA 1GAJA 3MG9A 1P2TA 1U2RA 3QBVA 1GNRA 2PJZA 4AG6A 1EX6A 1SHKA 3DKPA 1OH6A 2EWWA 5KNDA 1P6XA 4OK6A 5KUTA 1KDTA 4PAOA 4OYHA 2CL0X 3NBFA 1FQJA 4IJMA 1JJ7A 2OFXA 3FPAA 3IEUA 4PQYA 3K70D 3U7EB 4POAA 3H4MA 1X6VA 4GZLA 3RS2A 1Q0UA 2JATA 3AVYA 1BMFA 4DUGA 2ZE6A 2W0MA 4PANA 4KSCA 3K9NA 2EQBA 3RYTC 4L16A 3UATA 2AWOA 3NVAA 3A4MA 2CK3D 2ZRNA 3ZVMA 3VNUA 1TAGA 1TF5A 4EPRA 2ZJOA 2P3SA 2WICA 5CJPA 2CE2X 1J2JA 2QA5A 4JLOA 1QHNA 3HYRA 1QG2A 1X8LA 2FZLA 3AF0A 4A0RA 3CUEF 4JLNA 3MRSA 1NVVR 3GLIB 4F38A 3W90A 2ATVA 5P21A 2MSCB 1OT3A 2F9MA 5FH9A 2GXUA 3QF7A 2EFEB 1E9RA 3IPXA 4Q4AB 5DN6D 3K0SA 4KYUA 3ZYCA 1CR2A 5CITA 4QKQA 2R9VA 3HYTA 2A5GA 1W4AA 2FDCA 3JZAA 2P6NA 4RVCA 2IT1A 3LQRA 2FFBA 3NWJA 2B8WA 2QORA 3WNDA 1Z47A 2QRNA 1TMKA 3PENA 3EW9A 2QMOA 4RD4A 3X1DA 4BWYA 1E2LA 3NEYA 3SI7A 4NYJQ 5KOYA 2QROA 4BLRA 3AVPA 4M9QA 1OIXA 5FBQB 4MGYR 4QOSA 1SKYB 2QP3A 1TX4B 4JJZA 2FA9A 4BFZA 2R6DA 5JLJA 3RS7A 3SHWA 3UMSA 4LY6A 3THYA 4WW0A 1E79D 4X8LA 4UNRA 2QAGB 1W0KA 2OCBA 1T5IA 5CIQA 3CLVA 1DAFA 4PSAA 3MWYW 1SULA 3EZ9A 1PV4A 3RSLA 2P5TB 1KZ7B 1N5JA 3AF3A 2AFHE 5DO9A 2NO0A 1J8YF 4TL9A 1VIAA 1FOEB 2QT1A 1MT0A 3W6NA 4W5HA 4V0ME 1G1MA 2VO1A 2ZRLA 3VR5A 1SVIA 3TIFA 1Z08A 1AGPA 3EIHA 1E1QA 1UAAA 3BH6A 3H1TA 3QKSA 1OYYA 5C18A 1SGWA 4OK5A 1ZYUA 2QP9X 2ZRIA 2WJVA 3P4YA 2FOLA 5E7IA 2Z5FA 1FFHA 2BDTA 5DGXA 4JS0A 3QPUA 3FFBA 4QGGA 1Z6AA 1YR9A 2WWGA 1A2BA 4V0KA 1GILA 1E9DA 4GP7A 3UWOA 1UKYA 1I4DD 3BGEA 3ADBA 2ZIAA 1QVRA 3OEEA 5AJVB 3R9IA 3SJCA 5K8TA 1KO8A 2Q3HA 3O8CA 4OI1A 2FSGA 3WRYC 4US1R 5D3MB 2EVWX 1N6RA 2PEZA 4TLBA 3GJ0A 1ELOA 1TNDA 1XD2A 1W44A 4RFVA 4YMWA 2QSYA 2BBSA 2OG2A 3AF1A 4B44A 4C0AC 3CKLA 5J47A 4JLAA 3RWMB 3DOEA 1ZINA 1OB2A 3WMGA 4M8NE 2AR7A 2KBEA 1SXJE 5DYIA 2YYZA 3SU8A 1IQPA 1X8KA 5LBIA 2XZLA 1KOFA 5HCIA 3BFKA 1O3YA 1YZQA 3HPRA 3QG5A 2J0QA 2WSSA 1OXXK 1KJYA 1JAIA 2CHQA 3J81k 1RIFA 1A7JA 2NIPA 2D2FA 1KK0A 3A1UA 3ZZUA 3K70C 4YONB 3FMIA 4OI4A 4DIEA 4PO1A 4JLPA 1WBBA 1KI3A 3Q72A 4Z51A 2P6UA 3Q7PA 1JEDA 4AG5A 3SNHA 2PL3A 1OH8A 2WHXA 3WP1B 4FI3C 4IKEA 2HYIC 1ZU5A 2A5JA 3KQKA 5KSYA 5JWRA 4D26A 4G3XA 4LYHA 3PVSA 2IHYA 1SVLA 2VSFA 2GK7A 5FOTA 1JQJC 4PXAA 3JVVA 1G16A 3UWKA 4BFTA 3NKVA 3LFUA 3OIYA 4EPTA 5C1BA 3HR7A 2UZIR 4Q03A 3H2YA 1L2TA 3EAQA 1RE0A 4I4LA 4M0LA 2SHKA 4B3FX 2IYLD 2XTNA 1CBUA 4XSHA 3P1JA 2R6GA 5KDLA 1TUIA 2CK3A 1Z29A 3B85A 4LBZA 1KYIA 3U5ZB 2ZRMA 4UJ5A 1WF3A 3FMFA 4G5OA 1F48A 3EPLA 2BC9A 4LRSA 2OM2A 1N2CE 3Q9LA 2ZI4A 3TH5A 4C2TA 3FHOA 1FW6A 1KI9A 1KNXA 4M22A 4KU4A 1M7HA 4IFBA 2J0UB 4A8JB 4BRUA 5L3QB 2NTYC 3KFVA 3GEHA 1MRSA 2ANCA 4G5RA 1JECA 3SFVA 4QL3A 1Q1QA 3AVOA 4JLBA 3W6PA 4MRVA 2VTKA 5DN6A 3C5HA 1N0VC 3LRPA 3MCAA 3I92A 4XVRA 4Q1CA 2CLSA 4QRHA 4Q01A 2RAPA 1US8A 2X2FA 3BB4A 2YOGA 1G8FA 3MMPA 2Q0HA 4WA7A 1GG2A 1IBRA 2J41A 1HEIA 3QEJA 4OHXA 5H68A 2ZRGA 3BOSA 2FFHA 1Z3IX 1N6PA 3ZH9B 2GVZC 4IDHA 3B9PA 4AI6A 1LW7A 1P60A 2G77B 3P32A 4TMWA 3WRXC 5KYKA 1R0YA 4JSTA 1OKKD 1QHHA 2ZUDA 3LW7A 1NIPA 4DXAA 4WZ6A 2OLJA 2EW1A 1W2GA 1CEEA 2VA8A 3REFA 4MGKR 4DDTA 1DAHA 3R20A 2GBLA 5JSZA 3O47A 1G19A 1MO3A 4Q1AA 2NPFA 1OH7A 1XPUA 4NYIQ 3D6TB 4L4UA 1E4VA 1ZM9A 2BV3A 