3U60B

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
MITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 103
structure length 319
sequence length 319
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u60B01
4U02A 4TMVA 4TSFA 2XEXA 5JFGA 1KDTA 3J81k 3OEHD 4PZLA 4NYJQ 1G3IA 1K5GA 4I1SA 2OLJA 1Q21A 3I8XA 3TBKA 3WNCA 5AJZA 1EFRA 3GQBA 5H68A 1NLYA 3UANA 2KB0A 4FXPA 4TMXA 4XD7A 3SFVA 3DVLA 1T3LA 2WM9B 4MKHA 1R7RA 1SKYE 3VNVA 4UXIA 4P31A 4FMDF 2NO9A 1ZD9A 3PIRA 4LJ5A 1U0JA 4I1VA 2EQBA 1I2DA 4IOJA 5JJLA 1VTKA 3T5DA 4EPWA 1KSHA 2Z4RA 1UKVY 3F8TA 2BMJA 1GZSA 3KUDA 4XWAA 4ARZB 4B2PA 1DG3A 4TT3D 3ZIAD 4D0NA 2ONJA 2GETA 4LHVA 1N5LA 3GLGA 3CLVA 4K81B 4QGHA 4M1OA 1XTSA 3KQUA 1XU4A 2GESA 4BLPA 3WBJA 4U7DA 2CLCX 2PX3A 2WOOA 1Z0FA 2JEOA 4TYYA 4CEIA 4ZIRA 2ZUDA 2ZSEA 3EZFA 1QG2A 1ODFA 5GJWC 3TW8B 3CF0A 3SQXA 3FHTA 2R2AA 4TMZA 1QHHA 4QHYA 1IJFA 1G4AE 3MRSA 5JHGB 3SHWA 3FMPB 4LV8B 4ESHA 4A36A 2CK3D 3CKLA 2ZRFA 1G7SA 2C9YA 2HXSA 4OHVA 4ASUA 1P2TA 4NL4H 1BS1A 2IYQA 3NDPA 3GJ8A 3TAUA 3K0FA 4B3BA 2PEYA 1TL7C 1KKLA 2GA8A 2GF0A 3R7WB 3KQNA 5EXSA 3KUCA 5L3RA 4DDTA 4PAMA 5FOVA 3OESA 5BXQC 3A58B 4Q1EA 4WIAA 1L8QA 1TQ2A 2OCBA 1NP6A 2RHDA 3K70B 2P6UA 3A4NA 3Q72A 3KKPA 4TL7A 1MABA 2QI9C 3UIEA 5K8TA 1FW6A 4ITRC 4ABYA 5FUXA 1W49A 3M6AA 2LKDA 5FTLA 2GXUA 1A82A 3WP0A 3OEHA 4FMCF 3EC2A 1ZVQA 1AN0A 3NEYA 2XJ9A 3L0OA 3ZGXA 5JS7A 4US0R 3ZJYA 3T1TA 4KJZA 3CZPA 3HYTA 1VIYA 1W47A 1II9A 4O2LA 1OXTA 3HWSA 4FWTA 1S2MA 1E79D 1M2OB 3W6PA 1J70A 5C4GB 4BFUA 4EPRA 4TT3A 2Z0MA 4HLQB 5KNDA 5DHAA 2XTMA 2WWYA 4POAA 4M9ZA 4TLDA 3W5JA 4KU4A 3RABA 1WQ1R 1CBUA 4QJ5A 4HAXA 5DE3A 4PC1A 5FR1A 1KMQA 4Z1MA 2GJKA 4JIMA 4LHYA 2DCUA 3LXXA 3B9QA 4Q00A 3BIFA 3K70D 1ZU5A 1U9IA 1G5RA 1COWA 1E9SA 3IIMA 2C9CA 4LI0A 2IXGA 2ZSDA 1N0WA 1E4YA 1KI3A 3PFIA 1ZNXA 2BCGY 1N25A 2ZE6A 2ZRLA 2WKPA 3GJ6A 3NH9A 4PHTA 2IUUA 3PQCA 2Q0HA 3IQXA 4LJ4A 5FFMA 3FMFA 2P5SA 4HLUC 2ODNA 4QGGA 1F2TA 3Q7QA 4I99A 2ZYTX 4NP6A 4RZ2A 1VCMA 1JECA 3QVUA 1R8SA 2QW6A 221PA 2C78A 3CWZA 4MH0R 4OJQA 521PA 4B76A 3TSOA 821PA 3FMOB 1AS3A 1AZSC 1YRBA 1Q12A 4JT4A 4LPKA 1LFDB 2ZQ5A 1V43A 2ZYVX 4G5OA 3I3SR 4Z51A 2DHRA 2J9RA 4V02A 2CE2X 4UNNA 1Z28A 4PHFA 2FSIA 3QI2A 1GDDA 3FOZA 2QROA 3B1YA 3BBPA 2ZE7A 4B3XA 4PZYA 5P21A 2CDNA 4HI0E 2CLSA 2HT1A 1BMFA 1NLFA 2O8EB 4UNRA 2CVHA 3R8FA 1DBSA 4L16A 1LW7A 4RD0A 5AK0A 2FJUA 2YOHA 3EZ2A 1KI9A 3JZAA 4QC2A 1XMVA 2HJGA 3WMFA 2CJWB 2JJ2A 2ZSBA 1HE1C 2IC5A 3OFND 3RNLA 1JAIA 1IN7A 1FX0A 2OCAA 3AP2A 4WZBE 1PV4A 1VDZA 4IFBA 1KO1A 1E79A 4PQFA 2XNDA 2EFHB 1JJVA 1J8YF 2WMOB 3S1AB 1KGDA 3QXSA 3IQWA 2ZAMA 1QHYA 2J5XA 2QAJA 4X8OA 4DEYA 5HZHA 3AVPA 5IT5A 4M53A 4KLNA 1G21E 1G3QA 1XDBA 1E3MA 2HF9A 4TTQA 3KXIA 4PC2A 1T6NA 4RVCA 5SZIA 2KRKA 1ZIOA 1ZAKA 3Q3JB 4OHXA 4RFVA 1VYVA 4JKYA 5JEEA 3ECCA 1UJ2A 1UBCA 2Z4SA 4LWZA 3KB2A 1OV4A 1KK3A 3EPJA 1B0UA 4RCYA 5FBWB 3N2EA 2GCPA 2JAQA 4PO9A 4JVLA 1KO7A 4QHTA 1G16A 2HCBA 3CBQA 1JEDA 1VG1A 3THOA 3U6KA 2A5FA 3L82B 1XEWX 4V0LA 1CRPA 3K0CA 3U7HB 4NONA 4Q7MB 5E3HA 4RZXA 2MMGA 4LV6A 2H5EA 3NC1C 5DI9A 2C8VA 4F92B 1P73A 2P67A 1GAJA 1EFCA 3PEWA 1E2IA 1HH4A 5HCIA 4JLOA 3T15A 2E1RA 3K9NA 3CRVA 2WOJA 1IXZA 2XOKD 3O8BA 2NPIA 4Q4AB 3LA6A 1DAFA 4W5WA 2DFNA 4RSGA 4D4LA 4AIIA 4J0QA 2DB3A 1RFLA 2ZE5A 4L8GA 4N0EA 4ZKEA 2QRNA 4NYIR 4A0FA 1T3SA 5GJCA 4ESVA 4RKFA 4WZAE 2ZRKA 3GEIA 2OCPA 3NHAA 2Q9BA 5J4KA 3UWOA 4ZO4A 4MRPA 4B3DA 1PZNA 2FEOA 1ZD1A 3L0SA 4OL0A 5CYOA 1JQJC 4MRRA 2F43B 4LJ9A 1TF2A 1VKJA 2YC2C 2V1XA 3NEJA 3EA0A 4E03A 4DDUA 4YQFA 5D3MA 3OIUA 2J7PA 2ZR9A 2VL7A 4ZV4A 1DO2A 1GILA 4BLRA 2ZRBA 1JXMA 4G5SA 3AF3A 4WAUA 3HU1A 1BIFA 2JA1A 2OFXA 3BXZA 3KQKA 5KSZA 4NYJR 3LD9A 2YNMA 4DB2A 3ZD6A 2IYRA 1W4BA 3KJGA 1E2FA 1E96A 3NBXX 2OFWA 2WKRA 2EU8A 4B47A 1M8PA 4TZ6A 3SI7A 2EFDB 3VR2A 3KJEA 3OHMA 1TUEA 5UKDA 1E2GA 1XTKA 2F1JA 3GLIA 1M1YE 1AQYA 1CR2A 5IRCD 1JXOA 1FUKA 2EW1A 1VYTA 1CLUA 4XWOA 3VHLB 3EZ9A 1SKQA 5JI3E 1KI1A 1W4CA 3LLUA 4TMWA 4TQ9A 4OI1A 1UADA 2LWIA 4KV9A 1OH5A 3UKDA 4DCVA 2GXAA 2JASA 1AKYA 4AWXA 2A5GA 2VO1A 1J8MF 3A1UA 3ADBA 2KWIA 3HU2A 2ZJBA 