3U60B

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
MITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
total genus 103
structure length 319
sequence length 319
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u60B01
1Z0KA 3K9NA 3MGCA 3WP1B 3HU3A 1ANKA 4YC7A 2CMKA 3R9XA 5UKDA 3MWLA 3M1IA 5DN6D 1U0LA 4NMMA 1EK0A 1ZC4A 4IDPA 1YKSA 3FPAA 421PA 2NO1A 3PUYA 1D5CA 1RZ3A 4XWKA 1E2PA 2GESA 3HWSA 4C0AC 2HT6A 2GVZC 2WMNB 3E70C 2XXAA 3LFUA 3WNDA 4LRTA 4Q9JA 2G3YA 1CLUA 2NO7A 3QUSA 5CB6A 3NC0C 3U3OA 2ZRDA 4US2R 4MITA 1E2HA 4WZ6A 1KY3A 2XZPA 5JI2E 1R7RA 3BH0A 3NBZC 1TEXA 3K0AB 1YZTA 1EFRA 4D4JA 4DZZA 4F93B 3PEVA 2ODNA 3DM9B 4JKYA 1TF2A 3THYB 2JLZA 4PHTA 3L0OA 4E09A 2GCOA 4P33A 3SHWA 1AA9A 2ODBA 2XX3A 3E2IA 4G0NA 1BKDR 2FZLA 4ITRC 2XB4A 5G40A 4DLWA 2R2AA 3L8ZA 1PLJA 1ZM3A 3SEAA 2P3SA 1P62B 2WPDA 1KY2A 3K0CA 5B64A 3R7WA 4A6PA 1SVSA 2Q3HA 4Q66C 1N6PA 5EJEA 4I1VA 4C2TA 1KNQA 2I1QA 2IYXA 2RGNC 5BN4A 3EX7C 1I4DD 4B73A 1NNEA 3BORA 1Z5ZA 1VYTA 2CNWA 4EPXA 2UZIR 2QQ0A 1PLLA 1BMFA 3A4LA 2WJYA 1XCGB 2Z5FA 4AI6A 3RANA 1X1SA 2GZHA 4FXPA 2DBYA 1U8AA 2HV8A 4P3YA 3VNUA 2QM7A 1GM5A 1DTSA 4QGGA 4B6FA 4J0QA 4M8NE 1DVRA 1KTVA 3AUXA 5KSOA 1Z6YA 2WKPA 2WSSA 2GJKA 4ASUA 2R6DA 3QNUA 2GCPA 4G5QA 4BLOA 4CF7A 2CK3A 1CULC 2ZE5A 3TQFA 1XDBA 1AS3A 2ZJZA 3B1YA 4TLEA 4LJAA 5E95A 1M6NA 1DPFA 5SZIA 3UATA 5E7IA 5TMPA 2VHQA 2IS4A 5JMTA 3FHOA 4Q1FA 3PITA 4RCYA 2ZAOA 4PC7A 3ICQB 1QDEA 5EE5B 3A1TA 1GSIA 2Q6TA 4TZ0A 1ZJ6A 2PX3A 3FKSA 3B7GA 4CEJB 1MR3F 4Q18A 1TU4A 3AVYA 5HCNA 4TQAA 4QOSA 3D8BA 1SHKA 2IYQA 2R6FA 5CM9C 1KMHA 2ORIA 3P20A 2IYSA 1G5RA 4Q01A 3QSYA 3KXLA 1KO4A 1GKIA 2DFKB 4MKFA 3CIOA 3WYGA 3PIRA 4MDEA 3TIFA 5KSPA 1ZC3A 4M9QA 1XMVA 5EXSA 1UFQA 1E9DA 1FP7A 2R9GA 3QI2A 2VQSA 2BMFA 4NU0A 4WXRA 3Q85A 4TSFA 1U99A 3KXIA 1KI6A 2DWQA 5AK0A 1E0KA 3CKLA 4A9AA 4HZIA 1DADA 5FBWB 2JASA 2JLSA 2O8EA 3ZQJA 5FTJA 1CBUA 3B85A 1IOZA 1Z6AA 2RGBA 3FTQA 3GJXC 3QVUA 5C4GB 5KU1A 3BFXA 1Z0JA 1FMLA 4IOKA 1XXHA 1XB2A 1VHLA 3EWSA 3NH9A 1UKEA 1TNDA 1W48A 1NN3A 4PHGA 5KHOC 1PVOA 1EESA 4Q9IA 2ZITA 3AVOA 2ORWA 2ZRAA 3HYRA 3VKHA 4DLXA 1BH2A 5G53C 4CT4B 1KK0A 3U7FB 3BB4A 2ANCA 3GFTA 2DWOA 1HE1C 2OAP1 1Z2AA 1ZW6A 2VH5R 3ZDQA 4NCKA 5FUXA 3T1QA 3AKEA 2DY1A 2RKOA 3EZ9A 1QHHA 3BS4A 4PPGA 3U5ZB 3RS4A 5FBRB 5L8VA 4B74A 1NKSA 1IAQA 2NOAA 4TQUS 3TMKA 3TUIC 5L3VA 2AKAB 3V00A 1SVMA 1T3SA 1RIFA 1ZUNB 1DAKA 4V02A 4FCVA 3ZLJA 1W7AA 4D0NA 1AKEA 5J40A 1S4QA 1VYUA 1H8ED 1VECA 1E1RD 4NCNA 4TMZA 3U7GA 5JCPA 1R5BA 4JYCA 1QVAA 3QF7A 4AKHA 3B1ZA 2OCYC 2VF8A 1HT1E 1J99A 3ASYA 4EPTA 1KSJA 4DC9A 3D6TB 2F7SA 1OE0A 4EPVA 1N25A 1X8KA 2YJTD 3MJHA 3GP8A 2FSHA 2ZRCA 1GWNA 4RKFA 4LJ5A 1IN5A 4NHOA 2C03A 2C5LA 3R9WA 4TSFD 3M0EA 1KYIA 2WSMA 3PXGA 2WAYA 4ABYA 4DSNA 2E1RA 2O8DA 5HR5A 2FGJA 4QHTA 2NO9A 1DS6A 1LV7A 4HAVA 5JRJA 1KHTA 2VYFA 3ZQ6A 3KFVA 4I1UA 4ACBA 1OIVA 4C2UA 1U2RA 3GJ6A 3TUZC 2REXB 2KRKA 4XD7A 3UWKA 1US8B 4N1AA 1NSTA 3TKLA 1NLYA 2BBWA 2CVHA 5CDFE 2FDCA 3AJIB 3NDBB 3T06B 1GILA 1P3JA 1RW4A 4RFSB 3IQWA 5AJYA 2F9LA 4CEHB 3CR8A 1FTSA 2ZEJA 2D62A 5TY0A 1RJ9B 2VHTA 1Y63A 4JBWA 4ZDWA 5JZVA 1RPZA 1RFLA 3LVRE 2AD5A 3CUEF 1WF3A 4XSGA 2PMDA 4IFEA 4K46A 1P60A 3K8YA 1KSGA 2QEQA 2NIPA 4KBGA 1JQJC 2QT0A 3A8TA 1N0VC 3HR8A 2IEYA 1M74A 1TMKA 3O8RA 2IA5A 1RC8A 1NKTA 2DR3A 3LW7A 3EZ2A 2QENA 1OXSC 4KSBA 3AVXA 4HLUC 2QAGA 2OFWA 3FDIA 1EXMA 4GOJA 3TR0A 5F9FA 1X1RA 4I81A 3I4LA 4M53A 1W5TA 3IPYA 1T3HA 1KK1A 3EPKA 4GOKA 3AQ4A 4OQMA 3TSOA 1XEWX 2YV5A 2XB2A 2A9KA 3CR7A 1KK2A 2V7QA 4AC9A 2JLWA 5IRCD 3BFKA 1YU9A 1VYVA 3VR1A 1ZM9A 4XIGS 4M1WA 4M2LA 2AL7A 1EFHA 4A8JB 3SJBA 2YWGA 4OHXA 3THYA 3W9YA 5JWRA 4LUCA 2WWFA 1F48A 4DWJA 4B3GA 1ZUHA 1P73A 4WZBE 1FW6A 1JQLB 3VKWA 4DT1A 4OQXA 1DAEA 3Q7QA 1Q1ZA 2DZOB 2WJGA 2BCJQ 5CYOA 4XD7D 4OJKA 5EXTA 4I4LA 4NBSA 2WJJA 5TB5A 3ZVLA 2W00A 1OIXA 2DHRA 1NJGA 4LC1A 4IXMA 2ZRBA 4D2IA 3P27A 3IEVA 1TQ6A 5ELXA 3GLFE 2B92A 1OFHA 1JAHA 4TMVA 1C1KA 3PQCA 4HAUA 3AP2A 2WPDD 2QPAA 2GJSA 1SZPA 4KYUA 1WBDA 4CEIA 2O5VA 1HY3A 1ZMXA 1R8QA 1E2GA 1ESNA 4JLNA 4XWAA 4X8LA 2EWVA 3QXCA 2C95A 3GJ7A 3F0TA 3GLIA 1JEDA 1OW3B 1YVDA 2NO6A 5CIWA 1JI0A 4TYPA 1ZU4A 2ZRNA 1UBCA 4LRSA 1U8YA 2CCGA 3NWJA 1SXJB 1JXMA 1W4AA 2C9CA 4LHZA 4Q1BA 1X37A 2QAGB 2PT5A 2QP3A 4G5GA 1E0JA 4UNSA 4Y0AA 3KQKA 1U98A 5C2JB 1G3QA 3OAAA 4BASA 5JHHB 2AK3A 3BIFA 4RKEA 5BN3A 4L15A 1Y3AA 3G5UA 3QY0A 2AR7A 3BFVA 2QMEA 1L7VC 1B23P 3AVTA 2N1BA 1YR8A 1SVWA 4C0SA 5JS8A 4CIDA 1S9DA 1R4AA 2J87A 1G16A 3N70A 1O87A 4NYIR 3CTDA 5DI3B 4CT5A 4JMPA 4MKHA 4BFSA 2IXFA 4NZYA 2XNDD 2CLDX 2ZJ2A 1SQ5A 4IRUB 1NMYA 1K6MA 2PX0A 4U02A 3W5IA 1KSFX 4LWZA 3OEED 5HCIA 1RKBA 4AKGA 3AH8A 5FPYA 4II7A 2OCPA 4TYNA 2ONJA 2WIAA 3ZD7A 3KJHA 1ODFA 2ZJBA 3NH6A 5DYGA 1ZD9A 3QKRA 4NYMQ 1AM4D 1M7GA 2ZI4A 3AF3A 5LD2B 1US8A 1M8PA 2EFEB 1ZCBA 1Q21A 5GADl 1G8YA 3EASA 3ND9A 1JNYA 4PQRA 4ZKEA 4RD4A 4E07A 2IX3A 1M2OB 1LVGA 4GITA 2W0MA 1DAGA 3IO5A 5AUNB 4JLAA 4LHVA 1LY1A 4CEHA 2LKDA 5DI3A 2IYZA 2OG2A 2QTFA 3A4MA 1Z06A 2REBA 3Q9LA 5JHGB 1GTVA 3I1FA 4Q9LA 2C78A 2ZYTX 2KSQA 