1CS4C 4UNSA 3N5CA 3RRNA 2VIIA 2A9KA 1PZNA 1XTIA 2FFQA 1KIMA 4BRWA 5CDFA 4TYPA 4GITA 1TPZA 4LJAA 1YZNA 3K9LA 3AM1A 1KAGA 4XWOA 5LD2C 1OB5A 2QQEA 3ZJYA 4M9SA 5FTKA 2PT7A 4M1WA 4DLSA 1GNQA 4MRRA 1F2TA 1KJWA 2ZRKA 1R0ZA 2B21A 3FVQA 3OZXA 2ZE5A 4Q21A 1YHNA 4TLCA 4AIIA 3U4QB 4HSEA 4RD0A 1E9AA 3LW8A 4QG7A 5FUXA 3B1WA 3ZLJA 4HI0E 4IHQA 4Q48A 1EXMA 121PA 3I3SR 1LTQA 3NHAA 2O0JA 4LRTA 3LVQE 2J87A 2AX4A 4JL8A 3FFAA 1Z83A 5DLQC 4NCIA 3B1VA 1GOTA 1S2MA 4R7ZA 2D4HA 1N25A 2PJRA 2R6CA 4LC1A 5KSPA 4B74A 3QXXA 3JVUA 2QY9A 4DSUA 2H18A 2WJIA 4OKSA 4BFXA 4C0BA 1U0LA 4PHHA 1JNYA 1JALA 1JPNA 2IL1A 4AKIA 2V7QA 2J45A 4Z54A 2AXNA 3SR0A 5FTJA 2REOA 1P2UA 2V6IA 2ODEA 2JLQA 4O3MA 3WXMA 1UJ2A 4AKHA 1XJ0A 2I1QA 3QE0A 2FEMA 3ND8A 3AUYA 1KY2A 3DZ8A 2ORIA 4YMUA 2XSZD 4A0GA 1XEXA 3RRMA 2F43A 3QKTA 1DAEA 2P0EA 1WXQA 5TXGA 4AD8A 3WMEA 4A2PA 3KKNA 4NBSA 4DT1B 4DWJA 4NYMR 1JPJA 4H1VA 1OPXA 4RJLA 5DI3A 3KXKA 3N70A 5E7JA 4DDVA 2D74A 3ADDA 2F1IA 4PHFA 1K8RA 5KSOA 5H1YA 3LWNA 2QP4A 1XFAA 1VTKA 2FSFA 3OHMA 4HZIA 4NP6A 4I1SA 1A1VA 1NF3A 1EWQA 3T34A 2I4IA 4DCSA 2O8FB 3LXXA 3R8CA 1R6BX 2KRKA 4GBMA 2I3BA 2HV8A 3KJGA 4EIWA 4M1SA 5FOSA 2Z4RA 1U94A 1UEIA 2O5VA 4KAXA 3TSOA 1R5NA 2WMNB 1DBSA 3X2SA 4H1UA 4BFUA 4I1UA 3SE0A 3CRVA 2WOOA 4LBVA 1R0XA 4JL6A 2ZSEA 1II8A 2WKRA 1FP7A 5BN5A 5BXQC 3QENA 4CVNA 2VHTA 3OFND 1ZC4A 4FXPA 2BJVA 3B82A 3NTUA 4HLDA 1S3GA 1XTRA 3O8DA 4YMSA 3EA5A 5SZKB 3F0TA 1RRCA 4M21A 4R2HA 3CM0A 3VX4A 4FWIB 2CJWA 4CEHA 4HLQB 1DARA 3Q8XB 3GLFA 2E87A 4URWR 4V0LA 2F7SA 1MO4A 4ZIRB 2QNRA 4Q19A 1G7SA 4P4TA 1DG3A 1ESNA 1N6LA 4A82A 2XITA 4D4KA 4PHGA 4TLEA 2XXAA 2D2EA 1KO4A 2QI9C 4DVGA 3PG5A 4O25A 4UNPA 2QGNA 2VQSA 3GLGB 1E69A 3WMFA 4D6PA 4TWZA 1RRGA 4G5SA 3S1AA 2ZJ5A 2NMVA 3SZRA 3LLUA 1QBKC 4KHZA 2OSBA 4TMKA 3IQXA 4LWZA 3TAUA 3SJBA 5GADl 1OKKA 2GJ8A 4NONA 4AWXA 5EE3A 2W2VA 2GDJA 1GM5A 4US0R 1BOFA 1Z28A 2F3RA 2VP2A 3M6AA 3H0KA 4M1MA 5F3WB 4GRAA 5A0FA 2A3RA 4ZKDA 2WBLC 2ZS9A 3QXSA 1Q3HA 4MKGA 4TSFD 1XP8A 5JS8A 3B9QA 1NP6A 4GMDA 3TNFA 1TQ2A 3KJEA 1F3OA 3ZIAA 3BC1A 4HDCA 2ORVA 4MRNA 3TUIC 2MSEB 1HTWA 3ZQJA 2ZJAA 3TLXA 3GJ3A 2CL7X 4JVNA 5KDOA 4EJSB 2CVHA 1FQKA 2G3YA 5TARA 4C0KA 1DG1G 2C8VA 1TQ4A 2B7BA 2W2XA 3GLHA 4ACBA 2WVJA 2C77A 2B8TA 4NZYA 2QPOA 1AZTA 4IDOA 4PHTA 5GVRA 2ZTSA 3C5CA 3TQFA 1BYIA 1KDPA 4P4UA 3A8TA 2GZAA 2LKCA 1E9EA 1GSIA 2XTZA 3ASZA 2BEJA 1YZUA 3PUZA 1ONBA 1U81A 2JLUA 1HH4A 3M1IA 3LBIA 1CXZA 4Q9JA 5FL7D 4Q4JB 2W83A 1I4TD 1AKYA 5CB6A 4HZUB 3SQWA 2CCGA 2EFCB 5BN4A 3X1WA 1EFRD 4NHOA 4PQFA 1E6CA 4A2QA 1JXMA 2BIFA 1NMZA 1W4RA 1OIWA 4GFDA 4II7A 3WHLA 2ZRAA 5BQ5A 3MWKA 5HE9A 5TVKA 1E2IA 4C4PA 2KJQA 3MWLA 1SQ5A 5EP3A 3AB3A 4QXAA 2DZOB 1KAOA 4JIMA 4KV9A 2GCOB 1QG4A 1NMYA 2VL7A 4UJ3A 1ZVQA 1AQYA 1OFIA 1CLUA 3ZVRA 1ZIPA 4UXHA 3RDPA 4I1OA 1Z6YA 4HATA 2XX3A 1W0KD 1ZCBA 5JFGA 1X86B 4RFSB 5F9HA 3Q7QA 4M1OA 4NE2A 3BRWD 2JLZA 4QHYA 4B71A 2DWOA 4OK3A 2ZAOA 1MABB 1G41A 4B47A 4B2IA 2C2HA 1L8QA 2PCJA 1DO2A 4ACAA 2GEDA 3HPQA 2G83A 3LVRE 3C14C 4YC7A 1MH1A 3CRQA 4LRWA 4FINA 5B64A 4WXPA 4HB0A 2GCNA 5AJWA 4EFMA 4MQBA 1TUEA 4BPBA 4PTLA 2C99A 3UG6A 2VHJA 2QTFA 1JJVA 1YKSA 2VRWA 