1GUAA 2GVZC 3A1VA 4NBSA 5IDVA 1OF1A 2EFEB 1NIPA 1E9EA 5EZ5A 1TX4B 1GOTA 3BFXA 4QL3A 4KVGA 4RFSB 1KI2A 2ZE8A 4JYBA 5EP2A 3PV0A 3V4RA 3EA5A 4HB2A 3MWYW 1TMKA 1YRAA 2IS6A 3CRMA 2PCLA 2PCJA 1EX7A 3I62A 1IN5A 1RRCA 2V6JA 4PFSA 1CKEA 3LY5A 4YMWA 1KYIA 4DLTA 2GXSA 4ERNA 2B7BA 1G64A 2DFTA 3THXB 1J7KA 2XTNA 2P6RA 2Z83A 4NDZA 1D2MA 1E0AA 3HJNA 4AG6A 1Z6GA 3BD9A 1FOEB 1ETUA 5GVSA 1IN8A 2QPAA 4NCJA 1OB5A 1P62B 3D7MA 1DO0A 1LTQA 2QBYA 1HT1E 1KMHB 1LB1B 6Q21A 1XXHA 2QU8A 1W4AA 3AF0A 2FU5C 1XD9A 1GP2A 2HUPA 2V7QA 3T1VA 1I2MA 2MMCA 2B8WA 2IEZA 2AFHE 4TMKA 2C77A 2OT3B 1G3RA 5H70A 2XZOA 1TUIA 3KQHA 2AWOA 4YMTA 4FCWA 1W2HA 2RHMA 3TK1A 5BN3A 4I4LA 3UPUA 4DLZA 3NIBA 5JHHB 2REXB 2BKEA 1UM8A 2HCJB 3GCGA 3T06B 4UKDA 5LB2A 1LV7A 1RIFA 2ZXUA 2IBMA 4OHYA 3UMFA 4ZKDA 3TUJC 3VU9A 4HLUA 4JBWA 1MO4A 2C2HA 2FF7A 4EPVA 2VF8A 5B64A 1PLLA 4QHSA 4Q4AA 3OIWA 1X3SA 1UFQA 2OG2A 1DTSA 2KBFA 4M9SA 4LK2A 3MAAC 3GJ5A 1N0VC 4XWKA 2GJSA 3TW4A 4ON9A 5CIQA 1W46A 4JBXA 1YR6A 4QBGB 3DM5A 1EK0A 4M1MA 1OW3B 1Q22A 2GK7A 1Z47A 2N42A 4FMBB 1F60A 1VCOA 1YE8A 4TL9A 5EJEA 4C0HA 1P9WA 5J4HA 2FFBA 2A2ZA 2F43A 5TDHA 3ADKA 5C18A 3AQ4A 3CRW1 3FHCB 3G82C 1ZM7A 3RRMA 1U94A 1AS0A 4Q9KA 5JSZA 2BJVA 2XAUA 3THWB 4A2QA 1CULC 5AUPB 2O8DA 4GNKA 4NTZA 2R44A 4L9SA 1QHGA 2OBMA 1KI6B 1EWRA 3W5IA 4NZYA 3GJ3A 5CLLA 2VP0A 4BEJA 4P4UA 3MWKA 4EFMA 4LYJA 2OHFA 5AJYA 1OPXA 3RWMB 2QE7D 2F1IA 4BRWA 4YDHB 3RRNA 3QG1A 4FINA 5E95A 2G1KA 3NWJA 3TR5A 5JWRA 3E2IA 3PVSA 1TEVA 2Q21A 1N3BA 1GL9B 3GPLA 4OBEA 2VTKA 4MITA 1OKKA 1RZ3A 1NLZA 1J99A 3EC1A 4DEXA 1CJUC 1ZUNB 3BFVA 3T1QA 2ODWA 5JMTA 2I1VB 4IDHA 4IDQA 2PZGA 1E32A 1CJVC 2VP9A 4Q4HB 2W83A 1W36B 3RS5A 1XMIA 2LCFA 4L5BA 1NJGA 2J0UB 1TAGA 5AJWA 5JZVA 4LYFA 2VSXA 3MWLA 3JVUA 3U60B 1CTQA 4RFSA 1VPLA 4JLVA 3VFDA 3H0KA 2ZRCA 5JWOA 4QM6A 2ANCA 2YYZA 2J0QA 1EESA 3RC3A 2JLUA 4Q9HA 4PX9A 1BKDR 1UKEA 3X1XA 3OIVA 3TIFA 2ZR7A 3FDIA 4Q7JB 2BWJA 3IBGA 2R65A 3UATA 4XTCS 2VEDA 5TXGA 2PL3A 3K0AA 1XB2A 1HUQA 1Z22A 1ZRHA 4HB3A 5FOSA 1Z06A 2XTZA 2QQEA 1KJZA 5EE0A 1DOAA 2C03A 3BERA 3QBTA 1GKYA 4W7SA 1LF5A 2F7SA 3NVAA 1G6OA 3X1ZA 2F6RA 3GLHE 1YR8A 1G18A 1XTJA 1R0XA 5JCPA 3KJHA 2X19A 4LHXA 3SYLA 1KMHA 1LVGA 4FWIB 2MSCB 4E07A 1S4QA 3SJAA 1T4GA 2QT0A 2HLDD 2EYUA 3ZZUA 2JIZA 2QEQA 2X8AA 1XCMA 2FN4A 5EXTA 2FPLA 3BB1A 4Q9LA 4A6PA 5A0FA 3HYRA 2KJQA 1AQUA 1VIAA 3AH8A 3RYTC 1WBBA 2ZYUX 5JJKA 1W36D 1LS6A 3GD7A 4OK3A 4CVNA 1P9RA 4GOXA 4PO1A 4YMVA 4DLSA 4DIEA 2YWEA 2BDTA 3FWYA 5DO9A 3GJ0A 1GNQA 1GL6A 2ZI7A 1NY6A 1K8RA 4HEJA 5HE9A 3ZVMA 2DR3A 3FKQA 4OQXA 5CM9C 5FOWA 5E4FA 1VYUA 3KXLA 3CONA 2C5LA 1N6OA 3QQ5A 4Q1DA 1KSJA 3CPHA 3W6OA 1NRJB 1ZIPA 3CPEA 4F38A 3ZQJA 3P4YA 1F6BA 4B3GA 1DAMA 3GLGB 1E4VA 2ZI3A 1FP6A 4JSYA 1FPMA 3KB1A 2XB4A 1NVWQ 3MSXA 4B34A 3W3AA 3RS2A 4MGZR 5AUQA 3K9GA 1FTSA 2IYUA 4B43A 1NL3A 1W5TA 4ZIRB 3THWA 2RGXA 4CEIB 4B44A 1UKZA 2FZ4A 2IWRA 1SHKA 5KPDA 1JPJA 4LBZA 3CZQA 3V9PA 1FQKA 2CHGA 4NPHA 2YWFA 1PUJA 4BFXA 3K9LA 3RSOA 2QUZA 1NMZA 1NVVQ 2C96A 1OSNA 1E2MA 2O0HA 1KI6A 3AUYA 2HT6A 4XTRA 1OIXA 4DLXA 3EX7C 4CEHA 5H8WA 1X6VA 1HV8A 2QZ4A 3K0FB 4TSFD 1ZC3A 3BJIC 2GJ9A 2GWHA 3LAWA 1JEEA 2CL7X 4M1SA 3B8HA 2GAOA 1T3HA 1EFRD 1MO6A 2QNRA 2XJ4A 1E2QA 3UXMA 2FMXA 2J41A 2WWGA 3GMTA 1FL9A 1MABB 4PZZA 3UG7A 2O8BA 1F2UA 4BZQA 3SE0A 2X2EA 1NG1A 2Q9CA 1P4SA 3HU3A 3DM9B 4Q4HA 4FN5A 4DVGA 2W6JD 1FFHA 2CL6X 2RMKA 3JVVA 3WMGA 2WIAA 5FR2A 2DFLA 1A1VA 4URVR 2A7QA 3U7EB 4BFVA 5FBVB 1E1QA 3RLFA 1EFUA 5CJ2A 1XD2B 1IY1A 4HATA 1T0JB 2BEKA 2ZJ5A 1RJ9B 1ZM3A 4A4DA 1U0LA 4CZ2A 2PZFA 3U4QB 3M4YA 1Z6TA 4EIWA 1I4DD 2FG5A 3B1ZA 4TLBA 5IHPA 3L2OB 3TLXA 1DEKA 2R6CA 1KO4A 1XJ0A 1M34E 3LVRE 1CXZA 1E2EA 5CDFE 1SVKA 4PHGA 3RDPA 3NDBB 3CF6R 4ACAA 1PUIA 1ZM2A 3KDSE 1YJ5A 1Z08A 3P27A 5DI3A 3GEEA 4NYIQ 4DXAA 2GEVA 1ZP6A 1R8QA 1VG9B 1ZU4A 2YWHA 4CYMA 2WIBA 4KSCA 4JYCA 5H1YA 3ZVNA 2DWOA 3OAAD 2WWXA 2HYIC 4URXR 1N6IA 4PO8A 1R0WA 1C9KA 2IF0A 5JJIA 1Q1ZA 3VLFB 2BBSA 1EWQA 1UPTA 3MLEA 4FD2A 2JCSA 4JL5A 2CVFA 3VKGA 4C0SA 2HJVA 5FPSA 2IS2A 4DSUA 3AKDA 1F2TB 5TMPA 1QVAA 4S35A 3Q7PA 1IAQA 1IN6A 