1G21E 5LD2C 2GJ9A 4R2IA 3AV0B 4RZ2A 4LSGA 3C14C 4URWR 4CRWB 4PQYA 3CBQA 4C7OA 3FHTA 3U61B 4MYTA 1ZRHA 2J0SA 2HXYA 4FW9A 1KO1A 8OHMA 1JPNA 621PA 5C46F 1RRGA 4BLSA 4AK9A 1II0A 4KITB 3CONA 2X2FA 4A1FA 1E9AA 1G5PA 3KQLA 2HCJB 4BFZA 2QMHA 5EP3A 1GAJA 2FPLA 2W6ID 2IYYA 2ZE7A 3N2IA 4D0GA 4L5BA 4JN6A 3U6BA 4MYCA 2L0XA 4MKIA 2DVWB 1Q44A 3U7EB 5JJLA 2P65A 4R98A 4A2WA 1WP9A 2FJUA 3ZIAA 2GKSA 4KVGA 2CXXA 2XOKA 3KDSE 4TLBA 3FHCB 3SNHA 5JSZB 4BEBA 3L82B 5A5GA 5DHAA 4XVRA 3J81k 1N5JA 2GEVA 5CM8B 3FKSD 2IHBA 2GZDA 2ZIAA 4IDQA 3O8DA 4MUAA 5KO2A 4G01B 4CVNA 1BO6A 3NC1C 4NL4H 3BAFA 2QAGC 4LOAA 5GJBA 5FBVB 1LF5A 2R9VA 2HJGA 1MO6A 4PAQA 4ZO4A 2O8FB 4IOMA 4DT1B 1VG0B 3PEWA 3KJIA 2KI5A 2ZS8A 4Z1MD 3B1VA 3H2YA 5EE3A 3RS5A 3SJAA 1YZLA 2D74A 1MH1A 1GRRA 2VP9A 2Z6VA 2AFIE 1KI6B 4JT2A 4DB2A 5H70A 2BOVA 2VHCA 1TTTA 4DJTA 4YDSA 3PVSA 3L8YA 2DB3A 1Z8FA 2B21A 2H18A 1EFTA 3OIUA 4QM6A 1RYHA 3KX2A 3T34A 3OE7D 3NEYA 2HXSA 3W6PA 1W36D 1F6BA 1Z0IA 3K0FB 1CTQA 2F1JA 3SN6A 2IF0A 3ZS9A 4ILEA 3WMFA 4FMCF 1W4BA 2ZR7A 3RRYA 2CL7X 3PUWA 4MUBA 1XJCA 5KSYA 3KQNA 1G9XA 4PC1A 2ZSEA 4FWHA 2EW1A 4M1TA 1P7CA 1BYUA 4M1YA 4C9BA 1CU1A 1FTNA 2BV3A 3VX3A 3BH6A 1OYWA 3TBKA 1CR2A 3K0EA 3KKMA 4I99A 3RS7A 2CHVA 3QBTA 1G64A 5KTYA 2WOOA 3PUZA 4V0ME 3BWDD 1GL9B 3LH5A 1NF3A 4DUGA 1XFAA 4K81B 2WZQA 2CHQA 2IS2A 5IK2A 4TT3A 1G18A 3UG6A 2F43B 2OLJA 2IWHA 4AWXA 3OEHA 1T8TA 4QL3A 5FH9A 5C4MA 2FH5B 5DH9A 5FTMA 4QBFA 4ON9A 4LHXA 1Q3HA 3NVAA 4JL8A 4E22A 1ZNWA 5JEDA 3G82C 4A82A 2JLYA 1CR0A 3OIYA 4Q9HA 3AF2A 3LBIA 2QE7A 2OCBA 3OEEA 1NI3A 1NVWQ 4LJ9A 4TQ9A 4I1OA 4A8JC 4DLVA 4V0LA 3ZVRA 2Q0HA 4PSVA 1AKYA 1QHIA 3DHWC 3C8UA 3U3RA 4GMXA 5TDHA 2JLXA 1AQUA 3SYKA 3R7WB 5JWOA 5IHPA 5JJIA 1TF5A 1OFUX 2Z0MA 1NBMA 2LKCA 2B7CA 5JCZA 1G3IA 3A58B 2V3CC 4FWGA 4L4UA 4BFUA 2WOJA 4Q00A 2VP0A 3FFAA 3UWOA 2W58A 4BFYA 1KJWA 1XPRA 5FI0B 1N5LA 4OI4A 2NTYC 4LBWA 4ZIRB 2WKQA 4PPNA 4JVLA 5L3SA 3AB3A 4MKGA 4GBMA 3GEEA 4D80A 5JBQA 1II8A 3AGPA 4B3CA 1OSNA 1R10A 2I3BA 1AZTA 3QXHA 4PFSA 4TTRA 5AJZA 4D6PA 3EZFA 4B34A 4U7DA 4RZUA 2A2ZA 2J0UB 1P4SA 1E2DA 3LXXA 2KWIA 3W3AA 2KE5A 3ZH9B 2O0HA 5FBLB 3ZJYA 2VSXA 4A3VB 1FFHA 4UJ5A 4HSEA 1KDOA 1J7KA 2JJ1D 5AJVB 2O8EB 1G291 3K09C 3REGA 1CRQA 1R6BX 1ZNZA 4B3XA 3W8RA 1CRPA 3SFZA 4G5RA 4KU4A 1GRNA 3X2SA 4EPRA 3WYFA 4XVQA 1FOEB 1IJEA 2C98A 1IY0A 1NN5A 2GCNA 2F1IA 1Z6XA 1U0JA 1E96A 2FFAA 1C4OA 4PZYA 1XD2B 3ADDA 1JJVA 3DZ8A 4Q03A 4LJ8A 2FFBA 1EFUA 1RE0A 4YMWA 5DISB 4B33A 2B7BA 2OBLA 5A0FA 3CH5A 2ZI9A 1EWRA 1JJ7A 5GVSA 1MOZA 3BGWA 3OESA 3U44B 3NBXX 1WBBA 2A78A 5AUOB 1OF1A 1IHUA 3BGEA 4H1VA 3QKSA 4FCTA 2EFDB 4R71A 2MSCB 4JSYA 3FMFA 4JJZA 2V4ZA 2ZS7A 2JCSA 3RVBA 5JLJA 2IXGA 1T6NA 2P6RA 1SKYE 2D3WA 5F9HA 1RJ9A 1DG1G 3C15C 2ATXA 4KBFA 5FI1B 4OJQA 2NG1A 1IM2A 4Q9KA 2HYIC 4KFRA 1XEXA 2WWHA 4KI0A 4X8OA 2EYUA 3NTUA 1XMSA 3V4FA 1XX6A 4IDNA 4WZAE 1XTJA 4Q4HB 5C1BA 2BHRA 3Q3JB 4D4MA 2VA8A 4RD0A 2CDNA 3GJ4A 1XTQA 3RRMA 4B44A 3B82A 4Q1EA 2GEDA 4BLPA 4F7WA 2QQEA 1E9BA 2ZRFA 1D9XA 4OBEA 3RWMB 1IXSB 4V0KA 1ZD8A 1IBRA 3GJ0A 1GNRA 3BXZA 2D7CA 5JWHA 2HUPA 3K0CC 5EZ5A 5K8TA 1ZIOA 4EIWA 4TL9A 1BMFD 4HDQB 4QHYA 3K0FA 4PHHA 5DLQC 4W9MC 3EZ7A 5DGXA 1F60A 3AKYA 3FWYA 4LRWA 1E69A 3TAHA 1E4YA 1KKMA 2OFOA 1NVVQ 1NVVR 1DAIA 1KKLA 1T0HB 1U81A 1Z6TA 2VSFA 5DNYB 1HTWA 3GJ3A 3NBYC 3AVQA 2CVFA 4M9XA 1II9A 1G20E 1UM8A 4UNNA 1JPJA 2R8RA 3CF0A 3MWKA 3GLHB 2PT7A 4EQ6A 5LDDC 1MRNA 3U3KA 3I5XA 1OKKD 2OAQ1 3LQRA 4RVCA 4FWDA 2BBTA 2J7KA 2X77A 4MRSA 1Q1QA 4NH0A 5J4YA 3KQHA 4EFMA 4POAA 4W5WA 3U2QA 1CJTC 5F3WB 1S9HA 1UKVY 1X3SA 3A6PC 5FTKA 3NXSA 4BUJA 3LLMA 5G3YA 4BWYA 4B2IA 4ESHA 2EU8A 4F4CA 4AKIA 3PUVA 2OBMA 1FZQA 4TLCA 3LBNA 1E9CA 4YMTA 3Q8XB 4QNRA 1XCPA 3GFOA 3Q7PA 1GP2A 1MABB 1W0KD 4HEJA 3WRYC 2UVQA 1KO7A 1ZM4A 4MRNA 4EJSC 3B1WA 4QHSA 2OE2A 1NMZA 3SZRA 4JLBA 1TPZA 1NIPA 2XJ9A 3CF6R 3FFBA 3K9LA 4LI0A 4XVUA 3UKDA 4BLRA 3QEJA 3VMFA 4Z1MA 3B9PA 3PEYA 2C99A 5B58C 4O2RA 2W6JA 2ONKA 1YR7A 1NJFA 1SVKA 2WWXA 4IXNA 1OIWA 4LBYA 3K53A 4LBZA 3T12A 2JA1A 3PENA 4E5UA 2ODEA 3A1VA 3O47A 4WAUA 4AY2A 1DBSA 3IILA 2V9PA 3UG7A 4GI7A 4HLDA 3PJRA 4BZPA 1E9FA 1YE8A 3A1UA 4IVPA 4M0LA 1W0JD 2RGDA 1GL6A 1XTSA 3VHXA 3SYLA 1E79A 1UDXA 2GJAA 1QF9A 3NHAA 4JVMA 5TV2A 2ECKA 3GLFA 2F9MA 3RABA 3LDAA 4Q47A 5FPSA 3SJCA 2H1LA 4HLQB 4UNQA 1QRAA 1R0WA 2GK6A 3B13B 1AIPA 5L3QB 1N6NA 2QMUA 4V0NA 1M7HA 4TMWA 2V54A 1NVUQ 4LHYA 3GJ5A 4KCGA 4DUGD 1GZSA 3K9GA 2JJ2A 4JL6A 1YZNA 4FMDF 4LPKA 5IK2D 121PA 1Z28A 1W46A 3NHBA 2G0NA 2XGJA 1NIJA 2VP2A 2G83A 2QZ4A 1LFDB 1WRBA 2QRZA 4NYMR 5HZKA 2WWYA 5DE3A 3ZYCA 3EPLA 2A5DA 2J5XA 1E3MA 1IY2A 3P26A 3C7KA 5KPJA 3LBHA 2NZJA 1Z0FA 5ANRB 1ZAKA 2J7PD 2XOKD 4P4SB 3JZMA 3JZAA 5L3SB 3I72A 4G5OA 4Q4JA 1OFTA 4JVSB 1CR1A 4KFTA 2QU8A 3ZVNA 4YONB 4C0BA 3SFVA 1RRPA 2XITA 1GVNB 4HUQB 2Z83A 2CE2X 1E9RA 4B47A 1HA3A 5FR1A 4GRAA 3RRZA 4DIEA 1EWQA 1KAGA 3A1SA 1K5GA 4DLYA 2R6CA 1DARA 3KTAB 1P72A 4A0GA 3IIJA 1XD8A 4BLQA 4JT4A 1IXRC 2YWFA 4AG6A 1XZPA 4F38A 1OB5A 1T5IA 1SXJA 3SC3A 2A5YB 1KK3A 3T35A 1QHNA 4H1UA 3ADCA 3EIQA 2WJIA 1MV5A 