2CEAA 3BIFA 3QKUA 3OFNA 1QVAA 4JT4A 5KO2A 2QUZA 3B7GA 4RD1A 3GLIA 4BUJA 4V03A 4ASUA 1ZUNB 5EXPA 3OEED 3L0PA 3QOFA 4B48A 3PEUA 3W5JA 1BH2A 4I81A 1FZQA 2QMEA 5ANRB 5FTMA 2NZJA 3K0FB 5EE9A 4GOXA 1UF9A 1KZGB 1NVVQ 2GJKA 1WDTA 4Q7MB 5AJYA 4OQMA 3ZZTA 3Q5EA 2H7VA 3T1QA 1COWD 4LJ9A 1A4RA 3F8TA 1ZM3A 3KW6A 1NBME 2PLRA 4HEJA 4DSOA 2Z43A 3FTQA 3CX7A 4QGHA 4CEJB 3DM5A 3LAWA 4TMXA 4URZR 2VLIA 2DZNB 1UBCA 2FFAA 1SXJB 1ZW6A 1A2KC 2V1UA 1KK3A 3TRFA 1KKMA 4DRZA 4Q9KA 1N6KA 2R65A 4CGZA 4PAMA 2OBLA 3X1YA 2WAYA 4PX9A 3K0CA 2JLVA 2VP6A 1OLOA 3I5XA 3RS4A 1N6OA 1DADA 5EE5B 4A4DA 1G6OA 1SVOA 4BZPA 4TSFA 1C1YA 2RB4A 1E0SA 2J3EA 4D4MA 4QM7A 3I5YA 3K8YA 4TZ6A 1DTSA 4L5BA 1R8SA 5H8WA 1IXZA 3NDPA 4ZCMA 1JI0A 3L0SA 3LDAA 5JJKA 4Q1DA 1FUKA 5DI9A 5JRZA 5GJBA 5G3ZA 1XMJA 1W36B 2XNDA 1LNZA 3KKMA 1ZNYA 4RY2A 5F9FA 3IIJA 1KKLA 1DVRA 2G0TA 5FOXA 1IN8A 3CONA 2OZEA 3SBDA 4Q47A 4Y0AA 1E2GA 2AHOA 2IHBA 1TEXA 3AJIB 1U90A 3SYNA 1AK2A 2H16A 4U5XA 5D3MA 4P33A 5KNBA 2D7DA 1Z06A 2BBOA 1IN4A 3TE6A 2RGNA 4EUNA 2YWGA 1H8HD 1LY1A 1XTQA 3K0AB 1AS2A 1G3IA 1Z0KA 3B1YA 1G3QA 2QL6A 3RAPR 3THWB 3EIQA 2XNSA 5FOVA 1ODFA 1IY2A 4QNRA 4JL5A 4KSBA 4BLOA 3A1TA 5FL7A 3DM9B
chains in the Genus database with same CATH superfamily
3ZV4A 1P0MA 1GG9A 2REBA 4M8IA 5I4KA 2OAEA 1B4DA 4YXWA 2HGZA 2JRLA 1RXEA 2VSOA 4B84A 1UBGA 1RXIA 1VMAA 3IXQA 4ISCA 3NH6A 5K03A 2A0YA 1P2GA 3SZUA 3TIVA 4HGNA 1O97D 4NL4H 1B76A 2YVKA 2REQA 4F97A 4ZOEA 1W76A 4MW2A 4RPKA 2WFMA 3L4EA 3ZK7A 2QW0X 4BLCA 3QMWA 2JRCA 5AT1A 3KZKA 4JJ4A 4JJKA 1VSBA 2O8EB 5IT5A 2HFJA 5FP0A 1I2AA 1UL1X 1N7JA 4XE5A 1KK2A 1QE5A 3JZFA 4K5QA 4N54A 1CV2A 1LX7A 3ORFA 3RFUA 5AIBA 5C37A 1CP2A 3AX6A 2XVAA 2QSUA 4KE9A 3RUPA 3NP7A 3W34A 5CFOA 4DUYB 1KJZA 4QAJA 4WFJA 2GRJA 3ACBA 4Z8XA 5G0VA 3B7QA 3HCOA 1BRTA 1W34A 2DFPA 4I5DA 2RB5A 1SQFA 1PBNA 3TR5A 4RZXA 4IHJF 2CE7A 1FEZA 1HETA 1Z7WA 3QU4A 3OTGA 2NGRA 4J6EA 2FVXA 1P1IA 3KFXA 3B6JA 4M7OA 5EERA 4RTLA 4C22A 1R4NB 1OXBB 3GAZA 3H2HA 3ZY6A 4TUYF 3AIOA 2BBWA 5C51B 4JI0M 3L6EA 4M9UA 3PR3A 1E2HA 2H0QA 4E7OA 4EFLA 4WNCA 1DCKA 1I2MA 4G1VA 4K9RA 2RGDA 3ZBUA 3DZIA 1R12A 1N5OX 2D1QA 3G0CA 2RG1A 3JD1A 4V1CI 1KR5A 3ZHQA 1UOEA 3ND5A 2D62A 2H92A 4B3CA 1YVPA 5AKEA 6REQB 5IAKA 5JQWA 5GONB 2J5RA 4FZJA 4OY3A 3MIIA 4IG9A 4CNQA 2YXDA 3N59A 3TZCA 1NT2A 1E5LA 1M9NA 3DUFB 2A59A 2NQ2C 2BHLA 1A9TA 4K9LA 1G6HA 2I2DA 1N1DA 1TYCA 4CF7A 1P7PA 1S02A 4RTMA 2ZBEA 1KYYA 3TLEA 5HK8A 3UG7A 4HVLA 4UBOA 3Q9UA 1FFBA 1ORYB 4ZQFA 1A7AA 3NHRA 2V65A 2W6JA 3ISVA 1M2KA 2M6RA 4REZA 3OE7A 3KQNA 2V4ZA 3A2KA 4QYIA 3AEYA 3PFCA 3LL7A 4YIKA 4PGHA 3CSDA 3JS5A 2WWXA 4LXQA 3P9NA 3RU3A 4XWWA 4XD2A 5K7SA 2JJ1A 1RWOA 3N2KB 1IOZA 1J6UA 3SF8B 1P6QA 2R46A 3RYFA 1U9IC 2D00A 4EDFA 2OHIA 3MWEB 4BJ6A 1RAHA 3CRRA 3J7AS 1W6RA 2HADA 3VYRB 3TZ6A 4XJXA 4XSVA 1KKUA 4E94A 1I1NA 3CNOA 4B9EA 1RSZA 7ABPA 4NOJA 1IDOA 3ZU3A 4X54A 3LQ1A 4WMLA 2IYWA 1WS6A 4WGGA 5DHPA 2NVUA 5IDVA 1MB9A 3ONVA 1NLYA 3M3DA 5CTJA 4ZI7A 1WR1B 1J2TA 2QOEA 4UZFA 2I2WA 1WB4A 1SC1A 3HQ4O 4X66M 5LMZA 1RP7A 5DCWA 5IM5A 3GGPA 1IXRC 2J6IA 1XOIA 2Q49A 4YUZA 1BO6A 2ILVA 4Q00A 4PHCA 1UWVA 4D8TA 2HPZA 3BDAA 3VOAA 