3SNHA 3RS3A 3EIHA 3LBHA 3P32A 2AWNA 2NO0A 2DWZB 2QTFA 2JJ1D 1G5TA 4LJYA 4KODA 3FYHA 1OFHA 2SHKA 2AD5A 5FTNA 2XNSA 4KITB 2W6JA 3WXMA 4C0AC 4DCTA 2AKYA 2OEPA 2VSOA 3ASZA 3D31A 4UXHA 3FPAA 5LD2C 4CEJA 4P32A 2CHVA 2B8TA 2XZPA 3TQCA 3QY0A 1TQ6A 2D7CA 4R9UC 3H84A 3MGCA 4Z1MD 5EP4A 4Z8YA 4JL6A 2ZJAA 1P3JA 3TSZA 4C0KA 2VHUA 1P2UA 4GL2A 1FX0B 4U5XA 1ONBA 1H8ED 4X8MA 1COWD 3K0EA 4EFLA 3U7FB 4Q48A 2L0XA 4BZPA 2CHQA 3IPYA 4HAWA 4QXAA 2WJGA 4B32A 2OAP1 1CP2A 2JLWA 1TU4A 5BYJA 1R5BA 4KFTA 4RD3A 1G8HA 1FMLA 1OT3A 1XCPA 4P4SB 5FL7A 2G6BA 4G5QA 2VP6A 3D3QA 3EIQA 1UDXA 2FPKA 1J2JA 1MO5A 2G3YA 4V0ME 3GP8A 1GTVA 1R0ZA 5FPYA 3AGPA 1KI7A 3OAAA 1ANKA 3K1JA 2OZEA 1I4TD 5JRJA 2QMHA 1W0KD 4LZZA 1XCGB 2A78A 3BGEA 1DAKA 1WMSA 5FPTA 5HE8A 1ZNZA 1BMFD 3PG5A 4TMTA 2YJTD 4A0HA 4JT2A 3NBYC 5JS8A 2BMFA 1XD2A 1YU9A 3LQRA 3DOFA 1XFAA 4A9AA 1XPOA 1JBKA 1NN5A 2OO7A 1OJLA 2JJ2D 4Q5IA 2JJ1A 1RJ9A 1K5DA 1JALA 1Q57A 2DBYA 1QBKC 2YINC 4HZUB 3SBDA 3SJBA 1G17A 3U4QA 4KYIB 1N2CE 5BYKA 4DZZA 1R0YA 4KVAA 2QMEA 1OXVA 2ZI4A 1GL7A 5F2EA 1EX6A 1SVMA 3FE2A 2XNDD 3TVTA 3QPVA 3U3RA 2WKQA 4PQRA 4A8JC 1RE0A 2ZRIA 3NG1A 3X1DA 4XVUA 1KTVA 2BBTA 3E70C 4MUAA 5TB5A 4TL8A 3AVVA 5FTJA 1XX6A 2BCJQ 1N5IA 2Q9AA 2F1HA 4JZKA 1ZC4A 1UKYA 3E1SA 1QHIA 1E9FA 2IL1A 1KJYA 3CR7A 1H8EA 2J45A 2H57A 4CF7A 3AVOA 4PAOA 4V03A 3BRWD 4Q9IA 5FUYA 1D9XA 1E69A 2ORWA 4QBHA 5D3MB 3GJ7A 2JGNA 3FVQA 2QG6A 5EP3A 3IIJA 1DVRA 5G41A 3BH0A 1MRNA 4RCZA 1KDOA 1Y63A 3MJRA 4LV5B 1AJEA 2PT7A 4JJKA 1NBME 4DCUA 1A2BA 1MOZA 1JPNA 1R5NA 4TTPA 2CCKA 5JBQA 3RS4A 1II8A 3CRQA 1NF3A 3WY9A 3GFPA 5KDOA 1AGRA 1XEXA 3K0SA 1M6NA 1W0KA 2ANBA 3GLIB 1P5ZB 2K5UA 2CMKA 3T5GA 5HCNA 1OE0A 4IW3B 2P2LA 3PUVA 4IKEA 3BB3A 1KAGA 5TV2A 2B7CA 2FWRA 2QPOA 4GOKA 4IVQA 2XZLA 3R20A 3I5XA 3OIYA 1LF0A 2VH5R 2QENA 3Q5DA 4OI4A 2IHYA 4QGAA 5HTKA 4AG5A 3RAPR 4GT1A 1G8PA 4QKQA 1XJQA 2H18A 2ZAOA 1ZMXA 3I32A 1E2DA 1Z3IX 4A2WA 3N2IA 4Q02A 4B2IA 3AVYA 1NVUQ 1P60A 4DSNA 1NNEA 1Z29A 4IVPA 4TYQA 4GFDA 3DMNA 5FBQB 3B9PA 2NO7A 1NVVR 3I72A 5BQ5A 4DLRA 5A4JA 4F7WA 2J7PD 1DAHA 4Q4JA 1P2VA 2FFHA 2Q6TA 4BLTA 4DBLC 3U44B 3ZZTA 4TYNA 2I1QA 1XBTA 3A6PC 1X8LA 3CUEF 4P4SA 4DCNA 3OF5A 3W3ZB 2WJVA 1E6CA 1GSIA 1OIVA 2J3EA 4JL8A 4BUJA 1NSTA 3O8RA 1G8GA 1R6BX 1Q1EA 1OIWA 3E5HA 5JLJA 2A9KA 1ZW6A 1JB1A 4HDOB 4IOMA 4Q21A 3L0PA 3LX8A 2QBYB 4K8OA 4LBYA 5BW8A 2ZSFA 3ZD7A 1XXHB 2FFQA 1P9NA 2EYQA 3GLHA 1WCV1 4JLAA 1VCIA 3U6BA 3M0EA 2CCJA 1OFTA 1DADA 1KJWA 4Q1CA 2OESA 2NIPA 2IXFA 1XTQA 2IYWA 3EPHA 4M1TA 4B6FA 4HZUA 1E0KA 1E2LA 1ZINA 1XZPA 2B6HA 3UMRA 4UQOA 1E2JA 4AK9A 4ILEA 1T5LA 1T8UA 1ZM4A 3VU9B 2IXEA 1J90A 3HPRA 2QY9A 4RZUA 1KNXA 2GXQA 2X2FA 3QPUA 4AY2A 4AYWA 2VIIA 2W00A 2IK8A 2J59A 2WAXA 2E87A 3C14C 4LUCA 1UEJA 4JLJA 2EVWX 4Q03A 4DCSA 5J4VA 1BYUA 2IT1A 4BQSA 2E9SA 1G291 4UJ5A 1WE2A 2PX0A 1P2SA 1U99A 1SKYB 4ZCMA 2YZ2A 3W9YA 1QHSA 3BFKA 4H9GA 1Q0UA 4TTRA 1KZ7B 4KSBA 1B23P 2GK6A 1R4AA 2BC9A 4NCIA 4GDFA 5AUOB 2F3TA 4W5HA 2VQSA 1W1WA 2C95A 1US8A 3SDZA 4R7ZA 2HXYA 3RHFA 5JSZB 1KHTA 1ZUIA 3F0TA 4HUTA 3X1YA 1MH1A 1E0SA 4PPNA 3QPWA 5CM8B 2V7QD 1G8YA 1L4YA 3DDCA 4M9QA 4Q9JA 3RS7A 2O8DB 1NY5A 4P3YA 5AR1A 1HQCA 4FWDA 4N1AA 3P20A 3O8DA 1NKTA 3KTAA 1RYFA 2BOVA 3RC8A 3TJZA 2G9NA 2PT5A 3BB4A 4EKDA 2JLRA 2FEMA 1D2EA 1OYWA 4RKEA 1TU3A 3BS4A 3Q5EA 1VHTA 3LO5A 1CJKC 2QP3A 1JI0A 1NN0A 3VR4A 3DPUA 3KW6A 4V0NA 1RRFA 2ERXA 4OHWA 4K46A 1OH8A 1G3UA 5C4MA 1KOFA 3U2QA 1CF4A 1QHXA 1ZCAA 2PMKA 4GMDA 5EE9A 5EQTA 5F98A 1KO8A 4FWHA 4PHHA 2D74A 2AXPA 2ZSAA 3IDQA 3EPKA 3EASA 4MRNA 2NZJA 1D9ZA 3KJIA 4NE2A 4LYAA 4A1FA 1Q20A 2QM8A 1QDEA 2A5YB 3U44A 2RH5A 5DSZA 2FNAA 4FI3C 5DGXA 3K0AB 1QVRA 4OHZA 2F1RA 4JLDA 3M1IA 4G1UC 2CNWA 1YZLA 3QEJA 4YLGA 1P6XA 3R9IA 4HUQA 421PA 4MGYR 4FCVA 2BKUA 4PAQA 5JEDA 4TYWA 3QKTA 4ACBA 4M4SA 4A8JA 1D5CA 3UMSA 2ZRDA 3QXHA 4KFSA 5CDFA 3DZDA 3EIEA 721PA 3RWOA 5KNCA 3QKUA 2ZUCA 2BMDA 1YZGA 1OKKD 4PANA 4OQMA 3EXAA 4FCTA 4GITA 3BH6A 2R9VA 1G1MA 1KY3A 3L8ZA 3ADDA 4G3XA 1FP7A 4R98A 4TLCA 4EFNA 4X8LA 1E2NA 3TSWA 3LWNA 2FSFA 1FMJA 2CL0X 3CM0A 2JDIA 1WXQA 3QBVA 5K8UA 4Q19A 