5BW8A 1P9RA 3AEZA 3KFXA 3GPLA 1ZD1A 2CCKA 2WV9A 1FQJA 2Z4SA 4URZR 4B71A 5B30A 1HQCA 1A2BA 3FB4A 4M4SA 4PC6A 3K70B 3EW9A 4Q5IA 1SVLA 4JLJA 1IXZA 3HPRA 2QROA 4IKEA 2QBYB 1VIAA 4URYR 1XWIA 1IJFA 4P0TA 3LLUA 4HB2A 1ZYUA 2RAPA 3VR4A 4TTPA 3AVUA 4BRUA 4TN1A 1YHNA 2IL1A 3CH4B 3VU9A 5FOTA 4NPHA 1HT2E 2N46A 3CRRA 4FWIB 4Q1DA 2JLRA 3E5HA 5FOXA 3CZPA 2BM1A 3KKQA 3PFIA 1K8RA 1OXUA 3CX6A 4CEIB 3LXRA 2IW3A 1QHHB 3WP0A 2N42A 1NVXQ 3RS2A 3VQTA 1N5KA 3QG1A 4Q4AB 4TMXA 5DHFA 2ODWA 4EPYA 2J3EA 2P0EA 3ASZA 1VKJA 2GNOA 4JLDA 5KPDA 4DVGA 1JBKA 4B3BA 1ONBA 5GJWC 5CITA 1Z0AA 2H17A 3MMPA 2V7QD 4IEEA 2J0QA 1XF9A 3BD9A 4IJMA 1G8GA 4BEJA 3KL4A 1XTKA 4GOXA 4LBVA 2I4IA 2JATA 3IIMA 2XEXA 4Q7KA 3WMGA 3KXKA 4OI1A 4RD3A 4WXPA 2ZM5A 5KSZA 1Q20A 1FNMA 4LJ4A 4PAOA 3CWZA 4BQSA 2XTMA 1YRAA 2XXAB 3LX5A 3CZQA 1XRJA 4A8JA 4PZZA 4JYBA 1ESMA 4DLRA 4PTLA 3QOFA 1E1QA 1R5OA 3EAQA 3OF5A 4YXWD 3RAPR 5SZKB 2IYVA 3UMRA 5HZHA 2EFCB 3AVWA 1EGAA 4PQFA 5BXQC 3SR0A 1KO8A 1G17A 3DMNA 5E3HA 2ZSDA 4IOLA 5FUWA 1Z3IX 5D3MB 3K09A 4OQLA 1KI8A 2DFLA 1SXJE 1UKZA 1H8HD 4IW3B 4LYAA 3W5JA 4AYTA 2K5UA 4B43A 1W4RA 2OFXA 1G6HA 1KGDA 1D2NA 4KHZA 3AP1A 4HAWA 4HB0A 3M6AA 3CB4A 2R65A 2OUKA 4CEJA 2LWIA 2W2TA 2HDNB 2PEZA 4RZXA 5CJ2A 3THWA 2JAQA 4X8HA 2OEPA 4GT1A 2BDTA 2MSDB 3A4NA 2CNWD 4JJKA 4WVFA 2ZUBA 4R2HA 1E99A 4OHYA 1ZP6A 1DOAA 2XJ4A 3QIAA 5A4JA 3I62A 2QW6A 4KV9A 4YLGA 3UPUA 3L0IB 2V6ZM 3VR5A 2ZYWX 2ZJOA 2WSSD 4DCUA 1TF7A 2NO0A 1QZMA 4E03A 1UADA 1KI4A 2ZSBA 5SZHB 4ZCMA 1DE0A 2WHXA 1N6LA 1E1RA 4O0MA 4WOPA 4DXAA 5CLLA 4HDCA 1KSHA 1PJRA 2O0JA 3CM0A 4G5SA 3X1YA 4V0MA 2CCJA 1HEIA 1S8FA 1KI2A 2C9OA 1GDDA 2J59A 4KAXA 3Q72A 4LJ7A 1Q1BA 3LD9A 2GDJA 5FOWA 2CJWB 1E2EA 1OFIA 1Q12A 3AF4A 4RCZA 1E2FA 3T15A 4L9SA 3CWQA 1Z08A 3WXMA 1F2UB 1KOFA 2OM2A 3IDQA 4PR0A 2OSBA 5CLQA 1AN0A 4RFSA 3SDZA 3T1VA 2G1KA 1G4UR 1VPLA 3I32A 3RRNA 2EFHB 2GA8A 5DO9A 2X8AA 4DIDA 3TSWA 2Q9BA 2BJWA 2EYQA 3K0AA 4O3MA 1M7BA 3GEIA 1CS4C 3A37A 4UXHA 4Q1CA 2IXEA 4Q48A 2CL6X 3KQUA 5LB4A 2FN4A 1JAIA 4V0OA 2BVNA 2ZVPX 1S96A 5DI9A 1TQ2A 2XZOA 4LYJA 5HE8A 3K70D 3BH7A 2REOA 4DB4A 3AUYA 3WYAA 5FOSA 3QQ5A 5BN5A 3MHVC 1VHTA 4NDZA 1TX4B 3JVVA 3FE2A 4KODA 2O52A 2O8BB 4BFWA 2ZU0C 4FMCB 3GLIB 1VIYA 5FL7A 4OYHA 4A0RA 4URXR 3VR6A 4C0JA 1KDPA 2ERYA 1JR3E 3F8TA 5AR1A 5HKKA 1U8ZA 4HZUB 1QZXA 1PV4A 1U94A 3KKPA 2HEIA 1YZUA 2P6NA 2QAJA 1E2QA 1Q22A 6Q21A 2JEOA 1IN8A 5DN6A 3LRPA 1VCNA 1DAMA 3IPXA 1CJMA 1LS1A 1XMJA 4B75A 1OKKA 1XEFA 2WAXA 5KNBA 1KI9A 4MH0R 3K1JA 4V03A 5KYKA 3PEUA 4QRHA 2VSOA 4QFMA 1X86B 4P32A 2YKGA 3HP1A 3ICEA 521PA 3ADKA 2J7PA 1G4AE 4D0LB 2ZTSA 3GLGE 4KJZA 4OL0A 1OJLA 3MJRA 3LX8A 1M34E 2G0TA 4P4UA 3WRXC 3DOFA 3O8BA 4FI3C 2P6UA 4KXFB 1NY6A 1W0KA 1EFRD 5IT5A 1SVIA 1ZU5A 1WCV1 1NP6A 4CDGA 1LB1B 1P6XA 4F91B 1E1QD 3VU9B 4NE2A 4A92A 2XZLA 2SHKA 4QM7A 4LPSA 1N6OA 3BRWD 1TAGA 4TTQA 1CIPA 1XTIA 1ZCAA 3I8SA 1VG1A 1SGWA 1V5WA 2IYRA 2QM8A 1U9IA 4HUQA 1KNXA 4Q7JB 5F2EA 1P9NA 1TQDA 1ZM7A 3AKDA 4DSTA 3RWOA 4ESVA 2QN6A 2FEMA 1BYIA 1Q57A 1N2CE 1L2TA 2ZQ5A 1G8PA 3SQXA 3CX8A 2FF7A 1ZNYA 2D2EA 2GVDC 4IEIA 3Q5DA 5IF9A 2OXRA 5EP2A 3KJGA 1GOTA 4LC0A 4HUTA 1WXQA 4WIAA 4B3FX 2FFHA 5KNDA 2Y8EA 4HATA 1I2DA 2FA9A 1J8MF 3CPEA 4FMDB 4DSUA 4IVQA 4EFNA 3PV0A 1G1MA 1XCMA 4AYWA 2AK2A 2RMKA 3EWAA 1OHHA 3THOA 2W6IA 3LW8A 4HLCA 5AJXA 5AWFC 4ZKDA 2NPIA 3ONWA 1FNNA 3LV8A 1WMSA 2QP9X 4LDJA 3TNFA 4BGDA 2ZU6A 3LWNA 3BB1A 1TADA 1SHZA 3C16C 5AUQA 3FMIA 3GLHE 2XTNA 4HDOB 2CHGA 1EG7A 2VP6A 4PO1A 3I73A 4JKIA 1NY5A 2QE7D 3SJZA 3EIHA 3GLGA 1F2TB 1GRQA 4TYQA 4QBGB 4B3DA 1DEKA 2GXSA 2IF2A 4UQOA 2AX4A 2VP5A 4MRVA 1G41A 1NN1A 4L9WA 4Q4LA 1VTKA 3AKCA 1A5TA 3FMPB 1S0UA 3GMTA 4PAMA 1XD2A 3WNBA 4D4KA 4DBLC 1KDRA 2D2FA 4S2EA 4ACAA 1E2KA 4NONA 4Y0VA 2YC4C 3QENA 3K9HA 2PZFA 4KLNA 3GLFB 2JGNA 1PZNA 1XPUA 3WBKA 1WE2A 1UPTA 1JEEA 4N0EA 2AHOA 2F3TA 4B2PA 5H8WA 1QVRA 2QP4A 2OT3B 2DWZB 1YZQA 3R8FA 1JXOA 3LNCA 4ERNA 4WW0A 3TW8B 2P5TB 3AM1A 4MYUA 4MGYR 1H8HA 1G7CA 1IY1A 5CIQA 2FEOA 2ZRKA 3T5DA 1A2KC 1MRSA 4DRZA 3IIKA 4DLUA 4NP6A 3PG5A 1IN6A 3CW2A 3TLXA 3KB2A 2C96A 1KZ7B 2PEYA 3ZGXA 1MT0A 4LCBA 4P31A 2QTHA 4FCWA 3K70C 4XWOA 3QPUA 5DIFA 3WHLA 2GBLC 4HAYA 2OLKA 3ND8A 2B8WA 3SHFA 3MCAA 2GEUA 4FN5A 4MRRA 4KFSA 3GFPA 5KUTA 1A1VA 4D25A 1OHHD 5FPHA 5G3ZA 5CB8A 4GSYA 1YZKA 3CNLA 3KW6A 3EXAA 4YDHB 4JBXA 4A6XA 4O2LA 2GF9A 2CE7A 4QC2A 4FWTA 3KUDA 3TUJC 5FOUA 1TUEA 1XTRA 2WICA 4BZXA 2O8BA 4QNMA 1D9ZA 5BYJA 2NPFA 3X1ZA 2GRJA 4PO9A 4NYIQ 5FTLA 3MWYW 1GIAA 1SKYB 1Z47A 4PANA 1J2JA 1S3SA 2Q21A 2CEAA 2FSGA 3EA5A 1ZVQA 3AF0A 4ZPXA 3P4YA 3D3QA 2OV2A 2WWGA 3REFA 3W6NA 5FPKA 1NBME 2XNDA 2FFQA 2IWRA 4U00A 5KNCA 2QRNA 4C0HA 3EPHA 4C7OB 2GTPA 3TVTA 2A5JA 3OIWA 4GDFA 4F92B 2QTVB 1HYQA 1SKQA 4DEXA 4GP6A 1OXVA 2BBSA 3GQBA 4H9GA 4M1OA 1KI7A 1TEVA 4YMUA 2H92A 1FPMA 1CF4A 1Z63A 4QGHA 4MGIR 2FWRA 4P4SA 2MSEB 1T8UA 1ZBDA 4NCJA 3ZZ0A 3BC1A 4GPTA 4ZV4A 3X1WA 4C0KA 4BE7B 3C41J 2DCUA 2PCLA 3VR2A 2OILA 3ZVMA 2G6BA 1P2VA 4CGZA 2A5GA 1NN0A 1R5NA 4TZ6A 1XU4A 4BLTA 4PPQA 1DELA 2P67A 2WKRA 3F5FA 3R20A 2FE4A 2Q9AA 