1QK3A 6LDHA 1BU8A 3ZE1B 3DV9A 3T9AA 1YULA 2BGWA 4TQUS 1E2BA 1XN1A 4P3OA 2UUCM 3AW9A 3CHYA 4LBYA 1VC2A 1ZZEA 2EARA 4ZOLA 1SBCA 3R75A 1KE1A 4IOMA 1LBQA 5E7MA 4GZ3A 5FLYA 1X0XA 1NX9A 1Y98A 4TV8F 1NGSA 1U7DA 9ABPA 3DKVA 4C0XA 1Z5WA 4PAQA 4D4IA 1A69A 3M1AA 5IZ7D 1Q12A 3HJFA 2ZE7A 2YHAA 2IKQA 4QG3A 4UQOA 2VUSA 3OLVA 3F7MA 3F98A 2WMOB 3T9EA 3AHJA 4MICA 3EIFA 1GRRA 2ZXUA 2KA6B 4RSRA 2BBTA 4FDUA 3TDMA 2L42A 4W7HA 1LPMA 4E6PA 1E3LA 2VAWA 1EAMA 3WL4A 4XIIA 4KJZA 2L4FA 5A4JA 1A76A 4HCJA 5DLDA 5K0FA 3U1BA 2HMSA 4M9ZA 4KNWA 2Q3MA 3VC1A 3NORA 4INJA 3QITA 1UJ4A 1Q02A 2AOTB 2HMYB 1I4WA 4DR3B 5FFMA 1C1DA 3DEZA 2OBBA 2YC2C 2RGNC 3MD0A 4YRTA 1NBHA 4IPTA 3ZDDA 3RO7A 4L2IB 1KSHA 2JJ2D 3FNFA 4ZQCB 1ZJYA 1AUVA 3RANA 4MIYA 1IOVA 5KWEA 4L0DA 2VPQA 4J43A 4KQXA 4BWGA 1DKLA 4YMTA 1NRIA 2HN9A 3SFZA 2WM9B 4P3NA 4OBEA 2LVNC 3PC3A 4R51A 4DSAA 1HKHA 1JHYA 1HURA 3KJXA 1CJSA 2H54A 4NX2A 1N9GA 4W9NA 3ASYA 1OI7A 3NFRA 5ENVA 3CUSA 3CUYA 4YRJA 3F4LA 2QF7A 1N5IA 2O1SA 1KI8A 2J0UA 3D81A 3H42B 1UDAA 4OB6A 5BY2A 4RAOA 1SCAA 1MIOA 3C4JA 3E9YA 3K71B 1I0ZA 4RVUA 5A5GA 2NTJA 5F7OA 3AUUA 4EGSA 1JHQA 1W6UA 4C3UA 1FW8A 4DZZA 3HP4A 1YR2A 5JQGF 2ZS8A 2Q9UA 3RPEA 2G5GX 4BO6A 1WCIA 1CUZA 5FTNA 3L1JA 3JQPA 3N86A 1HLPA 4E32A 4CIDA 1KQNA 3VHXA 4NMMA 4PDGA 3LO5A 4IICA 1CIPA 3EVNA 1A8SA 3O2JA 4NJMA 1JH8A 1S1MA 5EIFA 3H3JA 4BO3A 3OZIA 1CUBA 1ISPA 3NEPX 1CF2O 4YV7A 1VDZA 3S3TA 3K6SA 2HCTA 1RFGE 5D3ZA 1DWUA 5REQA 4KIJA 1RKXA 2J9XB 3R5KA 4ER5A 3VMFA 2NUAB 4EMTA 4KYIB 2WM3A 1BS1A 1T5SA 2HWYA 3WGIA 1Z26A 1YS9A 5KOHA 4YAGA 5I7UA 2IBMA 3P0EA 2PUTA 2HK6A 5JLAA 4BVJA 2D0OB 4ILKA 2QRLA 3B1FA 5TRTA 2Q21A 1BD4A 1E6EA 3NOVA 2QTWB 2P5UA 1DBWA 1ULBA 3H1EA 4B43A 1Q16A 4QJBA 5K3DA 2YXEA 3T7DA 3RFWA 1FLVA 1HY3A 2H1FA 2DT8A 3LP5A 3TIIA 4E1VA 4DV5B 2PT5A 1YZKA 4MYSA 1M34E 2J6BA 5DHRA 2JLAA 2N3ZA 3WKBA 3LUFA 1HTBA 2VKTA 2J3IA 5IJXA 1NI3A 2V59A 3G0DA 3FOZA 5B4UA 3PKZA 4CHTB 4AZTA 1AHNA 1MTOA 4FFOA 3I1JA 2PRSA 1ZGGA 4OA5A 1SXHA 2R85A 5FFNA 3K09C 3WMWA 1EXWA 4ENPA 3BMOB 4QGAA 1G8PA 2GF0A 4FB5A 5KNCA 1YJQA 1SOAA 5JH7F 1CVRA 4CKCB 1B0AA 4DBLC 2D8MA 4EY6A 4RGQA 3LQFA 3T7AA 2GH1A 1U7ZA 3BB1A 4P4GA 4B35A 1LJLA 1PLKA 4LSZA 5B58C 2OAP1 4FEAA 4HB2A 1JMVA 5BORA 4FONA 5GTDA 1EFHA 4KXMA 4EO7A 3G13A 3ANTA 1K5DA 2XGOA 1IWPB 1GN8A 5LA6A 1E63A 5A4DA 2ZFUA 2HUNA 4XM1A 3PXBA 4RPHA 2G40A 2W6PA 2G7MC 4MXDA 1M2OB 10MHA 4UM5A 4WDRA 3L29A 3S4YA 3Q40A 2VJNA 4FDAA 1DMSA 2BFAA 1VG1A 2LP4Y 3CTDA 3OFKA 1FRVA 3PNMA 3RB8A 3WWDA 2DNAA 3ZVNA 5D3KA 2I3ZA 2VJKA 1SNYA 3EVGA 1M6VB 2Z95A 1JLRA 1GUBA 1KHTA 3CZAA 4RESA 4AO8A 2YJ5A 4DUGD 3RU9A 1D6MA 3EZ6A 1OBFO 3DWFA 2LV8A 5F73A 4RWEA 3OQJA 4KO3S 5CA0A 3B1ZA 2ZM6B 3R6LA 2JEOA 1X80A 1P7ZA 2NZVG 3GARA 5E2IA 1RABA 3U7HB 1UKZA 2CWBA 1XCPA 1KJQA 3OQHA 4ZO4A 2OCAA 2IIPA 4BQOA 2DYKA 3AP2A 4TLAA 2C9MA 1EFPA 3I01A 1UJMA 4TYMA 1EUCB 5BYBA 3S1AB 4QX6A 4PYQA 1TQHA 3NNDA 4UTZA 5ESWA 3U6KA 1U4SA 2W58A 4HDMA 3X1XA 1T2FA 1T3LA 4PPNA 4OGKA 1W88A 2IPNA 1K8XB 3QHAA 4Q4HB 5KPZA 3LT2A 2GSDA 1MX5A 1DUVG 4TYNA 1UXIA 5CA1A 1EAYA 3E9CA 5ILOA 1P44A 1BWPA 3AHGA 3W5UA 4NCBA 3MM4A 2HFKA 4Z4HA 1X1CA 4ZGBA 4Z3KA 4UHEA 