1S9HA 4MGKR 4QNMA 1RKBA 4BECA 1D8TA 2PEZA 3KQLA 3BOSA 3AF4A 3ZVRA 4OJKA 3FFAA 3TR0A 4HZIA 2X77A 1WF3A 3REGA 4C0QC 2GNOA 1NVMA 1ZCBA 2R6DA 2VYFA 4NCKA 2REOA 4M22A 4GPTA 2KE5A 2FX3A 3TAHA 3T35A 2WJHA 4PSVA 3I1FA 1WDTA 2QORA 1LNZA 3Q9LA 5M04A 4HB0A 2JIZD 3R9WA 5ELXA 2ZU6A 2VA8A 3VHXA 4PC6A 3AJIB 2OE2A 5FBRB 3CF2A 1XRJA 3L8YA 1M7BA 4NYMR 4R2HA 1WBDA 2QTHA 4HLDA 4CEHB 5FTMA 1CIPA 1CS4C 1U8AA 5ANRB 2PJRA 2ZREA 2ZJOA 3AP1A 3KZ1E 1E2HA 2RKOA 1QZXA 1S1CA 4GRAA 4LRWA 2BEJA 3UG6A 1HURA 1GVNB 1OXXK 4DJTA 4LJ8A 1XWIA 4GMXA 4OI0A 4EQ6B 2W2XA 5CK5A 3SJZA 2H1LA 1XMJA 1RC8A 1A2KC 2RCNA 4AD8A 3W8RA 1GNRA 4PXAA 621PA 2D7DA 2O8BB 1NBMD 1F2UB 3H1TA 5HKKA 5IK2D 2YHSA 1HT2E 4V0MA 3VKHA 4D82A 1LS1A 2VF7A 2C98A 2RGNC 2BV3A 2V9PA 1MR3F 4DLYA 1Z2AA 5DISB 4TYPA 3WNBA 4E5UA 4D4JA 2R6FA 1E2KA 1L2TA 2GTPA 3A4MA 2ZTSA 2NZ8A 2G0TA 1BO6A 4QRHA 2JLYA 2UVQA 3IGFA 2A3RA 1XNJA 3CH5A 1AGPA 1II0A 1N6RA 1IM2A 4M9XA 2VP5A 1DAEA 2CXXA 3KKOA 2LKCA 3AF1A 4GBMA 3X2SA 4QJ4A 2CBZA 5TVKA 1JQLB 2WZQA 1DPFA 2NO6A 4JJZA 3LFUA 4B74A 2GZDA 3EW9A 5G3YA 4ZCLA 3C16C 4PC7A 3VKWA 2W2TA 1NSFA 3CIOA 4II7A 5DI3B 3ZDQA 3VNUA 4TZ0A 3C7KA 1L7VC 1NI3A 4LRSA 4WZ6A 1AKEA 2P3SA 4C0JA 3Q8XB 2DZOB 2NTYC 2ZM5A 2CEAA 2ZS8A 2ZUBA 1S3GA 2AFIE 2GCOA 5KDLA 4XOIA 5DYIA 3CWQA 4RZ3A 2GF9A 1BYIA 4O3MA 4HLCA 1SULA 3HDTA 1PLJA 3GLFE 2KBEA 4DLVA 4C2UA 4IOKA 5HR5A 4NH0A 4URYR 3VR6A 3LV8A 3CR8A 3TQFA 2IYVA 1E1QD 4F4JA 2V6IA 2YOGA 4IJMA 1XPRA 1WRBA 4C0BA 2N46A 1Y3AA 1YZNA 3MJHA 1FQJA 1NBMA 1IXSB 4KFRA 5IK2A 3K09C 1UAAA 1KSGA 1IONA 1D2NA 1AZTA 4LCBA 4OK5A 1XEFA 2X1VA 2IWHA 4O25A 2WBLC 3SEAA 4CEJB 3NBFA 2RGGA 4BLQA 2H8KA 3GEHA 3NH6A 1CJMA 5L3SB 1T0HB 2NGRA 4DKXA 4ZDIA 1OYYA 2AKAB 2ZRHA 5JWHA 2EWVA 2MSEB 2BM1A 4KAXA 4Q1AA 3RSLA 4UNPA 1SVOA 5DYGA 4TN1A 4NHOA 4ZDJA 3SYNA 4PC3A 2GKSA 4KBGA 3DEFA 4URWR 2QGZA 1AA9A 1ZNWA 1G19A 2O0JA 4YXWD 4NCNA 5CK4A 2WVJA 4ZPXA 1RRGA 3U3OA 3B1VA 4LC0A 4BE7B 1GWNA 3NKVA 2V3CC 5LPNA 1KK1A 3B1XA 2F9MA 1S96A 4ZI2A 2N1BA 2H7VA 2FA9A 4LBWA 2DFKB 2F9LA 3SS8A 4EQ6A 3A4LA 1G5PA 1TQ4A 2QT1A 1YR7A 4URZR 3B82A 4JVNA 3QG5A 4V0KA 3NTUA 2DWPA 4MYHA 2DZNB 3SR0A 4JVSB 4W5JA 2VRWA 3AM1A 4DWJA 5B30A 5SZKB 1QF9A 4C0LA 3TNFA 5L3QA 4MQBA 1OFUX 5B57C 1CR0A 1EFHA 1KI4A 5KSOA 1GRNA 4YC7A 3OZXA 4C30A 1W0JD 1RW4A 2AXNA 3AKCA 1HY3A 3GFTA 3P1JA 4A2PA 3LVQE 5DIFA 1GG2A 2O8CA 2D2EA 2EFGA 4LRTA 1OH7A 1JJ7A 1ZM9A 2W58A 3SHFA 4CT4B 3B78A 3LNCA 5FUVA 2AL7A 4D6PA 5LDDC 3TKLA 1S1MA 1R10A 1M7HA 4F93B 5K8LA 2RGAA 1FNNA 5E7IA 5EUQB 2BMEA 2GBLA 5LB4A 4AURA 3P4XA 4XSGA 3G0HA 1NJFA 4EAQA 2W2VA 2Z43A 3LW7A 5FI0B 1W48A 1E99A 4DT1A 3QJYA 3U61B 2I3BA 2VBCA 4B73A 2IYLD 3FMIA 2RAPA 4BLOA 4CGZA 3ETLA 5FL7D 1GITA 1ESNA 3MG9A 4DB4A 2G1JA 2J7KA 3KXKA 4UXJA 1E9AA 1XMSA 4RD2A 2YVUA 1UEIA 4HAUA 2FSGA 4YXWA 1ZYUA 3W6NA 1Q1BA 2FDCA 1M7GA 4CRWB 4XH9B 2W0MA 5GADl 3L0IB 1X1RA 1QG4A 2FZLA 1U8ZA 2R8RA 1SZPA 1JNYA 2ATXA 1DG1G 1XZQA 2O0KA 5CLQA 2RGCA 5CJPA 1YZKA 4DDVA 4NU0A 4V0OA 4IXMA 5JCZA 4D4MA 1IOZA 1N6KA 1I4LD 2ZI5A 1E2PA 3KX2A 5KO2A 3MMPA 2OXCA 4LYHA 4DIDA 4LSGA 4IOLA 5CB8A 1II8B 1G41A 3QXJA 1XEXB 5F9FA 3FTQA 1P72A 3SBEA 4B75A 3K53A 2QGNA 2J46A 1NN1A 1H8HD 1GKIA 2Z6VA 3GJXC 4JLKA 1GIAA 2GDJA 2YKGA 1W0JA 4LHZA 3FB4A 1MO3A 2FSHA 4MUBA 2PJZA 2QM7A 1DE0A 2ZRNA 5C2JB 5EP1A 4MYTA 4IHQA 4BFWA 5CITA 5EE1A 3D8BA 5L3SA 3AGQA 2JLXA 3EWAA 3B6EA 4LGMA 3QKSA 4LBVA 5E7JA 4JVMA 4D25A 1U0HC 2FGKA 4N3NA 4B3FX 3QF4A 4UJ3A 1OHHA 1U8YA 2OM2A 5F3WB 2R6AA 2WICA 4DSTA 1UBEA 1E9CA 1R5OA 2NG1A 2P65A 2ODEA 2RGNA 4Q4JB 2O8FA 5CIWA 4UNQA 3AVUA 1WP9A 2REBA 4JS0A 1Q3HA 4QOSA 4Z54A 2OV2A 4DRZA 1NN3A 2D06A 3CH4B 4U00A 1CJTC 3ZQ6A 3C8UA 4KLZA 1OH6A 4BLSA 1FTNA 4IEIA 2F3RA 2J1LA 4EPXA 2GAAA 5FL3A 5DNYB 1Z5ZA 3BWDD 4O0MA 4C9BA 3CTDA 1M74A 2AK3A 4BFSA 3RS0A 4URUR 3GLHB 4F4CA 4WW0A 1JAHA 4IRUB 3WYAA 4CDGA 4LY6A 3C5CA 3T1OA 1SXJE 1SGWA 2YWGA 2G77B 4XSHA 1F3OA 2XSZA 1ZUHA 3VR1A 2QAGC 1QZMA 3CPJB 2ORVA 3O47A 4Z8XA 4KHZA 1E9BA 2D2FA 1KO5A 1XJCA 1W44A 4EJSC 4ZCIA 1BOFA 2ZI9A 2WSMA 4KXFB 2XITA 4OQLA 5KYKA 5EE5B 3AUXA 1FZQA 1H8HA 4FW9A 3RVBA 4AKIA 