4S35A 3RNLA 2BM0A 4U5XA 3E1SA 5E7JA 2QPOA 1HV8A 2ZRGA 4G1UC 3S1AA 3SU8A 5JS7A 2VEDA 4XSHA 5B57C 4URVR 2BC9A 4LHWA 3FOZA 2IS6A 2ZYVX 2G9NA 2WJHA 1CXZA 2ZE8A 2JDID 2A30A 3SS8A 1NG1A 2JIZA 2ZSFA 3GJ8A 5D3MA 4FMBB 1ZNXA 4Q21A 3V4RA 1B0UA 1IN4A 2J9RA 1E0AA 2F6RA 2FPMA 1E4VA 3U4QB 3LQQA 1OT3A 221PA 3NG1A 3RSLA 3O8CA 2WWIA 3BE4A 3QKSB 3EG5A 4DDUA 2BMJA 2GXAA 5H68A 4TLDA 721PA 4RD1A 1KMQA 1QG2A 2IHYA 2Q3FA 4TYYA 2YWHA 3THWB 1P5ZB 3VFDA 1H8EA 4ZDJA 5JJKA 2C8VA 1D8TA 1CEEA 3B9QA 2V8OA 2ZRPA 2W2XA 4LGMA 1VDZA 1NLZA 5CK4A 4WA7A 1KAOA 4OKSA 5P21A 2ATVA 4BRWA 1KZGB 4OK5A 1J90A 1N6HA 1IN7A 4PO8A 2PZEA 2RHMA 1MKYA 1Q0UA 2VPPA 3PUXA 4KYIB 4IOJA 1N6RA 3TSZA 4IDOA 4C4PA 2BWJA 2OHFA 3FGNA 5JFGA 2W83A 2RCNA 2G88A 1F2TA 3A36A 3KJEA 3RLFA 5KDOA 2FNAA 2JLQA 4N0DA 2O8FA 3QXJA 4NTZA 1II8B 1FUKA 1G8FA 1EFCA 3IQXA 3VLFB 1CR4A 2RHDA 1OPXA 2V6JA 2QSYA 1E2JA 1YZGA 1G6OA 4DDTA 1KMHB 3HU2A 1CJUC 4Q19A 2ERXA 2Q9CA 4ZDKA 5JSZA 2X19A 1KI1A 4ZIRA 1TL7C 1R8SA 3KUCA 1N6KA 4EAQA 1U0HC 3U60B 2IYUA 3NIBA 4N3NA 3VTKA 2FV8A 1MABA 4Q4AA 2JIZD 3D7MA 1Z6GA 4A15A 2YVUA 2QL6A 5KOYA 3B6EA 1PUJA 5G41A 2WMOB 3CRVA 4JLMA 4KVAA 2F43A 5FL7D 1GNQA 1GKYA 2WIBA 1G3UA 1CJVC 2AFHE 1AS2A 4QBHA 1G3MA 2HT1A 2GAOA 3P4XA 1KO5A 1G7TA 2VF7A 1VMAA 3MD0A 4R7ZA 3IKJA 1N0UA 2D06A 4NYJQ 1RYFA 3OIVA 1E9EA 2B8TA 4ASUD 3MLEA 4PZLA 3TK1A 2IYTA 1HURA 2V6IA 1CP2A 1R2QA 4EPWA 1BOFA 1CKEA 1HE8B 2YWEA 4RD6A 4LYFA 1T4GA 4M21A 2PBRA 1P75A 4ARZB 1AQYA 4LK2A 4KLZA 1WA5A 3I5YA 2ZI6A 4JZKA 4W7SA 5EE0A 3EPJA 1I2MA 3SE0A 2H57A 3IHWA 2ZRMA 1C9KA 5GVRA 4LZZA 1OB2A 3BK7A 4CZ2A 4BPBA 2ZETA 5J5CA 2QSZA 1UKYA 2R44A 1AGPA 1F5NA 4US1R 3TGPA 4IHQA 3D31A 4RY2A 1HUQA 1J70A 1TQ4A 2BEJA 1W2GA 2HF9A 4DDVA 1N5IA 3I92A 3TR5A 4TMTA 5AUPB 3H0KA 5EE1A 3H84A 2ZANA 2ZE6A 1L8QA 1N0WA 2QUZA 1G19A 2ZJ5A 3CPJB 1KJYA 2F3RA 4B35A 2ZPTX 4OI0A 3T61A 4Z8YA 1NBMD 3K0SA 2Z43A 3CX7A 3AP3A 2GK7A 4MA4A 1RVDA 3IEUA 2HJVA 5HE9A 4MDFA 3OZXA 4PSKA 1T3LA 4TL6A 3X1XA 4BZQA 2QG6A 2KJQA 1Q1EA 3WNCA 5J4LA 3QKUA 2FMXA 3DM5A 4PC2A 2RGAA 2UZ3A 2PZGA 3CO5A 4TL7A 3CRMA 3H86A 2ZRJA 3H1TA 5FUYA 1AZSC 2VIIA 1GKUB 1G8HA 4B2LA 4C0QC 4UNRA 1GG2A 3RS0A 4L16A 5K8LA 3W8NA 2OXCA 2YINC 1E2MA 4UNPA 2BJVA 5EXXA 2GCOB 2AWNA 1XD9A 1VCIA 3OFND 4TWZA 5CDFA 4BFXA 3RDPA 3WY9A 2IYLD 2RGGA 3IHLA 3TE6A 3DO6A 4JL5A 4UKDA 3NKVA 2J0UA 3THXB 2H8KA 1EX6A 2XSZA 4XTRA 4BFTA 3R8CA 3QVVA 5FOVA 1QG4A 4HLUA 5H1YA 3B2EA 4EKDA 2UKDA 2ZJYA 1G7SA 4XH9B 1UBFA 3ZD6A 1ZIPA 1DAFA 1IONA 3C5CA 2BMEA 2I1VB 2IC5A 2QA5A 2ZI5A 4AIIA 4QBIA 3I3SR 2YOGA 1RRFA 4PHFA 3P1JA 1AK2A 2C04A 4Q02A 4ZI2A 2AWOA 2DYKA 2EVWX 2HLDD 2WBLC 4OQFA 5EQTA 5FR2A 1PUIA 1W44A 5FFMA 2ZVQX 2BCGY 1OH6A 1LNZA 3IBYA 4IFBA 4HYYA 2GF0A 4QJ5A 4OQNA 3GLGB 3SBEA 1WQ1R 3PCRB 3EZ6A 3QEOA 1JECA 1VCOA 3EARA 4US0R 2IEZA 3KKOA 3MWJA 4AURA 3DPUA 1GL7A 3VHLB 3QPWA 2X2EA 2RGCA 5FUVA 4HB4A 1I4TD 2CL0X 2D4HA 3KB1A 1TUIA 2OBNA 3CNOA 2QNRA 3G0HA 2YNMA 4Z51A 5EXPA 4DLSA 4CW7A 2DFTA 4LYHA 3THXA 1S3GA 1NRJB 1UF9A 3ZZUA 1T5LA 1D2MA 2MMGA 3HJNA 5HTKA 4AD8A 2J45A 3QBVA 2IYWA 1OH7A 3BERA 5L3RA 3P32A 4OK6A 5B2ZA 3L0SA 1XP8A 1W36B 1LTQA 2PMKA 4BECA 4RZ3A 3WMEA 1Z29A 3A1WA 1NG9A 2CJWA 1Q3TA 3FVQA 2XNSA 2WWWA 1R0XA 3RYTC 2W0SA 3U3JA 2IS1A 5FTNA 3MUFA 1DO0A 2HF8A 3OHMA 4M1MA 3AVVA 1KI3A 1W0JA 5C18A 2VP4A 2GXUA 3JVUA 3V9PA 5KDDA 3L43A 3H4MA 2XSZD 3KKNA 3SQWA 2QMOA 4X8MA 2ZR9A 3UMSA 2VTKA 2G1JA 4HI0E 4JIMA 2BKUA 4JBYA 1Z2CA 4FIDA 1JALA 2GWHA 3ETLA 1XEXB 1OLOA 4Q4JB 2ZRIA 1SULA 2WTUA 1KJZA 3LA6A 2FU5C 2VHUA 2WM9B 3VAAA 3DKPA 3EIEA 3FYHA 2H16A 2XAUA 2JJ8A 3TJZA 2BEKA 3AVPA 4OHWA 4XTCS 2VLIA 3ZIAD 2YOHA 4TMKA 1HH4A 2FX3A 2VHJA 3C4JA 2QT1A 5JRZA 3TW4A 3MRSA 1E6CA 3BJIC 1GITA 1T9HA 2OESA 3I8XA 4GMDA 4RFVA 3MG9A 2NQ2C 4M22A 3QG5A 1MO3A 4YMSA 4C0LA 4XOIA 1DG3A 3N5CA 2EWWA 5CJPA 3QF4A 2GHIA 3GLIE 4QGFA 3TVDA 1DAHA 3HR7A 1XXHE 3W90A 4B32A 1W49A 4CYMA 1QHYA 4Z54A 1S1MA 2AXNA 4ZDIA 4R9UC 1UBEA 4ZCLA 3DL0A 3L2OB 2QPTA 1UEIA 3IGFA 1AS0A 3DDCA 2JLVA 2FSFA 2WVJA 1DO2A 1X8LA 3QJYA 3T1TA 4ZI3A 3CF2A 1OXXK 1JR6A 1ETUA 3ADBA 3QXSA 4M9SA 2F55A 2CLCX 4Z8XA 2IK8A 2C9YA 4F4JA 4L8GA 1NL3A 4D81A 1U9IC 3FMOB 3RS3A 4W5HA 2CBZA 821PA 4LV6A 5FBQB 5HPYB 4PXAA 1ZUIA 3HDTA 1Z07A 2H7VA 1D6JA 4MGKR 2FOLA 3C5HA 3VNVA 4QJ3A 2ORVA 2DPXA 1GFIA 1K5DA 1VCMA 4TLAA 3U6KA 2JJ1A 4GP7A 4HB3A 3LO5A 4EDHA 2JDIA 1XBTA 5HKKD 4PC3A 3QF4B 1E79D 2GZAA 2ZUDA 4HZUA 3UANA 4JLVA 4M9ZA 2QGZA 2AN9A 2ZI7A 4WBSA 4DKXA 2C77A 3OAAD 1WB9A 2VL7A 4MGZR 1Z22A 3W6OA 4TT3D 5J4KA 3OEHD 4MQBA 2IBMA 2PLRA 3HPQA 4A0FA 1FQKA 1KDTA 1F3OA 3SBDA 3W3ZB 2ZROA 1TU3A 2QI9C 5SZJA 1NSFA 1W36C 4QJ4A 3IO3A 4AG5A 2FGKA 2A3RA 3FKQA 2FG5A 4EQ6B 2R6AA 2A7QA 2F1RA 3KTAA 2RGXA 2VRWA 4Q7MB 2V1XA 3UMFA 1P2UA 1M1YE 1AJEA 1A82A 1NVMA 4XJXA 4D26A 2NZ8A 4G3XA 5JEEA 2KB0A 1OV4A 4NKRA 3W34A 4B76A 4NCIA 1FUUA 2AKYA 2Q3MA 3HYTA 4Q1AA 4D4LA 3GCGA 2VBCA 1YR9A 2DWPA 3MSXA 2PCJA 5F98A 3B5JA 4A36A 4PPFA 4D82A 4YXWA 2O8DB 3TH5A 4HAZA 5AJWA 4MYHA 1X6VA 2ZJAA 1E0SA 1L4YA 2TMKA 2ZUCA 3UXMA 5J4HA 3BOSA 5EUQB 2V1UA 2EQBA 3U3MA 1LS6A 2J46A 