3UY4A 3RM3A 4MGHA 2A30A 3FUVA 4MA5A 2UZAA 1RXYA 3IIIA 3FH0A 4F1KA 2XZTA 1GWNA 4EELA 3O75A 3I0ZA 2XB2A 2BI4A 3K4PA 1ZMOA 3GDOA 1P2TA 4YQEA 3QIVA 3SKXA 1P6XA 4OYHA 3NBFA 4K9PA 4POAA 4Z0NA 3RSHA 4YRSA 4L16A 4Q7QA 1DHRA 1TAGA 3RYCB 4B85A 1P31A 4LXGA 3JWEA 5EMHA 1CS0B 5KQRA 2G76A 1UK7A 2CLOB 1OT3A 2QW1A 5FNZA 4Q4AB 4ZHQA 1I3CA 2QL9A 1CR2A 3B1KA 4QKQA 2JY8A 3HYTA 3J7BA 2DQ4A 1Z47A 4DBZA 3DAGA 4KNYA 2P2DA 5K8CA 4YCCA 3AVPA 4RE5A 1R4NA 3QPBA 1TX4B 2R6DA 3HL4A 2JKYA 1GABA 2UYGA 5F5LA 3B8EA 2QAGB 1W0KA 1DQSA 1M5UA 4U7WA 2F5NA 4YHHB 5HKAA 4CQNA 3O6VA 3BILA 5LQMA 4V0ME 2ZRLA 3VR5A 2XE4A 3IMKA 2WJVA 4E2WA 2H1RA 1MG5A 4B87A 1O6GA 1XEAA 3QE4A 4L0QA 3ADBA 1IZ9A 4OLBA 6REQA 1Y6GA 1KJIA 2QRGA 2EVWX 2AMFA 5GONA 3LMKA 2FW0A 4N7MA 2I4TA 5BMVF 5DYIA 1GTSA 2XZLA 1QYVA 2V7XA 2RHLA 1NTOA 1OILA 2NIPA 5LBTA 1I9CA 1CUSA 4DIEA 4PO1A 1PGNA 1ZL2A 2GOYA 1MB0A 1IRIA 2BZSA 5D84A 4M38A 3KQKA 3VOSA 2OV6A 3NKVA 3V6MA 3OPMA 3PX2A 2YYAA 5BVGB 3ENQA 2RI0A 3ST7A 5FLXA 4TXLA 3FCEA 4MWTA 3OCWA 1DUIA 3IQIX 1FW6A 4M22A 4MW0A 3WGYA 1NNUC 4G6ZA 3KYCA 1IBMM 4BMNA 3HS3A 1K8ZB 5D6NA 3BGOS 3DE7X 1QWOA 2AV6A 4MPJA 1SIWA 1HTTA 3P32A 1L4EA 4DXAA 3LTEA 3REFA 3GXBA 1RS0A 1EP3B 2BEWB 4R84A 4IIJA 5HIJA 1JQEA 2YNMC 3DDHA 3WRXA 3GJYA 5TPZD 2PT7A 2N9UA 1PR1A 1GUZA 2QYHA 5AM1A 4FYWA 2ACWA 1MEEA 2Q6OA 4LRTA 1POWA 3AJ9A 2HSGA 1C7EA 3HCWA 4FXOA 2D4HA 1JL3A 5E8RA 1N1MA 4B74A 5P8WA 3FAKA 2WJIA 3I1YA 1Z0SA 2A33A 1QX4A 3KCNA 4R6XA 3PNSA 3LPMA 3AUYA 3CUUA 2Q2QA 3F67A 2EKZA 4L74A 4FW8A 5LL6P 4WNAB 1YHYA 5E7JA 3A3KA 2QJFA 4ALIA 1SUIA 3W5AA 3JQ8B 1JJFA 3FCSB 3IV9A 4XLLA 1M5RA 2OMEA 3MMNA 3ZNOA 2R8ZA 4M0MA 3SE0A 4YMLA 3SWWA 3ZNQA 3GU3A 4IXTA 1EUZA 2BGLA 5EWJB 3I4CA 2CC2A 5DM2A 4XOUA 1P1CA 3IBFA 4LQ4A 2EKPA 4M7RA 1RJGA 1LDGA 1N6LA 3QX8A 4BO5A 1GGJA 1MX9A 4JQCA 2AS0A 1DOZA 5JMPA 2AOUB 4Z0PA 1O95A 4JI4B 3FFWA 4HGQA 3W2GA 3DZHA 1K3WA 2GDJA 4US0R 5IKMA 3QVKA 1N5MA 5IU6A 4Z0TA 2WBLC 4NC6A 4OHRA 4YFVA 1K08A 3I9KA 3RK4A 3RD5A 3H11A 3VVLA 4HEA1 3GJ3A 3H2BA 1FQKA 2A1TS 3IAUA 2WAMA 2GHRA 3L1HA 5CVEA 2B20A 4X61A 1W87A 1EE2A 1RQ7A 1KDPA 5AHXA 3T7TA 1RMTA 3ZY4A 2JLUA 3GFGA 4HZUB 5CH8A 3SQWA 2EFCB 1DKMA 1SU4A 2IPMA 1NMZA 4KZKA 4II7A 2AOTA 3ROZA 4IR7A 3A4YA 2R751 4H7DA 2AGVA 1DG9A 1N5RA 3TJMA 1WMEA 2RHHA 4KVZA 5BSRA 2KDLA 2VDOB 4DE5A 4ZA2A 1Z0UA 1G41A 3K8QA 1DXYA 3A1NA 2AJ8A 1TH2A 2FJ0A 4D0RA 3HH8A 5B64A 4OW0A 1GU1A 3KBBA 2XB8A 1C50A 2OP0A 2PNJA 1P81A 3GLIA 5IDYA 2PGDA 3ZE2B 1X74A 3G5AA 4L07A 3W79A 3L0PA 3UUFA 4G41A 3DP9A 4KH1A 5L4LA 1UF9A 4F3TA 4F2HA 3CINA 1SD1A 3F8TA 3KW6A 5FB3A 3OT1A 5CX4A 1VG5A 5E7QA 2LD4A 1UFVA 4AZVA 1ZW6A 4M0WA 4NJEB 4Q9KA 4KO4S 3X1YA 4PX9A 5COBA 5EE5B 3ZI0A 1G6OA 4WKBA 3V4PB 4TSFA 1C1YA 1F14A 2P2YA 4D4MA 4LG1A 2WTAA 4HQ0A 1R8SA 2QV7A 3G5LA 3ICWA 4KR7A 2Q07A 1W36B 4B1FA 2WT9A 5F9FA 2SECE 1KKLA 5KTNA 1TM7E 3UYLA 2YZMA 3JQDA 1U90A 1KPIA 3BIWA 4H3KB 4C78A 1GUDA 3QXGA 3HB7A 1UR5A 2GK6A 4G0MA 1EWRA 2QD4A 3HFSA 4MR8B 4HQRA 4NBRA 1BWQA 2WUVA 5HP4A 1EIZA 2HZBA 3B51X 2Q9CA 1HT1E 4GQBA 2X14A 1AKEA 1VPVA 1DIAA 4M6WB 5FNVB 4NOKA 1Z3CA 2OHOA 1YZHA 4ZDWA 5A2QS 4MVJH 3UMFA 1UQTA 1YRAA 4F5WA 2A94A 