1G9XA 4A82A 5J40A 3GLFB 5EXPA 2WAYA 2IA5A 2ASEA 1KSFX 1V5WA 4QBFA 2PZEA 4AC9A 3SFZA 4BFTA 3U3JA 3THYB 3ZLJA 2IYXA 1NMXA 3AVWA 4JLBA 2ZU0C 1U98A 2V55B 1DELA 4Q01A 4QJ3A 1Z0AA 4BASA 3TMKA 1JR3E 3FGNA 1E9RA 4O2RA 4DLWA 1C4OA 3IKJA 1ESMA 3IPXA 3VR5A 3LBNA 3K09A 1EXMA 5TARA 4GSYA 1TADA 4DC9A 1CU1A 2IX3A 4L15A 4QM7A 1Q1QA 1US8B 1VG8A 1X37A 3ZIAA 5KU1A 2IUSA 1QRAA 4A92A 3BE4A 5LD2B 4C7OA 3LBIA 3QKRA 1HA3A 5C1BA 3EWSA 5KHOC 1UF9A 1G20E 4TQUS 2FH5B 3ONWA 5EXXA 3CX8A 1F48A 4HDQB 1AS2A 4NYMQ 4XVQA 4EUNA 2UZIR 1Z07A 3KTAB 2VHQA 4ZDWA 1P75A 3TUZC 2VHCA 2H16A 3L43A 4Q66C 5DN6D 5IF9A 2IS4A 1DAIA 4LJAA 5F9HA 4DHEA 2CK3A 3U5ZB 3FHOA 3HR7A 3N70A 4Q1FA 1VECA 1L4UA 3I5YA 3GJ4A 4MYCA 3CNOA 1KKMA 2NQ2C 3EPLA 3DO6A 2OILA 2HYDA 2ZYWX 4WOPA 3ZS9A 1SVLA 2A5JA 5G3ZA 4WXRA 3I73A 2IHBA 3EAQA 2VHJA 4MYUA 2H92A 4JSTA 4MDFA 2JLQA 4IDNA 3QOFA 1Z0IA 4GOJA 3DZ8A 3PUZA 3BGWA 2ATVA 3AP3A 1O3YA 3I4LA 4QG7A 1DARA 5FUWA 1E98A 4Q18A 4F91B 4ARZA 4IDOA 5A5GA 3HR8A 2IYYA 1KIMA 2ZVPX 2EFCB 2JLZA 4MDEA 4OI2A 1MV5A 2ZETA 1RVDA 4PPFA 3A37A 1X8JA 1EFTA 3CO5A 3FKSD 2PBRA 1IY2A 2QAGB 3Q85A 2V4ZA 3H2YA 2MSDB 2CE7A 4C4PA 1YQTA 4MRSA 1SHZA 3B7GA 4EJSB 1S9DA 4I1OA 2QMUA 4KI0A 2HEIA 3DKVA 2ODBA 4WBSA 1PVOA 4BWYA 4NMMA 3IEUA 4HUQB 4ZDKA 2BBOA 1OFIA 1KY2A 2UZ3A 5JECA 3WHLA 4KO8A 3SU8A 4FMDB 4A8JB 2PLFA 2RB4A 4WA7A 2XB2A 1G4UR 1R2QA 2A30A 2GZAA 2OBNA 3CNLA 3QF7A 2WPDD 4FIDA 3R7WA 4LX0A 3LXRA 5SZHB 3VMFA 1IHUA 1MRSA 4KCGA 3AEZA 5L3VA 2BVNA 3AF2A 1SXJC 1U90A 3DL0A 3U7GA 2BJWA 2V1UA 5EZ6B 2TMKA 5FOXA 4E22A 4OK6A 3EG5A 3KKMA 5DN6A 1TPZA 2OAQ1 4PSKA 1A5TA 3JZMA 5DHFA 4GZMA 2R9GA 5GJVC 4TLAA 4JBYA 3WMEA 4HDCA 3GLFA 3MD0A 4QNRA 1DS6A 4B6EA 5CB6A 3THYA 1MKYA 3KFXA 2GJ8A 4NCHA 2KSQA 4D26A 3AB3A 2ZJYA 5AUNB 1CR4A 1AM4D 3TH5A 3NC0C 1XTRA 2ZEJA 4LC1A 3D6TB 4LJ7A 4BGDA 2FE4A 1A4RA 2WTUA 2CNWD 1KDRA 1Z6XA 4GI7A 3VR3A 3KKQA 2ORIA 4B48A 3VQTA 2GZHA 4R2IA 5C46F 3A1TA 3HP1A 3ZYCA 1ELOA 3RRYA 4QGFA 3SN6A 1T9HA 4PR0A 3VX4A 3FKSA 2UKDA 1GFIA 5G40A 3I61A 1C1YA 4A3VB 1EG7A 3QSYA 2XX3A 1CR1A 3OFNA 1N6LA 4FMCB 3RRZA 3ZVLA 4QBIA 5GJBA 3H4MA 2PH1A 3IIKA 3SOPA 2QQ0A 3QVVA 5B58C 3PEYA 4WVFA 121PA 3AVQA 4MRVA 1NIJA 2GEDA 3QXCA 4M1YA 4C3ZA 2Z5FA 4IDPA 4D4KA 2JJ8A 3UK6A 2JDID 2WPDA 1SQ5A 3CW2A 1XPUA 2IEYA 2GJAA 2AHOA 3B1WA 2ZRAA 2VSFA 3K8YA 4BEBA 4AI6A 5DH9A 3T34A 1N6NA 2AX4A 4XIGS 2GCNA 3C4JA 3WRXC 2ZRJA 3MWJA 5KTYA 1N6PA 1T8TA 2HV8A 3GLGE 3R8CA 1TF7A 4CIDA 2QN6A 3IO3A 1TTTA 3MCAA 1OB2A 4HAZA 4D0LB 5AWFC 1Q44A 4P33A 3VX3A 1S0UA 4DUGD 2O8EA 1C1KA 2DWQA 5EUMA 2ONKA 5FBLB 3AV0B 5KNBA 1SXJB 4RD4A 2NO1A 2QAGA 2AN9A 2WSSD 3N5CA 1X86B 1TEXA 2CJWA 3IBYA 4MGIR 4OKSA 1SVSA 4NKRA 2V8OA 5AJVB 3ICEA 3I92A 1K6MA 3B60A 3X1WA 4EJSA 5J4LA 2XGJA 2VLIA 2ZIAA 1ZJ6A 2D62A 3QIAA 1SVWA 3ADCA 1O87A 3S1AA 1ZNYA 2XOKA 4YONB 3TVDA 5LBIA 3K9HA 4Y0VA 3U3MA 4X8HA 3LX5A 2VPPA 4DDWA 1XP8A 3B5JA 4PPQA 2GCOB 2WMNB 5KSPA 2PMDA 2ZPTX 5HKKD 3QXXA 2QTVB 4XVRA 3PUYA 2GBLC 2DPXA 4JLPA 5BWMA 1W36C 1IBRA 2AD1A 1KNQA 1U2RA 3B2EA 1UBGA 1D6JA 3H86A 4DSOA 5CYPA 5SZJA 5JRZA 2R62A 2WHXA 3CB4A 2JLSA 1Z2CA 2DYKA 5DLQC 2GVDC 2RGDA 2HF8A 4HB4A 3CRRA 5FH9A 2FV8A 1UDWA 5KOYA 3B85A 2AK2A 4OYHA 2G0NA 1VMAA 2GHIA 4H1VA 3IEVA 2QSZA 4US1R 1SXJD 4LOAA 2NMVA 2Q3FA 3OE7D 3WBKA 4A15A 2OSBA 4MKIA 5J5CA 2C9OA 3WYFA 5FTKA 3BK7A 2FGJA 3DHWC 2BBWA 3F3YA 1TF5A 3REFA 2IYTA 3PITA 3QE0A 1OXSC 3BC1A 1ZBDA 1YKSA 2ZR0A 1YHNA 2WJJA 4A0GA 2Q3MA 3RANA 3CX6A 4DUGA 3BORA 3QENA 4FWGA 2ECKA 2ZI6A 1Z8FA 2QMOA 5HPYB 3PR1A 4RD6A 4P0TA 2IS1A 4JKIA 2ZJ8A 2WSSA 3ICQB 1JR6A 1Z6YA 1W2GA 4M8NE 2Q3HA 1X8KA 1XD8A 2QRZA 3SYKA 1X1SA 4BPBA 1UBFA 1JR3D 4Q47A 1W7AA 3PXGA 2O52A 4W9MC 5TY0A 2BHRA 1SVIA 4AYXA 1TNDA 2OLKA 2J87A 3IUYA 5KUTA 3SZRA 1KI8A 2ZRGA 4I81A 3PJRA 2G83A 1DAGA 1ZD8A 3WRYC 2RGBA 1NMYA 3ND8A 1YZUA 4IFEA 2B92A 3NHBA 2WV9A 4CT5A 1KK2A 1IXRC 1GNPA 1VHLA 4L4UA 1NVXQ 3KL4A 4LDJA 3KKNA 3W34A 1NKSA 5L3QB 3EZ6A 4TQAA 4KFUA 4C2TA 3VAAA 3SQWA 4KBFA 1XEWY 1TQDA 4OQNA 2FOLA 4A0RA 1HYQA 4AKHA 4AKGA 5FOTA 4EDHA 2OBLA 4P4TA 3A8TA 2O8CB 4D0GA 1F5NA 2ZS7A 5K8IA 2V6ZM 3AVXA 