2X1VA 5BWMA 1SXJD 4DLZA 4A4DA 2HCBA 2P2LA 3UIEA 1P2SA 4TL8A 2BMDA 4JLOA 4DCTA 2OO7A 4JS0A 2RB4A 1A7JA 1CJKC 2B6HA 4GFDA 1XEWY 3F3YA 2LCFA 5J4VA 1VG9B 4K8OA 2O0KA 3VX4A 3GEHA 3SYNA 5CYPA 3SI7A 4LX0A 4DCNA 1QBKC 2PL3A 5EP4A 3OFNA 1E2NA 1U90A 2BKEA 3IUYA 2AXPA 5TVKA 4BFVA 1OH8A 4OK3A 1COWD 1N3BA 1V43A 1H65A 4I1SA 1D2EA 2GBLA 1BS1A 3CRW1 5JECA 2ZXUA 1MO5A 2R6GA 3BB3A 1Z83A 1LF0A 4LV5B 1UDWA 3B8HA 2RH5A 2GXQA 4FINA 3I61A 4FD2A 1FL9A 1EX7A 4B48A 3KZ1E 1FX0A 2HYDA 5TARA 1W2HA 2O8CA 2GETA 1E32A 4A2QA 2HLDA 4DEYA 5D3QA 4EUNA 2E9SA 2WJVA 4KFUA 3ZS8A 5LPNA 2J0VA 4JVNA 1GUAA 1KIMA 4QGAA 5EE9A 3SOPA 4DDWA 1G5TA 2DZNB 2AD1A 3TQCA 4HAXA 1QHSA 4Q7LA 2Z4RA 2ZR0A 3NEJA 4KO8A 4QKQA 3WBJA 2RGEA 2W2VA 4EFLA 2YHSA 4UXJA 1WDTA 2QORA 3DKVA 1GNPA 3M4YA 4IDHA 4PX9A 4LY6A 1PLKA 1UJ2A 4DHEA 4RJLA 4C30A 5EUMA 1P2TA 5EZ6B 5IDVA 4RSGA 2YZ2A 3PR1A 3LAWA 3U44A 1E94E 1YJ5A 5CK5A 3ZZTA 4QXAA 1ELOA 2JLUA 2W6JD 3EC1A 5E7MA 1XZQA 3B60A 5LB2A 3TAUA 4KSCA 1W47A 5EP1A 3AGQA 1P61B 4JSTA 1BIFA 1E98A 2BIFA 2J41A 2P5SA 2PJZA 3UK6A 1OYYA 3QPVA 3U4QA 1G7RA 5DSZA 3B78A 4LJ6A 1I4LD 2J1LA 5LBIA 3MAAC 1OXTA 1XNJA 1FX0B 2FSIA 1MO4A 1NLFA 4C3ZA 1W5SA 3EA0A 2IUSA 3ECCA 3OE7A 4O25A 3T5GA 2QBYA 2PLFA 3L0PA 4DLTA 4LV8B 5BQ5A 1R0YA 5JI3E 3NBFA 2KBEA 2YYZA 2ZREA 2GJ8A 1XXHB 4UJ3A 5FPTA 2V55B 2MMCA 1R0ZA 1W4CA 4JLKA 3IBGA 4YQFA 1S2MA 4ZCIA 1F2UA 2ZYUX 2ZJ8A 5M04A 1LW7A 3QXXA 1FP6A 2G77B 1IQPA 2QY9A 4NCHA 2PJRA 3GD7A 1JR3D 2A5FA 2IT1A 5FL3A 2RGNA 3U7HB 3LVQE 4AKEA 1E2LA 1N6IA 4M1SA 3GLHA 1X8JA 4URUR 2CLSA 1RRCA 2JJ2D 2YOFA 2O8CB 2GILA 4MRPA 2ZAMA 3LY5A 3DVLA 1J8YF 2NGRA 3S1AB 4DCVA 3QKRB 4GZLA 1ZINA 2CK3D 1HQYE 3RC8A 3EC2A 4DCSA 5DYIA 2GAAA 1ZM2A 1OH5A 1JB1A 1P9WA 2EFGA 3NDPA 1VG8A 4EJSB 4M1KA 3DZDA 1YQTA 4A0HA 3N2EA 5J47A 1L4UA 2QGNA 3DOEA 5K8UA 1E9SA 4GNKA 4OHVA 1QHGA 4NYJR 1AGRA 4EJSA 4AYXA 1XMIA 2IUTA 1NMXA 5K8IA 2BBOA 3CNNA 4A2PA 2D7DA 2ANBA 1UAAA 4GL2A 2NMVA 4PSAA 1C1YA 4IVRA 3QKTA 1W1WA 4UXIA 1FMJA 2FZ4A 2ZS9A 3CRQA 2H5EA 2C2HA 1YRBA 3RSOA 3HU1A 2F1HA 1A4RA 2VO1A 3Q5EA 5L3QA 3CPHA 4RD2A 4YMVA 4LJYA 3VKGA 2YC2C 3DMDA 1G3RA 2ZSAA 3CLVA 4P4TA 2E87A 1XPOA 1SVOA 1YR6A 1XJ0A 4OHZA 3RC3A 4JLPA 1S1CA 1O3YA 5GJCA 2ZRLA 1T91A 4F4IA 3AF1A 1Z0DA 3VR3A 2IUUA 2DFNA 1E2IA 1SXJC 2R62A 3B1XA 2ZI3A 2ASEA 4ARZA 5BYKA 4GZMA 4OI2A 3MFYA 5KDLA 1UEJA 3BBPA 4B6EA 4QG7A 2KBFA 2ZRHA 4Q4HA 1JR3A 2OCAA 4DSOA 3RHFA 3X1DA 2XTZA 2PH1A 1QHXA 2FPKA 3DEFA 1COWA 1XJQA 3QE0A 5GJVC 3R9IA 3WHKA 1T0JB 1UBGA 4TYWA 5E4FA 2OZEA 3TRFA 3T1OA 5TXGA 4W5JA
chains in the Genus database with same CATH superfamily
1FMCA 3WP1B 3ROPA 1ANKA 1Q02A 3AIOA 4B7HA 1VLQA 5E6RB 1L1FA 3R9XA 4AJ4A 3HLTA 3HKEB 4MMZB 1BKYA 2CEKA 1X7WA 1U0LA 5IM5A 3VVLA 2VUHB 5H82A 3R0JA 3ZW7A 5KYYB 1YKSA 2Q3BA 5TF0A 3TEFA 3VI3B 2NO1A 2QVCA 3AUFA 4PYRA 1D5CA 2SKCA 3ROGA 3H1BA 5JISA 4XWKA 3A6EA 1EZZA 1BA2A 4ZZ0A 2W37A 3EISA 2WMNB 4MAFA 3E70C 3LFUA 4Q4DA 3H7IA 3ZCUA 2Q1SA 1W75A 3GLKA 4Q9JA 5ENVA 3QUSA 2PUCA 3L7CA 1R6VA 4US2R 2K6BA 5F33A 1CUXA 1OAIA 2MSNA 5JI2E 1Y8GA 2PRIA 5BNIA 1QZEA 2JZ0A 4QOJA 4B1FA 4YEDA 1GAQA 2M98A 3O8NA 3K0AB 4M0DA 1EFRA 1YZTA 2YW2A 4X95A 3VDQA 4E5MA 1DKOA 3AONB 1YE9A 4F93B 1I3NA 2O7QA 4B6SA 3ZEIA 2HYIC 3H65A 1XV5A 1B73A 3LGSA 3THYB 3L0OA 3UMJA 3V7NA 1MAVA 3MIIA 4DIUA 4Q3BA 4E09A 4P33A 3RAEC 1AA9A 1SBYA 3E2IA 3T7KA 3A2KA 3JVEA 3O94A 3O7MA 2FZLA 4XYMA 2X0KA 2ZT5A 1GTG1 1V9CA 2DHYA 3UWDA 1PLJA 1SXQA 1YRYE 3Q6NA 3ZHVA 2XDYA 3UXHA 3H2KA 2ECQA 2WPDA 1KY2A 1Z5VA 3N2GB 1K4MA 3QFRA 3CQ9A 5B64A 5C8YB 4H7EA 1P4AA 2YICA 1TH4A 5EIFA 4ZEVA 1D0KA 4A6PA 3SS7X 1QH8A 1OTHA 2HK9A 5E7QA 5GJBA 1KNQA 4Z9AA 5SYNA 5BN4A 3FCUB 5TQ2A 3PGA1 4EVQA 2DI0A 1Y9DA 1VYTA 3ZWMA 2Z1NA 1SVNA 5EIHA 2R751 1G4HA 3NPMA 1DKRA 4R0VA 4DJAA 4D57A 2Q3DA 4OU7A 4YLYA 5KWEA 3EFOB 4FXPA 2DBYA 5I48A 5CIYA 5FEMA 5K4GA 1DBWA 2YFKA 1CV2A 2XA2A 3BRCA 3FZNA 4B6FA 1DVRA 2WSSA 1ECGA 3F5DA 4ASUA 2QVYX 5EVJA 4BLOA 3TZLA 2ZE5A 3D3WA 3T0IA 1ENZA 4W1SA 1RQLA 3L4EA 3ANLA 5F5NA 1DPFA 1UBNA 5SZIA 2CC2A 4C0XA 5JMTA 1PT5A 5FWYA 4RCYA 1TLTA 3OFKA 2ZAOA 3HJBA 2QLJA 3VZQA 1XZJA 2VP3A 1JWBB 2HMTA 2VNSA 4M0EA 1ZJ6A 3HK2A 4GC9A 4CEJB 2JHAA 3L4BA 3OM0A 1MR3F 3L2AA 1VL2A 4ZO8A 5HCNA 3EHEA 2B8JA 3WLHA 4RAQA 3S8EA 2GGSA 2IYQA 3A2LA 4JH0A 3KLOA 4N0PA 2NZXA 2BEWB 3C3XA 3P20A 2IYSA 2OWEA 2HW8A 3MF4A 3E61A 1U31A 3QSYA 4LF5M 2WAMA 4RTNA 4MKFA 1H94A 1BMTA 4ID3A 2PBLA 1OPRA 1ZC3A 2KHHA 5C8XA 1G8AA 1E9DA 2CKDA 1NFQA 5AOBA 5G0SA 3LCRA 3LF1A 3RFFA 1T6XA 1HMYA 2VQSA 2BONA 5FNVB 2C2BA 3Q85A 2A0KA 2G17A 2OMEA 3IQFA 1GPJA 1WY7A 1QOQB 3FNHA 3CKLA 3B1KA 4NE7A 1SCQA 5EIAA 4A9AA 4R0MA 5J2UB 1JHDA 4Z3KA 5K8CA 1GABA 2JLSA 3IKMB 3KCQA 3MTEA 5CURA 4BHTA 3B85A 1NZFA 4J49A 2ZBKB 3TI7A 2QRQA 1Z0JA 2WG1A 3REQB 4NNJA 3SC2A 1XXHA 1XB2A 2P4EA 4NOJA 4CLDA 4LDQA 3DZHA 4MI6A 5IX8A 2HF7A 4RH3A 1W48A 1ZNQO 5BN5B 3S2SA 1WOMA 3TIVA 1MHTA 1QC5B 5CT4A 1O2DA 3T7AA 5JY1A 2HSJA 3AJDA 2IQIA 2QXTA 3HLKA 3RU7A 1QSGA 2WAOA 3DD5A 3IKVA 3FUTA 1BH2A 4DLXA 4CT4B 4NK4A 1UJNA 3U7FB 4V2UA 4EY3A 4CDRA 2BHSA 2C4TA 4R01A 3I4YA 