2NUAA 2UZ3A 4A8JA 5L3QA 4MQLA 1T6NA 4XI9A 4NRWA 3TG8A 1FTWA 3PTLA 1VB3A 2FRDA 5LUBA 5IH7A 2J3DA 3WWYA 3BF7A 5B57C 2ADMA 2DWUA 1VDDA 2EO2A 1UMCB 1QZXA 2FP3A 3VLFB 3DDSA 2W70A 4DQXA 1KZHA 5C31A 1ECFA 1MN3A 2G8NA 4EHNA 4Q7EA 4EA8A 4FIDA 3ZD6A 4LK3A 1QP4A 3LUDA 5C1PA 3TOCA 1ONOA 1D6JA 2J3JA 4PLCA 4RCZA 1Z17A 4U00A 1W49A 2FR8C 2N47A 1YS4A 1WV0A 1P4SA 5CNKA 4BX2A 1F51E 3OICA 3LK6A 3IP6A 3LH5A 4QUHA 3P9RA 3VDRA 5E9JA 4D8YA 2D3WA 4B6RA 1H8HA 2ZJ8A 4EKYA 4XD7A 4DEYA 2ZQ5A 3FDFA 3FTEA 4MWZA 3RBXA 3TZQA 1I6KA 3AY6A 3LLSA 4LRQA 1VA5A 2Z6VA 4IQ8A 2FSPA 1YE8A 4MV3A 2CNOA 4HB4A 4QLOA 4J1QA 4HX2A 4J0CA 1E3SA 4N39A 3RAEC 3ZGZA 4CR7A 1NRJB 2QTNA 5DIFA 3DVQX 4RPCA 3AVVA 4NARA 1ZHFA 1FTGA 3KVRA 2BKXA 3NWLA 3ROXA 1JIKA 3HU3A 1DJMA 4FWDA 5EYPA 5DB4A 3QBEA 1L0BA 3LX4A 1SOVA 2HA2A 1WRBA 2QJOA 3O74A 2ZSIA 4R0VA 4R2WA 1SQSA 1QJCA 2ZZMA 5TS3A 2ZVPX 3GLGA 2LWIA 4CTMA 5DH9A 5ADHA 1AKVA 1NR7A 4ZKEA 3ZCPA 4HMPA 3DFIA 4BNIA 4A0SA 1DX4A 2QEQA 2BGMA 1SCJA 1UM9A 1SUPA 3DOFA 5E6SA 2GHQA 3O9VA 2DAKA 3DQZA 1O9GA 4QD3A 3V33A 5KKNB 5HZGA 2GF9A 2WAXA 4RKYA 2XZFA 2ZPTX 3QBTA 2VHVA 2VJCA 2HMAA 3F8WA 1UP4A 1XALA 2N46A 5KOIA 3Q8GA 3WDLA 1FNMA 3HEBA 5BVHB 1V3UA 4J7AA 2FETA 3HBJA 3SR4A 3THXB 1QIGA 2MYNA 5AK5A 2MMCA 4P3YA 2RGRA 2CZQA 3O03A 4YYZA 1P39A 1VPDA 4N03A 3C3CA 2ZJ1A 1XZJA 2OD9A 4M1KA 2CMFA 3HYSA 4Q4HA 3OG9A 2QRKA 4UHKA 2HHHB 5TQ2B 2JJ8A 3JTMA 4YT2A 5IZCC 2HSEA 1I4EB 4Y2XA 1YR8A 2P62A 3EXHC 5HRUA 1Z6ZA 1O7JA 4LE2A 1V7ZA 1XJCA 1Y63A 6AT1A 4D3DA 5FUQA 1HL7A 3CZ9A 4I50B 5EJ5A 3P2EA 2JHFA 1J23A 4GI2A 4LZAA 3UGQA 2IH4A 1QHIA 1E60A 1VPEA 2F1KA 3VK7A 1QP7A 2RKOA 4TLLB 1ISMA 4L15A 4PW0A 2B4KA 1PW5A 2HIGA 1V71A 3I2GA 1NN1A 721PA 3L8YA 3HA2A 1GRVA 1DX6A 3I45A 2E48A 2MSNA 1DEKA 3EVDA 1QFXA 4RHFA 4G0QA 2AUNA 1DZ3A 3CZQA 5CDUA 2VH2A 4DSZA 3TE7A 2LVAA 2X5NA 2Z2IA 4FHCA 3JR5A 1GZ4A 4KP7A 3QEBZ 1Z63A 2GZSA 3RYCA 3RSSA 2XUKA 2JAWA 4RX1A 4LMRA 3UWMA 2ZJ4A 3LUAA 3GRVA 4Q4AA 5JEDA 2B8NA 3R6DA 4IXDA 3SN6A 1VKOA 3TW4A 4IH4A 5DN9A 3PWZA 1BS9A 5EKTA 5G0UA 3MD9A 4X3PA 5E6UB 3UFXA 1RRFA 3LHDA 1NLFA 3KKQA 2OBYA 4B4VA 3W0LB 1N0IA 2QAGA 3ZQ4A 3DTVB 4C4YA 1PJLA 3O1IC 1EPUA 3QE2A 2WWWA 1DT5A 2ZOSA 3CGGA 3SC3A 5C4IA 5EIBC 4HS4A 5CW2A 4MV1A 4O63O 1KU0A 4J3NA 1M2FA 3U4CA 2WD8A 2C9CA 1CZRA 3Q11A 3WHKA 3KBOA 1Y4DE 2P3QA 4MGKE 4Y6GB 3E7DA 1FSFA 2IH2A 2IW3A 2WJHA 2PRJA 5KQSA 3HYCA 2AJCA 1I24A 4R1PA 1FS5A 4MV9A 2B9EA 3GHYA 1ZNWA 5K0LA 1CEQA 2DB3A 3PIRA 5FTLA 1HQDA 5KJ6A 2D5AA 3DAPA 3H86A 4KBYA 1MUUA 2WHQA 2RONA 4JDPA 1O94D 1SBIA 5BVGA 4BLTA 2XOKA 2ZTDA 1RTKA 1BCSB 1J25A 4UU1A 4AZSA 1OT5A 3D6FA 3ES9A 4XIFA 2WD7A 4RVHA 4QTUB 5HR5A 4V3BA 3KTFA 4QRIA 1PRYA 2P7HA 3AUKA 4DF3A 5JVDB 3GLHE 1DAIA 4G5QA 3ET5A 4OHKA 1Z2CA 5LWQA 2HJGA 4H77A 2R8RA 2QCUA 4QVKA 3FTPA 4UUOA 4W7SA 5KX5F 1UPTA 3TMYA 5CT4A 1AN9A 2K6BA 1MQ8B 1D2NA 2ZIWB 3UUWA 2O7NA 3PNLA 3MJFA 3NG1A 3FG9A 2BAGA 3NEJA 3EEFA 4PN7A 4Z0HO 2XGSA 2ERYA 2MYTA 2Q0QA 4W8OA 1H3FA 1HE8B 1NU6A 5EESA 5TVGA 3QY0A 4LVUA 4KBGA 2QE7A 4YK7A 1ORVA 5AKZA 5EJIA 1PT7A 3U0BA 1L3CA 1Q22A 1JKIA 3A10A 4ZU1X 3T38A 2WZBA 1XP5A 1JLKA 4L6V6 1KH2A 2PWAA 1E3JA 3P9XA 1F7UA 3ONNA 