3P26A 2QSYA 1MT0A 2W6ID 4B35A 2KI5A 4US2R 1W5SA 3WYGA 3AVTA 3A36A 4Q7KA 2O5VA 1SXJA 1G3MA 4BFYA 4PSAA 3OE7A 4S2EA 2F55A 1T5IA 3PEVA 1N0UA 3FFBA 3SC3A 5HZKA 1PLKA 4YMSA 4XJXA 3AKYA 2C04A 1G6HA 4G5RA 4DT1B 1GRRA 3NBZC 3U3KA 1H65A 1YZQA 3A1SA 4LPSA 2OCYC 4H1UA 4HAVA 1GM5A 1VG0B 1WA5A 3I8SA 3VTKA 4ZI3A 3ZZ0A 4R71A 5FPHA 4JN6A 2VHTA 3MFYA 2IW3A 2EWWA 2ZROA 3LQQA 1P61B 5FI1B 4AKEA 2J0VA 1YR9A 3TGPA 2H17A 2ZJZA 3THXA 3DOEA 5JI2E 3MHVC 2WWWA 1JR3A 1AK2A 1G7TA 2B21A 1OXUA 1HQYE 4MA4A 3TUIC 4UNSA 1LY1A 4L9WA 4Y0AA 1Z0JA 2IYSA 5J47A 1N5KA 1WB9A 2YC4C 4TL6A 2BM0A 2PLRA 2OFOA 2ZRMA 5L8VA 2XXAB 2QPTA 3T61A 4YDSA 2FFAA 2ZITA 4LHWA 5J4YA 1HEIA 1E1RD 4IEEA 1XF9A 2IYZA 4F4IA 8OHMA 2HDNB 3CX7A 4Q7LA 3C41J 4QFMA 4M21A 2WWIA 3CNNA 3NXSA 4GP6A 5B2ZA 3WNDA 2QE7A 2GRJA 3DMDA 1GRQA 1KZGB 3T12A 4YMUA 2IF2A 3EZ7A 4HYYA 4WXPA 1Z83A 5FOUA 2OXRA 4GZLA 4RJLA 2W6IA 2YOFA 3ND9A 2ZVQX 4GP7A 1Z63A 4BZXA 1Z0DA 2OUKA 3QKSB 4IXNA 5BN4A 1G7RA 4RY2A 1U9IC 3LW8A 3AKEA 1S8FA 4BFZA 3QF4B 3WP1B 5KPJA 1CEEA 1OLOA 2QP9X 3EARA 3W8NA 4M1WA 3WHKA 1E9DA 1S3SA 1E94E 3V00A 2O8FB 4BRUA 4E09A 1W4RA 1RYHA 1XTIA 4PPGA 5FPKA 4I1UA 3DKPA 4A6XA 3PEUA 1FNMA 2V54A 3GFOA 4PTLA 2P6NA 5GVRA 2JATA 3B13B 1CRQA 1P7CA 1YVDA 3W90A 2CCGA 3OEED 3IILA 4AYTA 2A5DA 3TE6A 2VP4A 2R6GA 1QHHB 1G7CA 4G01B 1RPZA 4MKGA 4D81A 2P5TB 4PQYA 3LDAA 3GLIE 1RRPA 3PUWA 2QP4A 2GILA 1G8FA 4CW7A 2FPMA 2NPFA 4Q4LA 5D3QA 1Z0KA 3PENA 2QL6A 1U81A 3PUXA 2ERYA 2AR7A 2WJIA 3QEOA 1IJEA 4XD7D 4B3CA 1IN4A 2HLDA 2WWFA 1N5JA 3BH7A 4HAYA 3MUFA 1E1RA 4MKFA 1YZTA 3IHWA 1Z6AA 4M0LA 4IVRA 4DLUA 2W0SA 3V4FA 2CLDX 5KSYA 5E7MA 1OHHD 2RGEA 4D80A 3HPQA 1Q3TA 4B2LA 4KYUA 2J0UA 2G88A 1T91A 4OQFA 4B33A 4G5GA 4TLEA 1GKUB 5EE3A 1HTWA 1HE8B 1PJRA 1KAOA 3F5FA 3O8CA 4M2LA 1AIPA 3SJCA 3KFVA 4RD1A 3PCRB 1FUUA 3QUSA 2IUTA 2BIFA 4B71A 2DY1A 3ZH9B 5KDDA 4D2IA 3A1WA 2NOAA 1A7JA 2YV5A 3K70C 1N6HA 3ZS8A 1VCNA 2WWHA 4Q1BA 1NG9A 2VP2A 3TRFA 4G0NA 4TWZA 2QA5A 2ZRPA 2J0SA 4ASUD 4EPTA 4N0DA 1XXHE 1IQPA 1KDPA 2Y8EA 3ASYA 5AJXA 2I4IA 5G53C 5BN5A 4C7OB 3LH5A 3QKRB 3C15C 3IHLA 4JMPA 1BH2A 2ZS9A 4JLNA 3C5HA 4LJ6A 2XSZD 2DVWB 3BAFA 2XXAA 3K0CC 4EPYA 3LLMA 1KK0A 3LRPA 2D4HA 3OEEA 2GEUA 2P0EA 1EGAA 3R9XA 2ZANA 3G5UA 3QNUA 2WJYA 2ZJ2A 4HSEA 1IY0A 2C99A 1E0JA 2D3WA 4JLMA 3UWKA 2JLVA 4M1KA 1QHNA 3IO5A
chains in the Genus database with same CATH superfamily
4OUKX 3QA3E 3RSHA 4J7UA 3JQQA 2EBUA 4XD7A 5EUBA 4NMHA 1KFEB 3QE9Y 3WLMA 3T5DA 3F8TA 4XJVA 4IX9A 3NR2A 5KNDD 4RIHA 1AF4A 4DMGA 3L4EA 4DNPA 2DM6A 2PUAA 2TECE 1EDDA 5JHGB 1E62A 5EZYB 1BS1A 3GJ8A 2ZPUA 5EPEA 1CZUA 1GVHA 2DQZA 4OHPA 3WK9A 2Z8YM 4ZZ0A 5BR4A 3WGNA 4DIUA 1UT8A 3OE4A 3WP0A 3ONFA 1T3ZA 2R8BA 1AN0A 4PS1A 3ZX5A 4D6YA 2GM5A 2H29A 2H3EA 5IAAA 2Z7JA 4ATNA 2Y1GA 2PIAA 5E9JA 4M9ZA 4J2TA 2Z30A 2Q4BA 3TB6A 4B0PA 3LGAA 4UM9B 4LHYA 3T1YB 3O4VA 4O4HA 2ZFUA 3LI2A 1CY0A 1QZUA 4ND8A 4LJ4A 5KVVA 4QGGA 5B1HA 2XLCA 1B7GO 5DOVA 1WHCA 5K7SA 4AM8A 3I3SR 1Q6YA 2CLIB 1JDZA 4MUNA 4K3VA 1Z73A 5H4HA 2GPTA 4IJKA 3C3PA 1GCUA 1JDBC 1HSZA 3HSSA 1FJGM 3EGCA 2VZEA 5F9MA 1OI2A 3A3PA 2ZSBA 4BLVA 1UIMA 1JEQB 2IP1A 1VDLA 1KZ9A 3TQTA 3T3PB 4QTTB 2ZCUA 1JJVA 4G4GA 3L07A 3T1NA 2IEIA 4NNJA 5KTRA 2D5CA 1TECE 3HRKA 3LOPA 3P9YA 2GYYA 5ADWA 1HFWA 1EQUA 1HBJA 2I65A 5KJEA 1Z35A 4Y1FA 1VIMA 3C7TA 5A2QA 2JFVA 1PNTA 1KA9H 2PBLA 3JAWA 2O3QA 4DGQA 5KQMA 2BTQB 2NX2A 2PO7A 2DFNA 1EWVA 3DOCA 4F86A 2YJ6A 1MXFA 3HZRA 3PSHA 2DKFA 2E4YA 5IH7A 4Z4EA 1ULZA 3H8VA 1G0NA 4N6GA 4L8LA 3A3KA 5T4FA 1X9IA 4UATA 3URKA 4MW9A 2O0MA 3G79A 4C4XA 3F90A 4AJOA 1PTJA 1DQRA 1M1YE 3T7SA 1JXOA 4KOEC 1N32B 3EZ9A 4DIFA 3ZDRA 3PF8A 2GXAA 1AKYA 4AWXA 2VO1A 3DDUA 5ISMA 5THXA 3V48A 3EA5A 1IOWA 3TZEA 3WNVA 2IHKA 2PCLA 1IN5A 1RRCA 3VDQA 1Q0PA 1X2EA 2GPNA 3LY5A 5JSYA 2DFTA 4NQRA 2J3QA 3THXB 1O95A 4WBNF 2PUEA 1H5QA 3K6SA 5KCZA 2VT3A 3MBIA 1YASA 1OB5A 3D7MA 4IBKA 1IXKA 2VTBA 3T6PA 2CNOA 1K06A 2C9BA 3GZ4A 4DA4A 3EG9B 3TK1A 4I4LA 2PNFA 2JRLA 4H17A 1O8CA 4JBWA 4IJVA 2C2HA 2IPMA 3ID6C 3RR2A 1DTSA 2KBFA 4LK2A 1PWEA 4AZ0B 1GAXA 2Q50A 3BG5A 1W46A 4JBXA 4QBGB 1K97A 