1V8FA 1T1JA 3GFTA 3GL9A 5LIRA 1UXJA 2DWOA 1AQLA 2OAP1 2D8AA 2VDUE 2XYPA 2QUAA 3H5IA 4EF6A 2G04A 1Q1NA 1D4OA 1V3TA 3ACBA 3OZTA 4NCKA 4UHBA 5FUXA 3T1QA 3OX1A 4KO1S 3X43A 2D5LA 3CVOA 5CH8A 1TLLA 3GVHA 4R1NA 5DLYA 2CWBA 1NKSA 2H3HA 3KKLA 4ZI5A 2CF5A 3TMKA 4ENTA 4YRGA 1YF3A 4QUGA 2VJDA 5ALUA 3V00A 2B4YA 3V2HA 5I9SA 1MA0A 4FCVA 5EJIA 4ZCQA 4D8WA 1C30A 2WUDA 1QU2A 2HEGA 1TUGA 4LF9B 4ESOA 2NO4A 2CZQA 3B7ZA 1WXEA 2PJUA 1RXWA 3KSJA 4JI6M 3OCCA 1S4QA 4JI0B 4DY4A 2CBGA 3RC2A 4E7PA 5KVSA 3KV3O 4PX3A 1KH3A 3SZGA 1BXGB 3L07A 1R5BA 3J27B 1NTOA 3OZCA 4TRRA 5JCPA 4U9HS 3R6WA 1QVAA 3ILVA 1DGGA 4PYKA 1TK2A 5FO0A 4EPTA 3QFTA 1ZAYA 4G09A 1KSJA 2VCYA 3QKWA 2FP4A 3D6TB 1OE0A 1LVUA 1MN3A 3MJHA 2YJTD 4KXYA 2FSHA 2V3VA 1SXGA 2X3FA 4LNUB 2ZRCA 1GWNA 1DZ3A 3SP1A 4NHOA 1IN5A 4BIIA 2C03A 1LDGA 4F7DA 5NLLA 5REQB 1T25A 3D2AA 3K4HA 5AKKA 1G71A 2YV4A 2PFKA 3ROXA 2YWCA 3ESZA 5KQLA 3M0EA 4A1OA 1OFUA 3PXGA 2WAYA 1DRKA 4AMUA 3QVLA 4QIHA 1SIOA 5HR5A 2FGJA 1D1QA 1LV7A 3Q0EA 4HAVA 5EA2A 1PS8A 2VYFA 3MT8A 4QDXA 1JG3A 2A4KA 3TD9A 3KJZA 5HFJA 4B8YA 2A1UB 1XT6A 1HTTA 2WA1A 4UU1A 4IICA 4OREX 3UWKA 4JASB 4IDGA 2B1IA 3L7DA 3L8GA 3WL5A 2JFXA 3WKAA 2BJHA 2FDCA 1OFVA 2GD0A 1K8YB 1UPBA 1GVHA 4HN2A 4F84A 3UUEA 1XKTA 4I9NA 2P3LA 3QU7A 1FTSA 3S5UA 2I1WA 3VYSB 3NHFA 3SASA 1YKGA 4TSRA 5TY0A 2NNLD 4MICA 3U4IA 4PG4A 4RK6A 4ZK2A 5JZVA 1JYFA 3C7CB 2KQUA 2OBYA 13PKA 2QD3A 3M4JA 4NBRA 1NNUC 1WMEA 4KWTA 3R75A 3CUEF 2OO3A 2GN8A 2IZ5A 3AJAA 4HFNA 1DDGA 2X4DA 4LGVA 3JQ7B 5CFNA 1A3CA 3JD2A 1DCMA 4UVGA 3AU9A 4YJ2A 5HIKA 2ID8A 3BMQB 1JQJC 3LT0A 1XIVA 2QT0A 5HUJA 2PUEA 5TMDA 3HR8A 2IEYA 1BDJA 1M74A 2HAEA 3O8RA 3G5LA 3TW0A 1XELA 3AHIA 1EHCA 4CL8A 2VNKA 2Z8XA 3AVXA 1J9ZA 1I9GA 4HLUC 1A5ZA 3ZOZA 5IWAM 1T9CA 2OFWA 4YRJA 4F5ZA 4I81A 4M53A 2JHGA 3AO0B 3IPYA 3QV2A 1E1MA 1P4JA 5ALDA 3EPKA 4OQMA 3HG7A 5JJ5A 3IULA 4L8VA 4DMMA 3IAUA 4F3TA 2XB2A 1M6EX 2A9KA 2JLAA 3CR7A 3JSAA 2IEIA 1C4KA 1PYOA 3RTGA 1WR8A 2OL4A 4P5PA 5EKUA 4G0OA 1UXGA 4HN9A 2X0DA 3PDIA 1VYVA 4CN8A 3W5SA 4DZRA 2E4XA 2Q5HA 3SVLA 4JUCA 4OHUA 2AL7A 3ERCA 4LJSA 5JIBA 4EA9A 4TPKA 3R76A 1AKVA 1R0LA 1ETHA 2BFEB 3PC3A 4Y8VA 3W9YA 5JWRA 1U9YA 1TM4E 1VE1A 4C05A 4B3GA 4PZDA 3UCXA 1X70A 4N49A 1FX1A 4D5EA 3L8FA 1JQLB 1W5FA 2FPOA 4BNGA 4DT1A 5B4TA 4C2AA 3T9BA 1B93A 1PGPA 3GGGA 4EJ0A 3T5AA 4JUBA 2YIVX 4NZMA 1T5BA 2JBHA 5EXTA 4I4LA 4IGIA 4LYDA 1UWLA 3TQTA 1OIXA 2DHRA 3KE9A 3BAZA 3LYLA 1L8LA 4LC1A 2ZRBA 3TB4A 4BVFA 2EV9A 2AN5A 4UTOA 3PWKA 2J5BA 4CM9D 2QJWA 4MUEA 5K0NA 1W93A 4CR6A 3CA8A 3SYRA 1QAOA 3LPLA 3DFFA 1A9RA 1SZPA 4FS8A 4KYUA 4M87A 5A5EA 1P77A 1ZMXA 1DPGA 1E2GA 1IE3A 3NPAA 4G8JA 5A03A 3QXCA 2CL5A 2C95A 3F0TA 2NSDA 5CIWA 2NO6A 4EF4A 3U56A 4PYMA 3KVWA 4GH9A 2JAUA 2ZRNA 1VOTA 4P3NA 5EIBD 4PLPA 1WOYA 3SCZA 2B78A 4GPZA 2CCGA 3G7SA 3NWJA 4OUKX 1N1EA 2XNHA 5CFZA 2X9QA 5U9CA 3ZKWA 2C9CA 3KQVA 1JBEA 4I9FA 2N3ZA 1QGAA 2XZTA 1GKLA 4LZJA 1MW9X 1TVCA 4M36A 1DOHA 2RBKA 4QPJC 4ZALA 3TEJA 5BSVA 5JO0A 3KQKA 2O05A 5C2JB 5IBRA 2BT4A 2J5YA 1R8JA 1WXHA 2AK3A 1SZCA 1KE1A 3BIFA 4Q3AA 1NFRA 4QU8A 2I7XA 4AIRA 4X3PA 4MM3B 1T36B 2ZBVA 3A9WA 4B84A 1WSBA 1ZX1A 4BMNA 2AUTA 3RVLA 2VNJA 3BFVA 2ACVA 3ZU2A 4UREA 1XF1A 1LBSA 1ZICA 1SVWA 4C0SA 1ZMOA 3QFSA 4LRQA 4O4LF 1S9DA 2DCMA 4CIDA 5GOTA 1G16A 1G38A 1O87A 3O90A 3CTDA 4CT5A 1ZWKA 4HX2A 4Q6WA 1TM1E 2IXFA 2L69A 4E3WA 2KW5A 5DNWA 4L0DA 2RGRA 2HPZA 1VBKA 4IRUB 3DS8A 2UXDB 3E4CA 4G24A 3RG8A 1QP8A 3W5IA 3WV5A 5HCIA 1RKBA 1XRNA 3AH8A 5H3CA 1FNBA 1A9SA 3NWLA 2QVLA 4TXNA 4A3SA 2ODTX 2VYNA 2REQA 4LMBA 4P82A 5HFNA 3ME5A 2D0DA 2WJ3A 2ZJBA 3CUUA 4HS9A 1EVYA 3C6KA 5DWDA 1RAIA 1ZD9A 4EA7A 4NYMQ 4HVLA 1V41E 3DLTA 3SIWA 3NVKI 3M6WA 1SBTA 1AXEA 1QH1A 1DXHA 3AF3A 1US8A 5B1DA 3U7IA 5LD2B 3O82A 3DUWA 5ECDA 4AJHA 1ZCBA 3GAMA 5G1OA 3FPGA 4KAFA 4UPEA 4PR3A 1OLXB 1G8YA 2BKVA 3PI7A 3EASA 4UD2A 5BW4A 4QOEA 4O2BB 1JNYA 1YGYA 2QOEA 4PQRA 4ZKEA 4YWHA 3GW8A 3G2PA 1U9CA 1ZD4A 3C8MA 4LFCM 4FGSA 4E07A 1RJEA 1LVGA 4TKLA 2Z4TA 3M9WA 5J2UF 2WU1A 1DAGA 5TPWA 4XM2A 3WIUA 1YJQA 4LE2A 4XVUA 3RVDA 5AUNB 1SC6A 2OG2A 3OO0A 4FQ5A 5J3JA 5M5BA 1GTVA 1ESEA 3J7AC 4GLBA 2YTZA 1GZHB 1C5KA 1RXIA 4P0QB 4Y28F 1CY2A 1G59A 2W43A 2ZYTX 5LZ4A 2R8YA 3DVAA 4QQ8A 3TXXA 1W88B 2B4RO 3WFZA 3JAMS 4LSGA 2JHCA 1QR2A 1TH2A 4YRIA 5BNWA 2PUAA 2E5WA 3IELA 8OHMA 3YASA 3EMVA 3HR4A 3K30A 1GYPA 621PA 5I4BA 3MTJA 1RBYA 1RJWA 3CONA 4XB1A 2ZUFA 2X2FA 4A1FA 1E9AA 3KPYA 1H4SA 1XTZA 3DMRA 4ZT5A 4UBMA 4XM1A 2FH0A 2HCJB 3F7OA 4BFZA 1ZUNA 2W6QA 2QMHA 3ACCA 3S2YA 5GZ3A 3VDXA 5EP3A 2ONZA 2HJWA 3BK2A 2BEVB 4O8ZA 5KAPA 2IYYA 3F9RA 4C76A 5BSHA 5AW7A 4L5BA 2HHAA 4JY7A 2XBUA 2LCIA 2ZIVB 4MYCA 3RU9A 3LKDA 1JP7A 3VPBA 2L0XA 2EX1A 4LNAA 2QD4A 1Q44A 1TM7E 4MUGA 3CPSA 3NHUA 1Z38A 4D42A 4K0KB 2PX5A 3FYUB 4IWNA 3ZIAA 4KVGA 1HDGO 2EZUA 2GZ1A 5DRTA 4FFOA 1O6FA 4TLBA 2DH6A 4UBLA 5ICMA 1DO8A 2FX5A 3L7JA 3UAOA 2IXDA 5ALTA 5A5GA 5AHOA 4CV0A 5GVSA 5DHAA 2PZJA 2G5PA 1FF9A 1UP6A 3IHTA 4FFDA 1N5JA 3UOWA 2FOIC 4DF3A 3J81k 2WV7A 3MA0A 3N53A 2O2XA 5AVXA 3AM3A 3BUSA 3HO1A 2GZDA 1ZKMA 1DUIA 2H7CA 3HCWA 4CN9A 