5B7PA 5JDIA 2A35A 4F6RA 3DFZA 3G3EA 1R0RE 1HJPA 2CFIA 4XB6B 2F64A 2Y3IA 1T36B 3D8RA 3JQ8A 3EWSA 2PLFA 1L7RA 4UFPA 3STXA 2Z2YA 1SKYE 1U8AA 4E03A 3PHLA 3K4HA 3HZRA 3N2ZB 3B20A 3MTQA 2GVNA 4NNPA 2PGAA 3FAZA 1NYLA 4U8HA 5A6SB 4N12A 1RFLA 5JPCA 2WJ3A 4I46A 2XCUA 1CQIB 4UBKA 4ZANA 3EZXA 4Q1BA 1M6EX 2ZUVA 4IX9A 1ECCA 4R8VA 1WBDA 3T35A 5TX7A 3UMYA 1CR4A 3NDBB 2OBNA 3PCTA 3A6KA 5T57A 1VCHA 3JYNA 1CSEE 2LIVA 2QUBA 4RDXA 4BNDB 1NC3A 2OBMA 1RQGA 4YECA 4AC9A 4D25A 1US8B 1PJCA 2OV8A 1BNCA 2FW6A 5JAOA 1XTTA 1G6KA 2CSUA 2Q5LA 3U44A 3HDYA 1CTQA 3OZBA 1KI6A 1E7WA 4HEQA 4CN8A 4GS5A 2CVFA 1F2TB 1W2HA 3RC8A 2YZ2A 3PDIA 3DAYA 4HV4A 3N2GB 3MS2A 4NFYA 5CHYA 1Z2PX 5LIPA 1ND6A 4FFVA 4HNAA 5C8YF 4KBFA 1T0JB 4HGRA 3V7UA 2O19A 2GNOA 4J7UA 4DM3A 1W46A 3EMKA 2Y67A 3ANXA 1F7VA 2E37A 1DIRA 3A1SA 1U0SY 2HNKA 3L0DA 3GRFA 4HRXA 1JHAA 4X64M 2CLCX 3C3XA 3HCEA 1XZIA 3IPLA 1LBIA 3J80S 1FS4A 2PBRA 4E5PA 3PDWA 1CZOA 5IC6A 3JZMA 4FKMA 3HR8A 5KMGA 1TC2A 2AT1A 2QDXA 2FWRA 1SHZA 1IWOA 4IVQA 1VE5A 1II8B 3NAGA 3NHSA 3A58B 1EVLA 1RVV1 1P3QQ 3C6YA 3TW8B 3JD4A 4ADSG 4X65M 5JS2A 5I8WA 1CJUC 1Z5VA 4PC3A 1XX6A 5BR8B 1Y5MA 3I52A 4WX2B 1U3UA 4UD6A 3K5HA 3UWDA 2ZW9A 1II0A 3H9EO 3ZHRA 3GMTA 4S12A 4DPMA 2EP8A 4PGAA 2VK8A 4R1SA 3X1JA 2O8BA 4CU2A 1XTKA 1J90A 2C4NA 5IC5A 4RSGA 1E99A 4WGFA 4WVLA 4PAGA 3T0IA 3KOUA 3R3HA 1LQ2A 3ZHZA 3KDPA 2PZMA 4X62B 4YAWA 5LMUB 1GITA 3I6ZA 1Z0DA 3UANA 4YRMA 1WQ4A 2FOIC 4ARVA 1A9SA 1OLXA 1T9DA 2JAQA 3ICQB 2X6RA 1Y9ZA 5FI5A 4O4LF 5FBRB 4J2TA 4HC4A 4WXYB 4LAFA 4X85A 1UT5A 2WIDA 3EIWA 4EENA 2Y4NA 3UMJA 4PCLA 1OH6A 1FE8A 2CL0X 1YJ8A 3LUJA 4IJMA 2OYRA 1JJ7A 3K70D 4PQYA 1GDTA 2J6CA 6ABPA 4MRMB 5IYZA 2E4AA 4FD3A 3DKKA 5LQJA 2ZRNA 1B14A 2P69A 1C3OA 2FZVA 2P3SA 2BI7A 5L4SA 2ZTCA 1L4HA 2VDBB 3V8NA 4DQDA 2EFEB 5BYAA 5DN6D 5K2OA 4G81A 2JD2A 2BYTA 3PD0A 5HSGA 3UB2A 1JB9A 1U28A 1PT5A 1TMKA 1OPRA 3KD2A 1NFQA 3SI7A 1OROA 4NYJQ 2A14A 3BQNB 1Z38A 3WLAA 5EZYB 2B0JA 1JZSA 3WBFA 1CY8A 3NANA 3N07A 1HG0A 3BMCA 3HNRA 5KYGA 1PV4A 2AYXA 2VUIB 4RO0A 3IV6A 3TIFA 4QICA 5B6JA 2H65A 4EG8A 3ERCA 1DQRA 2ZRIA 3MRTA 4JJ6A 1Z6AA 5F23A 2LVQD 1TZBA 2J8ZA 3L25A 1ILEA 2VRCD 3GUVA 3N7AA 2PXAA 3CKLA 4QTZA 1QSGA 4E5SA 2ZWOA 3FNRA 1ZINA 1TECE 1Z5PA 4S0ZA 5FXMA 2RD2A 2RHCA 3BFKA 5DLYA 4DZRA 5KQ8A 4Q3CA 3VPCA 4JLPA 1C4WA 1RU3A 3WO0A 1FJXA 4BEVA 3NM6B 2CVOA 1FX1A 1SVLA 2VZEA 1QM5A 4TTIA 2CKDA 3ZDCA 3N8HA 3O4IA 4NMLA 3PFNA 3ZGYA 1NV9A 3U5ZB 3E9ZA 5KAMA 3FRJA 4WLEA 3EGXA 2PXXA 2Q46A 1GEGA 3COSA 2Y27A 1N0VC 1DKOA 2EZUA 2X2FA 3EXIB 2NU6B 5AM3A 1Q2XA 3WQBA 2JLBA 4YJ2F 5ES3A 3X0DA 4RK4A 1Z3IX 4P7KA 2JFVA 4XGRA 5EPOA 1NIPA 1WXIA 3Q8WA 1V2HE 4B81A 4DV1B 4DDTA 4G1MB 3HB9A 4EJ6A 2WIKA 1OH7A 5LLSA 4MP6A 3ICVA 2MR9A 3AM1A 2QIPA 1OB5A 2XRYA 5CCDA 3DD1A 5BVHA 3M3PA 2ZE5A 3U4QB 5J5VA 1E9AA 3P52A 5FUXA 2TS1A 4JL8A 4RABA 5KNLA 5IASA 2YFYA 5IREB 3QXXA 5J1SB 1QWSA 2DEUA 3SR0A 3C6ZA 1F5SA 2JLQA 1R15A 4HWGA 3QW2A 1XJ0A 3V7WA 5E9QA 1PWEA 3UJ3X 1WXQA 2I2BA 3CZRA 1JZQA 1URPA 3ET4A 3ZBTA 3OFVA 2UXBM 2IDKA 2QP4A 5CHEA 1NF3A 4I50A 1ISJA 3BSWA 3JQEA 3DMYA 4OIFA 2C84A 5DXFA 5KO3A 1U94A 2IH5A 1DT3A 4QYSA 3HKBB 2W8BB 1USUA 