3DM5A 5ES3A 2XYHA 1TZKA 1U94A 2I6FA 4NCAA 5JMPA 1WDKA 3UHPA 3V80A 5A3RA 7CATA 3TS1A 3GELA 3S40A 1VBMA 1WPXA 3FPEA 5T6BA 3V1YA 3PVSA 1OVGA 3BT7A 4B83A 2B4AA 5EIBC 2W83A 1NXOA 3VAZA 2X14A 3WQSB 3OZAA 4JLVA 2OPHA 2FAXA 3DMYA 2BFBB 5MHTA 5IAJA 3K0AA 5FOSA 1Z37A 2IKQA 5PNTA 4DNFA 5EZQA 2JAPA 3S2ZA 1NLMA 3HL4A 3HXOA 4FWIB 4B0OA 3C1AA 3EEBA 2C00A 3HC7A 1SIUA 5EXTA 2EX4A 5DBHX 1V3QE 3ZHBA 2EJVA 3KVYA 2BDTA 2NAPA 3T5PA 3OCZA 3C2QA 3TRJA 3GDFA 1NY6A 2D3TA 2EDAA 2DR3A 2WLSA 5FOWA 1IQ0A 1NRIA 5JQWA 2GLTA 1RMYA 3AYZB 1ZIPA 1WS6A 5AHOA 5A7FA 4U3JA 2MCFA 5AOBA 1KVQA 3JXEA 3P71T 3OTIA 3BJRA 3L6RA 2QHXA 4ZIRB 2FZ4A 5JD5A 3FE3A 3HXTA 1K2WA 3N87A 1PDOA 2P9JA 1HETA 1ZV1A 1TTEA 4FR0A 3OIDA 1EFDN 1T3HA 1EFRD 2ZT7A 2C4UA 1UPFA 5FNVB 1EU1A 1CJBA 4ZEVA 1MNAA 2HMSA 4IIJA 3RVJA 3U7EB 2E4XA 5EINA 3UWPA 3B1ZA 2FG5A 2HTFA 3EUEA 3NPAA 2FR8C 3LVRE 4M86A 1BCSB 3QVKA 4UULA 4ECAA 5CDYA 1VRVA 3LFTA 3NETA 1P17A 1S4MA 4NYIQ 4AP5A 4W4TA 1ZU4A 4CDRA 2JZ0A 3O7WA 2FOXA 5CW2A 2OY0A 1J33A 5JU6A 1T6OA 4XOUA 1BROA 4UDNA 4QOEA 3ZWKA 3LECA 4ZARA 3A06A 1T2FA 3VOTA 3P32A 2YWBA 5ESXA 4CKEB 1SCUB 4DCTA 1CUHA 4RTPA 3ASZA 1PGNA 1U0OC 1YR3A 2W71A 3LOQA 4LTMA 4ZT3A 4R9UC 3PLNA 1ENZA 4LDNA 1KQFA 1P3JA 5BV2P 1TA4A 4PG4A 3H9CA 4CTNA 3LZ6A 5K0FA 2WFAA 2DCMA 1XCPA 1B6GA 1XYYA 4G5QA 2VP6A 1P1FA 2NACA 3QITA 2QCUA 1T2CA 4WK2B 4NARA 5LC1A 1YDGA 2A84A 1REQB 3KYBA 3IG8A 2FUCA 4TXNA 3MLBA 3ES5A 1RJ9A 2I4NA 5TX7A 1BMDA 3JAKB 1SVMA 1WPGA 2H0RA 3E7XA 3FPKA 4XVUA 4X54A 5AI0A 1UOPA 2B82A 2F1HA 1BX3A 1OWNA 4WKGA 3JYHA 5L53A 1KH2A 3UBTA 5ALNA 3KJFA 1XA0A 1WD5A 3WKEA 3RBZA 1R5NA 1KQPA 3OM9A 4CE6A 2V6BA 1XEXA 3ETNA 3F8SA 1P5ZB 1S2DA 1H9BA 4MV5A 4QDXA 1NFQA 5HCNA 1IK6A 1LNSA 1GV0A 3B7QA 2VH5R 4AZVA 3HNOA 2QGFA 1EA5A 5KKCA 4MCJA 5BQ5A 3HCPA 2J7PD 1Q0ZA 1VG5A 1E92A 5KYWA 2WJVA 4TM7A 5GTDA 5ALHA 4OMFG 3L0PA 3QX3A 2OMKA 4BVAA 2QRMA 3JD1A 2CCJA 3O3CA 5ESWA 4IJFA 1O94A 1E0KA 4UQOA 2OBBA 4EMUA 1OR8A 3GFGA 2Q6KA 4YJKA 2P78A 2QM0A 1WUYA 2IK8A 1E1YA 4ZVKA 1P2SA 2VTVA 4J07A 4CM9A 1RYDA 2A0YA 1T9GR 1PYDA 3AOGA 3IVGA 4XGIA 2B1RA 1SIWA 3SMPA 3FF4A 5JSZB 3RS7A 4Q9JA 1I1QB 1LW6E 1RYFA 1O5IA 4OUDA 1U11A 3UHOA 2QD3A 3HACA 3IT2A 1JI0A 1NN0A 4OL9A 4EI9A 1RRFA 2ERXA 4LHEA 2GZ2A 3O8OA 1H4VB 4BX0A 3OWOA 3EPKA 2XCOA 4IHAA 4YRCA 4ZVPA 4HEA1 1DEXA 5HA5A 5FLXS 1NJ5A 2JZ1A 4IG4A 4MGYR 3ROFA 1J25A 4IGIA 3IUQA 1VFPA 3UMSA 3UB4A 4I5IA 1UP6A 1CUAA 2COUA 3PT9A 3UV3A 3RWOA 2ZUCA 2BMDA 2XE8A 3DTVA 3LW5F 1KY3A 4G4SO 1K6JA 1Z36A 3HDHA 1E2NA 4LMRA 3PSAA 1CRZA 2ODTX 1FNDA 1VSUA 8LDHA 2C82A 2EIXA 2P5UA 1HYGA 1RM4A 1IEWA 1MQ9A 3BMNA 3S2YA 4QNMA 1PO7A 1Z5WA 1T0UA 4OJKA 2VAVA 2XWJI 3HN2A 1VP9A 5G0UA 3EXEB 4M22A 3Q9LA 2JIZD 2F4NA 1SUFA 4MVJM 4PC6A 4JFAA 4R2HA 2L6OA 3IE0A 4ZN6A 5AQ1A 1ZK4A 3UPTA 2EKDA 1U0FA 3GJRA 5BWNA 1XWIA 2H9YA 1UBMS 4AD8A 1O5TA 3KJNA 1NSYA 1JFTA 4UUNA 3UAWA 4V0MA 2X23A 3NJ8A 4POOA 3GT3A 1UANA 5DHPA 5E1BA 1L2TA 3T0IA 2JLYA 4O8CA 5IKXA 2VOJA 3WADA 3LOUA 4WK6A 2EV9A 3B7ZA 2O1XA 4CDNA 3H9QA 4YRJA 5CFOA 1N2CA 4JJZA 4B74A 4ENTA 1VLVA 4GBGA 4BZWA 3GG9A 1XN4A 1CIJA 3C7KA 1J9ZA 1IM8A 1Q1NA 2XMGA 2H1FA 1V9SA 4B4VA 4HJRA 3GOQA 4QVGA 3HO6A 2IOQA 1PGYA 1E1QD 4P86A 3PVZA 3NT5A 3PEEA 4DR2B 4X97A 1UFZA 4AMZA 3E7DA 4OGGA 4LA4A 4ZDIA 2MSEB 5GKNA 1AA6A 5KO3A 1KS2A 5KNLA 2QN1A 2G63A 1MW9X 3EQ7A 3QSGA 3HHEA 2DAIA 5A9SA 2CJXA 4DR4B 2MTBA 1Y6GA 3OLZA 3C85A 2NU9A 4CV0A 2KHZA 4QOZC 5DSTA 4RTJA 2B37A 4EY7A 1U0GA 1EJBA 4CT4B 4NFYA 1X1TA 3AW8A 3K9PA 3KAPA 1NJFA 1ZXBA 4AECA 3SATA 1YAJA 1KMNA 2R0IA 3FMIA 2V0NA 3HDYA 5FL7D 3U3DA 2WT9A 2IY9A 1A2QA 3L1VA 4NMXB 4XH9B 1NNI1 1U5BB 4Z9AA 3GMDA 2LRHA 3CUTA 5KO2A 1NU8A 5CB8A 3B6IA 3NAZA 4B75A 2HWXA 1AO0A 4S04A 5LQNA 1C9YA 1JDTA 2ZRNA 5C2JB 4BUZA 1MEJA 5ENVA 2BGGA 2G4VA 2GX6A 1NP7A 2Y6VA 1OHHA 4WOJA 1X1EA 1R5OA 4UMFA 1D7OA 5CIWA 2DETA 1N5OX 1XNRB 4Y6SA 4DMHA 1OAKA 4N6NA 4OOEA 3LMMA 1XJWA 2ZKIA 2GNPA 5DNYB 4UBLA 4UCQA 3OZTA 1RC1A 4F4CA 4WX2B 2YICA 3LPMA 3T1OA 2QAGC 1C4WA 1KO5A 2B4QA 4HH3C 2B1IA 2IITA 1H94A 2Q2WA 1X7ZA 1FP4B 1TXGA 3ZYZA 3E2MA 4HNVA 2PD4A 4AC9A 3W68A 16PKA 3UTDA 