4D43A 4DDKA 1L8XA 3BFJA 3NC1C 3A70A 3QTTA 1EK2A 2PVSA 4IS3A 4OHMA 4E5SA 1MO6A 3UOAB 4X64B 2ECFA 3U61A 1QCYA 4Z6KA 3VK8A 3SQLA 1I7SB 2O8FB 3AWIA 4E08A 1Y6RA 5GQSA 1XZCA 3E58A 1QCCA 3KJIA 4YACA 4C4YA 2KI5A 3GELA 2ZS8A 4Y1RA 3Q3HA 1NUTA 3AHJA 3H2YA 3W8FA 2OSVA 3SJAA 1XEAA 2Z6VA 4MRMB 4AY5A 5H70A 3THGA 1SZJG 2AQ8A 1DC5A 3EAFA 4QM6A 4UTXA 5E8RA 1SOAA 5L51A 3S68A 1PZXA 4QDZA 5LQCA 4F11A 4G0WA 2HQRA 3R3JA 1XK7A 2Z8YA 3ZS9A 5FWAA 4A5SA 2JLCA 4FI3F 2V96A 2HI0A 5LDHA 2ZWVA 1Q7RA 1ODSA 4KRXA 2D1QA 2R6HA 4IDAA 3RRYA 2FMHA 1UBSB 1AK1A 1T4BA 5EJFA 3E9CA 1C0LA 1BS9A 3L02A 4HNUA 3IYLW 5JLAA 4B7GA 1V1JA 4R6XA 5J4YA 4HVTA 1F12A 3AR7A 4FWHA 3RUAA 1YFJA 3JQ8A 2R86A 2PX4A 4M1YA 2WTMA 5D7NA 3ESBA 2C7BA 2DPHA 1IL0A 2H52A 4C7KA 4JJ8A 1JMVA 1TT5B 1CR2A 3NT2A 3GXBA 1G55A 2PGNA 3B36A 1PTKA 4UM8B 4LTMA 2QZPA 1G64A 1G5FA 2X5JO 3GZNB 2WOOA 3QBTA 4G86A 4OMFG 4QUHA 5KTYA 4L0QA 1GL9B 4H18A 3UJPA 3EGXA 4BP1A 1VDDA 3C1UA 4K81B 4LYYA 4YBZA 4KGDA 2PPVA 2IS2A 1YVUA 4HDNA 4TT3A 5B37A 2XA1A 4HDSA 2IWHA 1T8TA 1LSJA 3EXIA 2XQJA 1L4HA 5C4MA 2XODA 3UMGA 1GTSA 1HBJA 5A2QS 3KCNA 1QDTA 1BWSA 1OTYA 3K2LA 1C3OA 2XUOA 3L04A 4ON9A 3V8EA 1Q3HA 4AZTA 4E22A 5IC4A 4XK8F 1J2UA 4G8DA 4YX9A 3DC2A 1RLIA 5FA5A 2O6LA 5JEDA 3NV9A 4F8JA 4FN4A 1AF7A 3LBIA 2QE7A 4RNAA 1E3LA 2PWYA 3OEEA 1NVWQ 4Y2YA 3CNHA 1OTXA 3EXIB 4O8CA 4EHAA 5FV7A 2BFFA 4UD6A 2V7TA 4PLFA 1S2LA 1AKYA 4X66B 1YJBA 1QH8B 1I36A 4F8EA 4GEGA 4B5LA 4PCUA 3R7WB 5JV5A 1ZZGA 2QYHA 4RJ2A 4WFQA 4OP1A 1JZSA 5IHPA 4X62M 3PJEA 2AI3A 3L7LA 4QDJA 4C7VA 1RC0A 3ML1A 3VJRA 3ICVA 3O9ZA 3GJZA 4QUBA 1KKUA 2WJPA 1F06A 1NUAA 2V8BA 4ML3A 1PJTA 3VVCA 2QX7A 3F2IA 4DGSA 3F6CA 4L4UA 2GERA 1WXFA 2HLNA 2WOJA 4OH7A 3BXPA 5CFRA 2NU6A 2VP0A 5J63A 2L4EA 4MW1A 4FFPA 2W58A 3O3OB 4BFYA 2KLHA 1HDCA 2HLHA 3MXTA 1N5LA 2WNSA 4L6IA 3SKVA 4BBJA 4RF0A 3CINA 2I4TA 3O73A 1DGFA 2WKQA 4PPNA 4JVLA 4MDHA 4YAFA 1JLSA 5CYFA 4IJ6A 5AM1A 5JBQA 1N4DA 1BQ4A 1II8A 3IXLA 4GO1A 4OFZA 5AJZA 3HA5A 4K9RA 3T41A 3AQIA 3L29A 2OXFA 3TLGA 4DV7M 1DHRA 4XDYA 4YCBA 3WNVA 2AGVA 4CM8B 2X4IA 2A2ZA 4INPA 5BMVB 1RI5A 3B5EA 2BTQA 3W3AA 2YY5A 4PGMA 5AESA 1AQJA 1IG0A 3V2IA 4DV4M 2CJFA 4JQZA 3ZJYA 5JNLA 3VYWA 2HA2A 3ILYA 1IIRA 3P9CA 4B6QA 2ZCJA 4UJ5A 1XI2A 2JJ1D 4YO8A 5AJVB 1PJLA 4CR7A 2O8EB 1CRQA 1AU9A 1KA9H 1ZNZA 4Z0PA 3W8RA 2X7JA 3ODPA 3U3DA 1OLUB 2V58A 5KYVA 1L7RA 1T0BA 2ZBQA 5IYZF 1IPEA 3IP1A 1Y7TA 4J2OA 2C98A 1MNAA 4RKQA 2F1IA 2ID4A 2UZAA 3WGLA 2OXEA 2RD2A 1RXVA 2FFAA 1MP0A 1SD2A 3IG5A 1XD2B 2D7JA 2W22A 4PXYA 2Q2QA 1JJVA 2HZ7A 1IMJA 1J1UA 3SX0A 4LJ8A 1EFUA 1J22A 4YMWA 4B33A 1DQSA 2B7BA 3BJEA 4B87A 5DPMA 4HNVA 1K6XA 3OBBA 1JJ7A 2C59A 4X1YB 1PL8A 4ALNA 4E1BA 4B6GA 3N8DA 3FY4A 5EQJB 3D81A 1WBBA 2VG8A 1CVIA 1QYDA 3FYCA 4DR2M 2GARA 3GA0A 3R3VA 4P0PB 2AMYA 4ZMBA 3G1TA 1OWLA 2MSCB 3OF2A 1X2EA 3FMFA 4TWRA 4DNFA 2UUAM 1JEQB 1UMDA 3RVBA 4MVWA 3FDFA 1JJIA 5CCEA 3TLKA 4JC4A 4X9XA 4EX7A 1O08A 3ABRB 4V0QA 4HH3C 1E1CA 1CQXA 3AT1A 4WEOA 4XE5A 4X62B 3BILA 3I1IA 4OJQA 2FS1A 1RABA 2BR5A 2IV3A 5I4KA 5AH0A 3PD0A 4YRKA 1WB6A 1H23A 5CHEA 4LJKA 2XFTA 3GN1A 2EYUA 1YZVA 1BXRB 2I03A 3IOMA 5A7GA 1XX6A 4Q4HB 4MCIA 4D4MA 4DLNA 2VA8A 1KEWA 1R2ZA 1J5EB 1K6EA 5KVVA 5BOSB 4W5QA 3C3MA 3IEKA 5JQGA 2OB1A 4GKKM 2YWRA 2GEDA 4KIJA 1SCIA 1JE1A 2CMGA 2G1UA 1YIDA 4FDMA 4OOEA 1E9BA 4BLPA 1D9XA 2NYRA 4OBEA 3CG4A 4V0KA 3D4OA 1O6CA 2O59A 4ZVPA 3ZGNA 1GNRA 2D7CA 1AIPC 2P41A 1A8PA 1JQ5A 4XEUA 4UPVA 2DE0X 1UBJS 4EIWA 4PW0A 2L2QA 2JWSA 2PQMA 3DONA 3GEDA 1TW2A 3KJNA 3LP6A 4W9MC 1TEZA 3OJOA 3ZXUB 4LRWA 4AN0A 2QK4A 3RTEA 3TAHA 1KKMA 3Q7SA 4LEIA 2PT9A 4BC1A 1NVVQ 1NVVR 1ZISA 5JCOA 1T0HB 3RM3A 2Q07A 4GEKA 1K68A 1VBMA 2VSFA 1C9NA 3GJ3A 3MN1A 3MVEA 4G4JA 4ZFNA 5DNYB 1NNJA 1II9A 2CNDA 2QTVA 3A1NA 2V6MA 4E5VA 2HN9A 5JXGA 1JPJA 2OAGA 2R8RA 4MWTA 3ER6A 2X0FA 5JNWA 4RJKA 3LQRA 1OKKD 3F7TA 3L1IA 1U9JA 2Q5FA 2TSYB 2BFCA 4ER6A 3I09A 4V39A 2Z08A 4CDMA 4NH0A 4DQVA 3AJ9A 3QYFA 3DB2A 4POAA 4W5WA 2QIPA 3QLVC 1RYNA 1D2RA 2I34A 3A6PC 1N8KA 4BUJA 4Y6LA 1RJDA 4MP3A 4OUDA 1Z17A 3U9SA 4KHPM 1BW9A 2OBMA 4IDBA 2XUPA 4LJLA 2I4MA 3QUQA 4TLCA 3BGOS 1Z5UA 4TM8A 2YL2A 3LC0A 4C6HA 3QEAZ 4M55A 4BB6A 5L9AA 4CKZA 2FUNB 4YMTA 3Q8XB 4ETNA 3N8NA 5CT6A 2A57A 3U31A 5DMHA 5IEBA 4PDGA 4K9PA 1P1HA 4O6VA 1W0KD 4IQGA 3MB5A 5J1TB 1E92A 3QWFA 4UHEA 1KO7A 1ZM4A 5KYTA 3RHZA 1BJTA 2Y1OA 3B1WA 1R64A 2POCA 1HYBA 3CTMA 3CZRA 4B3TM 2YNMD 1Y4AE 4IH1A 1TPZA 1SRQA 2XJ9A 3GUHA 3C6QA 5JAIA 3L01A 3V5NA 3CCCA 5TF4A 4Z1MA 3VMFA 1BHJA 3FZGA 3H5AA 4JCCA 5B58C 2DBRA 1Z2OX 1Z8NA 5DTEA 2W6JA 3ZKAA 1GGFA 2W6PA 1BDHA 2AV6A 2WWXA 5CFOA 1WWKA 4V0SA 2FPSA 1HE5A 1T2VA 4E5UA 3C85A 4B6PA 4WP2A 3V8MA 4JYPA 4QXQA 3O47A 4WAUA 2AOTA 2L17A 3DCNA 4K6MA 4F5YA 4IIFA 4WZBA 5A3QA 3OOJA 4ENSA 3VV3A 1J09A 1LQUA 2G63A 1QYVA 3VYUB 4GI7A 1Y5IA 2IZ1A 4KQGA 1TM2A 4RSRA 3H6KA 4G0XA 1Z25A 1GCAA 5FPQA 3CTPA 2RGDA 1N9KA 2UUBM 4J7AA 3KZXA 4KKXB 3VHXA 4AY6A 3QUAA 4GI5A 1WKBA 2GJAA 4MUXA 5TV2A 1F14A 4JJFA 3RABA 1IZYA 1MHPA 2YNMC 3U80A 5FPSA 2H1LA 3K96A 3C70A 3PQEA 3L93A 5HA5A 1A88A 3RVMA 3B13B 4MR9B 