3PFBA 3TF5A 1NVMB 3EDYA 5ITZA 2I33A 1C9DB 4J0EA 2Q3LA 1LSJA 3WGJA 1NZJA 2CW5A 5EMLA 3L40A 1QLHA 5E9AA 1F4PA 1F8XA 3U19A 2QNRA 4S1PA 4OH1A 2VDWB 2B6NA 4DVGA 2V8BA 3P94A 4DADA 1YA8A 4FS8A 4G5SA 3NKLA 1H1LA 1S89A 1UJCA 4MKRA 1CYDA 1YZYA 3W78A 2EQAA 2W2PA 2W22A 3V8BA 3IRVA 5HG0A 1Y6FA 2Q99A 4MCHA 1NAHA 2YCLA 4H4DA 1YCGA 2CVHA 3OU7A 2GQ0A 5MF6A 1KZ4A 1XZCA 4GYWA 5I7OA 2VTVA 4YJHB 1QDLB 3G68A 5JNRA 2DJIA 2CBXA 4D0SA 3PTZA 1YOVA 1GADO 3DZGA 3CU5A 4IBEA 1E9EA 2BEJA 1X9HA 4IIUA 3VH4A 3P2KA 4IILA 3M1IA 1ECLA 1Y8AA 1D03A 5CB6A 3N8IA 1XGKA 1OD6A 1ZMVA 1E6CA 4OXNA 2ZRAA 3I9V1 2HR1A 3GN1A 4P8RA 3C74A 3PBKA 3KVVA 2XWSA 5EGSA 3L4JA 1CUHA 3IQZA 1JPVA 3RDPA 1T9GR 1H9BA 1ZCBA 3A6JA 3INNA 3B5EA 4FE7A 4Z3OA 3X44A 1W1IA 2WYWA 2JFFA 2QRVA 2H2IA 3H2IA 1XRPA 3UYKA 2CEAA 2FSSA 2JZ0A 1SQ0A 4EP1A 4ZYXA 3BHJA 3TFOA 1WXWA 4ZT2A 4CUJA 2PGOA 4ZVRA 3HTXA 4G37A 4LY0A 4DM4A 3LVWA 3NWOA 4RL6A 2BZGA 3RNOA 1JSLA 1DEOA 2P9FA 3IUPA 2QL5A 1VHQA 3GC6A 5L8RF 1XNRM 3EUFA 3UB4A 4A5SA 2ET6A 4RGVA 5FWYB 1GPYA 1GN9A 4OMUA 5AM0A 3DC7A 1YFLA 5BR7A 3K8YA 4RSMA 3MYYA 5KYYB 1U2SA 1RM5A 3L0SA 4EMUA 3E53A 2HBZA 1GRCA 2X2PA 1QCCA 3AM5A 3KD3A 2Q27A 3TCNA 4X3CA 4Y0AA 4PVDA 2GKGA 4R8RA 1EFLA 3AJIB 1PIWA 4I1IA 1EBBA 2H2WA 1S4MA 5CEJA 1NPDA 1KJ9A 4AJ2A 3FUWA 3T5BA 1H5QA 2O05A 3QPVA 1Y7PA 3ISJA 1G21E 3OPYI 3IIMA 2CDRA 3W1VA 5DSTA 1J99A 2OHFA 4X8OA 1OWLA 4P4SB 3TZKA 1P6UA 4FEGA 5ETJA 1ZU4A 5JZ9A 2VWQA 2JLCA 3WXBA 3QY9A 1HE3A 1E3WB 4BVFA 5AVWA 3N0TA 1MFPA 1NFFA 4C4ZA 3KKPA 2ECKA 2GETA 1Q21A 1ND5A 3W9SA 2W2LD 1ZUD1 4F45A 3NGMA 1ZD2P 3AC0A 2WIAA 5CH3A 2OQVA 3VR2A 3B78A 1WVMA 2WMYA 2OO5C 1DTWA 3OCZA 1AHHA 1X15A 2RDMA 5B4TA 1MOZA 3PDJA 2P6RA 4TKVB 1PUIA 3TTUA 2OC4A 1IN7A 2PE5A 5KI6A 4IBBA 2CYCA 2HQ1A 1QVZA 4HMOA 4KG7A 3L43A 4K6FA 2SNIE 3TLGA 2ANBA 4IYRA 5FUVA 3QYFA 1C7JA 2IXDA 1YVUA 1YZFA 2H5JA 4WXEA 4BJ3A 4JP8A 1HUQA 4YJ3A 3N39C 1RRMA 3W8NA 3WZLA 1MQAA 3WLTA 4ZZ2A 1W4CA 1ZK4A 5K3SA 5LDHA 1MRNA 3CC8A 5HE8A 4LJ6A 3N2YA 5HMLA 2ZSBA 3AETA 4W5JA 2ZRPA 1IN1A 4WOCA 4PLTA 4JNKA 4BNDA 3FD9A 4HFNA 4QYMA 3CURA 5LP6C 4BFLA 5DTJA 2VDMB 2DUNA 5DNWA 2ETVA 5EJFA 5JCXA 1CLEA 5AOBA 4HDKA 2NOAA 2P3LA 3VV2A 2I2AA 2G1PA 4JYAM 2VPXA 1ZCFA 1DPFA 2NUBA 2GPYA 5HPYB 3VNVA 2MTBA 1U2DA 3H8JA 1XLVA 3SSMA 4TTSA 2DWNA 3H7IA 4IBFA 2C54A 3I2HA 4V0OA 4PICA 3ED5A 3MCUA 2EG9A 3LY7A 4WUTA 3TOXA 1T8PA 3PUJA 5IZ4A 1C7QA 4FZ3A 5J2TB 4HWTA 1TUBA 2O5RA 4RKEA 4DUZB 4LOHA 4A36A 4L6IA 4GICA 1MRZA 2I34A 2OZPA 3VU9B 1ZNQO 2QB5A 4TV9A 3KTOA 4RS4A 4RVOA 2EBWA 4N3BA 1U3FA 4MGIR 2ADFA 1Y3AA 1CC1S 2H9YA 3BJRA 4UEJA 5LOVA 1V11B 1UP6A 5HBGA 1NT4A 2AFVA 3QMVA 3VNRA 3EOBI 2QM3A 4QOIA 1TEHA 3KKLA 2CY0A 2B82A 3FF1A 2C2WA 2WZQA 3BAZA 1L9KA 5AVRA 2FLKA 3AEKB 2QNBA 5CVJA 2OYSA 3SQDA 2FSIA 4FGJA 2WZCA 4PC1A 5G1NA 4X1OA 4OHFA 1EE1A 4QTTB 3TW8A 3T1VA 3GQBB 2G9VA 2DCMA 1E2PA 4FNGA 2XVMA 3MJSA 5TQ0B 1NW5A 4ZYWA 4URUR 1HYQA 3FR8A 4H17A 1GGKA 1WNTA 4JROA 4X8HA 4HPJB 1U4NA 1Z5CA 4HTAA 2GGSA 2AUMA 3U13A 4FYYA 3SY8A 1GJSA 1V7CA 3UHAA 3TMKA 1WAMA 4GKVA 1J8MF 4P0TA 4B3DA 2JH8A 2ZITA 3ZTTA 4D8WA 1MABA 1R18A 3KC2A 4ILEA 3OIVA 3QYJA 4ZZ1A 2DHCA 3DMTA 2FV8A