3D43A 5L3QB 1N6NA 3GIDA 3AERB 3IAM6 5ALPA 1DBQA 4PO3X 4V0NA 4XPIB 5F4BA 4B31A 2V54A 3MGKA 4WINA 3AM1A 4HH4A 4YDQA 2BFEA 4MCAA 2FLKA 5A06A 4DUGD 5FX2A 5HMMA 4WJLA 2HIHA 3K9GA 4W5NA 1PW5A 3PQ5A 1Z12A 4Y6RA 1K4KA 3NHBA 1W46A 3R4VA 4HNRA 4OV6B 1MQSA 3IDAA 4U1RA 1U3CA 2G80A 5EEHA 3TAXA 3DEKA 2WWYA 3JRWA 5EGNA 1S8OA 5DE3A 1F3LA 5KTKA 2XEPA 5CPFA 1YA8A 3E8XA 1MZPA 4E5NA 2X2OA 2NZJA 1Z0FA 4KPUB 2Q5CA 2J7PD 3QQPA 5KVAA 3JZMA 3DF7A 3VHRA 3LQ1A 5L3SB 4MWOA 4JVSB 2F5NA 1CR1A 1Y5LA 3TIXB 1EWVA 3WMRA 3DT6A 1RCUA 3KS9A 4A0QA 4I5GA 4YONB 4C0BA 3BDAA 4YALA 4ZVKA 2Q27A 3EFOA 1X39A 1Y9EA 1Z6ZA 4PYLA 2CE2X 3WKBA 2XF8A 3EDMA 2W2OA 4GLFA 1Y1KE 4CXMA 3Q6IA 2CUKA 4GRAA 4E31A 2DQ4A 3N0TA 2C9MA 1EWQA 5HF8A 2F67A 1O6ZA 5CA1F 2I6XA 3K0BA 1KPHA 3FROA 2LUOA 4QO8A 4IXDA 5DASA 1P72A 4A0GA 5LQRA 1XD8A 4GXQA 2OB2A 5DLEA 5TMEA 4JT4A 4KO3S 5B4VA 3R6LA 1SCDA 1VBNA 1J42A 3QBEA 4B08A 1C7RA 2BAGA 2J9FB 4UDYX 1SXJA 5JMOA 1I1HA 1QHNA 3KOZE 3EIQA 2Z58A 3ETJA 1UMKA 4FXOA 1OT5A 2Z56A 3QM1A 4PU0A 3AEZA 4EDFA 2LDXA 2H0AA 3GPLA 3FPJA 4WURA 4G4SP 1JIJA 1IQRA 4JBLA 1IPHA 2Z4SA 1B8OA 1O57A 1UFRA 3GNTA 3LQYA 4RDHA 5BT8A 2J6CA 3V1TC 1L5RA 1KF0A 4M4SA 1A2BA 1WDWB 2WG0A 3C6XA 3HB9A 4MUMA 3EW9A 3PC4A 2BTOA 4QPDA 3FOFC 4JLJA 2AXQA 4ZYVA 5CNMA 2I8AA 4IKEA 1J8VA 1M54A 3A7EA 1H2XA 1RYZA 3EGOA 4ER3A 3L27A 4URYR 4PDIA 2AR0A 2ZKLA 4P53A 1VM6A 3HACA 2CNNA 3LLUA 4LE1A 4WUVA 5BO5A 1XKXA 4BUZA 2QUBA 5JTTA 4KN5A 4TTPA 4CLHA 5BMOA 4TN1A 4RA6A 3RLIA 3F5SA 4E32A 4GUDA 3VR6D 3ANNA 3BFPA 4NPHA 1HT2E 3RJMA 2VAMA 1I32A 3CRRA 4FWIB 3V3TA 3L9XA 2JLRA 1D0SA 5FOXA 1BGWA 2HIAA 4BVLA 4X66M 2JFVA 4O3MA 2J48A 3DAFA 1ZXLA 2AC4A 2F4NA 3EOZA 2H63A 3KTDA 1ZOIA 4H31A 4IMJB 4WESA 4BNXA 4CEIB 3PHCA 1V33A 2EUCA 5F76A 1XZIA 4YAJA 1NVXQ 2PSFA 3GHYA 3FF4A 1XAIA 3VQTA 3T38A 1X1BA 3QG1A 3J7TA 3K35A 5F7JA 3IQDB 4MRMA 4EPYA 2P0EA 1GTJ1 3C1OA 1M73E 3RFWA 5HX7A 4BL5A 3UJHA 1H3FA 3T9DA 4I9GA 5DTRA 5GJWC 1OXKB 4AZVA 5CITA 3P9KA 2V7QD 2AJDA 4R5MA 4C6TA 1G8KA 1FVOA 4CLEA 4EEKA 2QTZA 3D6HA 4O0LA 2LVPC 2D4AA 1XTKA 1H2FA 1ENOA 4GOXA 3RAFC 4KMRA 1UMCA 1QMGA 3VI4B 2IXTA 4NAHA 4NSNA 3KXKA 1GQFA 2G9VA 1J24A 1SBZA 3NCTA 3QPBA 3CX3A 4N5DA 5A9RA 5JHHB 5KSZA 2ZM5A 4LJ4A 3ENVA 1F7VA 2Z9DA 2PD3A 5CCXA 1YRAA 4MUJA 4EABA 2PKCA 4H6VA 4TT8A 1L4BA 3LX5A 3CZQA 3Q7TA 4JBHA 1FEZA 3HL0A 3KOWE 4G2NA 2FHPA 1YBMA 2HO4A 4JYBA 1JKJA 1E1QA 1R5OA 4J1NA 3OF5A 3L1HA 3RAPR 5HZHA 3R0IA 3IL2A 3LUKA 4JX9A 1I7DA 3VNBA 1KO8A 1CZLA 3DMNA 1KJQA 3KEMA 4DQDA 3GLUA 4EEXA 2A9JA 3NRCA 2NV6A 3EVBA 2ZSDA 4HT3B 1Z3IX 2QM0A 3K09A 2DQZA 1L4LA 5CXUA 4O2BA 4GRDA 2GS9A 1PS9A 4W5OA 1J7JA 1W4RA 3ITEA 2O2ZA 5EZYA 4EI8A 3ESYA 1IPFA 1WLSA 4QEZA 2WYOA 2Z2IA 4HGQA 1I7PA 3BL5A 3ILSA 4JKOA 1OU4A 2R65A 5IJXA 1H2AS 3M1AA 4MQEA 4RTMA 5JAPA 1KERA 2GCEA 1VGQA 4IDCA 4MS1B 3PQ6A 2EKPA 4RZXA 5AQEA 4X8HA 3LCJA 3HCOA 5J2TB 3D0OA 3RVJA 4AJNA 2BDTA 3DOOA 2I65A 2R4QA 4A27A 2IYEA 3ZZMA 3VH2A 3W3AD 2ZUBA 4CIZA 4KH0A 1ATIA 3SM9A 4KE7A 1QPGA 2X15A 1QR6A 3DTVB 2XJ4A 4TRMA 5FQNA 1B76A 4E1AA 5FBKA 4B4VA 3DJYA 3N39C 4AF8A 1F8FA 3UFXA 3UPUA 3DVSX 4JUAA 4QOHA 2R96A 2ZYWX 3GGOA 1CUGA 3K2BA 3DV0B 2ZJOA 3EMBA 3UV7A 1K7YA 3I0ZA 2E0IA 1PEKE 3IQEA 1RPJA 1G0NA 4F21A 1QVZA 1TF7A 2NO0A 1OC4A 2VQ3A 3QYEA 3BXEA 3PQDA 4E03A 1YUBA 3DNPA 5ITZA 3FVTA 4X5OA 2WHXA 2CXQA 3W9BA 3GNSA 4U7WA 2NU9A 4DFDA 1E1RA 3GIWA 1U3TA 5CLLA 3A7DA 1PJRA 3GLTA 3CM0A 1R0KA 3S7ZA 1ZH6A 1Z15A 2WJAA 3OVMA 4JB0A 2XT0A 2NVUA 1WCIA 4C4OA 4V0MA 2CCJA 4LDPA 1IXKA 1S8FA 3JYQA 5ERYA 4EY7A 3KVVA 5B1SA 3GGSA 4F5DA 4RFLA 3TM4A 4G9GA 1E58A 1GPKA 2V6BA 5CCDA 1I30A 3ZKWB 3LT4A 1KBQA 3QX9A 1JPVA 3DE3X 5LZ8A 1OFIA 1Q12A 2CZGA 1XZGA 2O7SA 3QU5A 4LQLA 4LY9A 5T4HA 4G1MB 3M2PA 1SM4A 2CYAA 4CM9A 4IMRA 4RTRA 1ZA2A 2OM2A 3I4FA 1Y3BE 3IDQA 4LNUA 4ITUA 4OA8A 1WCIB 5ILQA 1V8OA 3KVNA 2JI9A 5E0OA 3IEXA 2I67A 1VPLA 2H0RA 5CP8A 5DXFA 3RRNA 1I7QB 4RTPA 2X8AA 4KI7A 1YQDA 4TUYF 3TNYA 4YUYA 2NSLA 5HDBB 2ZLBA 3CLTD 4Y1RB 4BNIA 1K92A 3VTZA 4WXMA 3E9EA 1LTHR 5E4TA 4U39A 5G0WA 2EYQA 3N74A 1NZJA 1GFZA 3GEIA 4L0CA 2OK7A 2RJOA 3A37A 3HRIA 3H5TA 4KQWA 4N0QA 1WSAA 2EARA 4K2AA 2AZTA 2IXEA 3H8SA 4XVHA 4KPFC 4NATA 5KYXB 1FNSA 2FN4A 3I5MA 2JD1A 4IYJA 4H2DA 4BDTA 3IUQA 3UT5A 3ZWAA 2XUHA 5CVUA 3K70D 4PFJA 1IQUA 3BH7A 3IAM1 2TMDA 3O9MA 2O8VA 4QTUB 1U02A 3CUVA 5LNK1 1XOIA 3H0EA 3EAGA 4XZ3A 3S2IA 4PVCA 3R3ZA 1Q19A 4C3VA 1VHTA 3H42B 3FE2A 4TYMA 3NDRA 1I1QB 3PQ7A 2ZU0C 4RLFA 2E18A 1VIYA 5DBIA 4BFWA 1T9GR 1A4UA 3HL4A 2BGIA 2PTGA 2QTLA 3FTPA 2QR5A 3NX4A 3MERA 1AUXA 1KDPA 1ZBQA 5HKKA 1CZOA 3R6TA 4MQEB 4EG3A 4HL6A 1QZXA 4HZUB 4LZAA 5IXSA 2P6NA 2QAJA 3RS9A 4PSDA 6Q21A 3MOSA 2XEDA 3C74A 2QIOA 2AG8A 4GP9A 5HM6A 1A9YA 1XDGA 1JN0A 2HX1A 5IBCA 1BVYF 3LRPA 4O4JF 1Y89A 4WKCA 1DAMA 1Y3DE 4R0NA 5IKEA 2PDAA 4RSHA 1Q0RA 1XMJA 2BFNA 1KR5A 1XEFA 4DR2B 4X65B 3WQQA 1Z36A 3O5AA 3N05A 1TUBB 1YZYA 2X6RA 2EBFX 4P3KA 2O4UX 1RXYA 3PEUA 3DPSA 3OTWA 3BRSA 1BX3A 1P5HA 2VSOA 3N07A 2B3TA 3OKPA 4KGVA 2YKGA 3HP1A 2PXCA 3ICEA 4PLWA 3ADKA 2J7PA 3LIIA 1FLNA 1LDEA 1G4AE 1N1DA 2PUDA 1GZVA 1TGYA 2I2BA