5KYXA 3U6LA 1Z0AA 3FGNA 4NHEA 5TARA 3TLCA 3BE4A 3QVSA 2GZ1A 3OT5A 1T9BA 3ONWA 2FPIA 1LLFA 1KU6A 4YH1A 2DE0X 1XAJA 1TRKA 1L4UA 4FOOA 4QGBA 1VPVA 1AUVA 1Y1LA 3HG7A 3UAZA 1KWGA 2IHBA 4JSTA 2JLQA 4FFLA 1Q2XA 3PUZA 1TU0A 3ASUA 3GJZA 5FUWA 4OJYA 3JWJA 5CTAA 4QXQA 1KIFA 3QEKA 4C7KA 3FKSD 3Q85A 3U5TA 4C4PA 4BNIA 3DWFA 3GZNB 4FGWA 2IBTA 1UWCA 1PVDA 4FFNA 2RB4A 4X84A 3R7WA 1C7RA 3PD7A 4PSKA 1A5TA 4GZMA 2R6HA 1VB5A 7ADHA 3GLFA 3QWHA 3MD0A 3T3EA 1DS6A 4BB0A 3PE4A 2Q3CA 3DE6X 2VHXA 4UAUA 2HWUA 4BGDA 1Q1GA 4C21A 2VUIB 1N77A 2DUJA 5EC8A 4DQXA 2PXHA 2R1UA 1MOQA 1C1YA 3OPNA 3L5OA 4FJ1A 5BUSA 2PZLA 4MRVA 5IEBA 2B3TA 2Y92A 3SZLA 2GJAA 3B1WA 3NB0A 2X6QA 1J8VA 4QWWA 5KTYA 5BSKA 3FUTA 2XVMA 2P79A 5E6SA 4F5YA 1GXSA 1V47A 3G2OA 5EUMA 1W9MA 3OF2A 3AV0B 1BFDA 1CJSA 1L4EA 3O6VA 1UDBA 4B4OA 1SVSA 4NKRA 3MN1A 2KLBA 1JNXX 3K9HA 3O4JA 2A0WA 2HD4A 4AMUA 5IFKA 2XV1A 1W36C 3TL2A 4F96A 3UO8B 3EXIA 2WHXA 1Z2CA 4EY5A 1NE7A 4ZI5A 2GVDC 2YWXA 3SICE 1QOPB 1L1FA 4X65M 3GG2A 5IJWA 1J4AA 4LDRA 3BWCA 3VYVA 2C9OA 3F3YA 1GDHA 1VJDA 4BVHA 1V8OA 4XPIA 3CEPB 1P81A 2DMRA 3G8YA 4PFKA 4IV0A 4LZJA 4QU5A 3BVPA 3SZRA 2NTVA 4I81A 3PJRA 4CBVA 3LZDA 2QTNA 1L4FA 5JV5A 1VHLA 1QQWA 2K6GA 2HAKA 3IUSA 2X3FA 4XJTA 3TW0A 1XHEA 3K16A 4K26A 1IQUA 1JG3A 2RI0A 2APJA 4HDRB 4BS9A 2OB1A 2M6KA 3GRYA 1N0UA 4YCCA 3H99A 2C04A 4E13A 4GEKA 5ARBA 4M76B 3JQ9C 5IWCA 5EQDA 4AJLA 3NVMB 4ZI3A 1L7PA 2SNIE 3S8MA 2X13A 3LQQA 2J0VA 3L92A 3IIEA 3HBAA 2Y4NA 4HQRA 1N5KA 2RBEA 2QPTA 4BVEA 3LRXA 4P9NA 4KQ9A 1E1RD 4R8KA 1Z6QA 4ME6A 1ILWA 2O2JA 2BL4A 4F3RA 3GZTB 3NTLA 4IV5A 1QCDA 2HREA 2JY6B 2FLWA 1UMBA 3GRKA 4AROA 3LIIA 4G5YA 4DV0B 4X00A 4OFBA 5IT9A 1W4RA 4P3OA 4Y2GA 2AVDA 2W8BB 3B13B 3ZDFA 1R37A 1GQFA 4CQJA 2R00A 1RPZA 4NVRA 2R68A 3N1UA 3AT1A 2BAGA 1HGXA 3TZKA 2WJIA 3RVNA 2D7JA 4UAJA 4WFIA 5LMNM 1OI7A 3FPSA 2LV8A 3AJAA 1Q3TA 5C7OO 1KAOA 4M2LA 1JQKA 3KFVA 3MPOA 4CV3A 4K1LA 4N54A 4C6RA 3WDMA 3R3WA 3JYOA 5AW6A 3RJZA 4AS2A 1GTMA 1OC2A 1ZIYA 5IS2A 3DD5A 3PEFA 2ZSIA 1Z0SA 1Y9DA 1EGAA 3HRHA 3G5UA 4OHVA 2W2LD 4YBRA 4KZPA 4TSFA 2I6QA 4ISBA 1F6DA 1K5GA 3BXPA 3WNCA 1MAHA 1NATA 4N0QA 3WRYA 1PK9A 1GU1A 4YRDA 3JTEA 1AKRA 3VDPA 4HG2A 1OASA 1Y3IA 1GPDG 3KB6A 4J4HA 4LHVA 3KHUA 1XTVA 4MVYA 2HJ9A 1R74A 2KDLA 1FFEA 4PXSA 2X0EA 1ZK1A 3KUCA 1Q77A 2EQ5A 4OMDA 2KNVA 1NP6A 3I1JA 3Q72A 1FFAA 2O06A 4HOYA 5FUXA 5HBRA 3AONB 4YWJA 3L4BA 1VEJA 4MIEA 2DKNA 4QDUA 5G0VA 5CT5A 3WXBA 2P68A 3ZJYA 3P8ZA 3BXEA 3IOBA 4ZT4A 2F48A 4NSRA 3W6PA 1XMQB 2PD3A 2ZBEA 1CBUA 4RZSA 5DE3A 3LXXA 5CB4F 2AEFA 2JZCA 1DKQA 4NS1A 1U9IA 1E9SA 3IIMA 4LI0A 1A9TA 3X43A 1N0WA 1C9JA 1N25A 2WKPA 1GN9A 2C3UA 4H7HA 4CQMD 4OJQA 221PA 2NSJA 4E5MA 1SBNE 1YRBA 2DHRA 3FRIA 4UNNA 3I30X 2GBPA 3KUKA 4LAFA 3TE7A 2VYVA 3O38A 3RLIA 2H1RA 1LW7A 3C4QA 3WIOA 1LQ2A 3GCXA 3TR6A 1YUNA 4IDEA 3ST7A 1FMFA 5GY7A 4TVBA 4AO7A 2X9LA 4LVOA 4X8OA 3DHVA 3FAZA 3UA3A 1IBSA 3NOXA 1XE3A 4IDBA 3OPQA 1L1RA 1G16A 5IAEA 4X60A 3DBOB 5EXDA 4JEHA 5KNBD 4RGBA 5FT9A 2PMWB 2Z57A 3OOHA 5H5JA 3W78A 1MAAA 4CQLB 4RZXA 2YS7A 4B3MM 2P67A 2LW7A 2Y0DA 3DC2A 1P4GA 3IP8A 4G41A 1WCXA 5KI6A 3K9NA 4J0QA 3NP9A 5T8KA 1M6EX 2EZUA 2BGWA 3A2KA 4QPDA 3HM9A 2GDZA 4NYJR 1FVOA 3DZGA 2ODAA 1CUBA 2OFWA 4LVUA 2VK4A 1TUEA 2X40A 2CYAA 2ASVA 2WSFF 4GR9A 3LPLA 2D6FA 4F97A 1P0PA 3E1GA 1V7ZA 1KAHA 2QNBA 3COVA 2PWPA 3I2IA 4YCNA 3PV0A 4X7MA 3JD2A 1EX7A 4OA8A 3NLLA 4WE3A 1SBCA 4XE5A 1XTBA 3CVWA 1QYWA 4NDZA 3BHMA 5HS6A 4G9BA 3JAMS 3DDOA 1LTQA 3WTCA 2WF7A 5JH7A 1NDUA 3QX7A 2QU8A 3P4UA 2W4IA 1GR1A 2B8WA 4M9UA 3LUDA 3NX4A 1Q16A 1G3RA 2XT9A 3KWMA 4F9TA 2G09A 2O4UX 4CODB 5CVDA 1NM5C 4ZKDA 2VUSA 3T0FA 4XFKA 2FF7A 3WMRA 4QHSA 1X3SA 5LNK6 4QLAA 4YMGA 1Z47A 3RTBA 1E89A 4GP9A 5HIJA 4ZT6A 5HIIA 4S05A 3WIDA 5D85A 4A2QA 3U3ZA 2VUHB 1UBUS 2Z2XA 2O7NA 5DCUA 1N1MA 4BEJA 1UC8A 3DDZX 1GPAA 2ZLBA 1WUHS 1QGUB 1OAAA 3EQZA 2QD4A 3W77A 2HV9A 2G0AA 1C1XA 4BNUA 5HKLA 2VP9A 3C45A 3RS5A 1NJGA 1W35A 2QUIA 2ZT6A 5JNSA 3NT2A 1CTQA 1GUZA 4HNTA 1XTPA 2ZRCA 4EH1A 1EESA 3E8MA 2CVZA 3DBLA 5DTRA 1XB2A 3BERA 2QTAA 1G18A 3CYFA 3W0FA 3N05A 3AFOA 3RKUA 3LDUA 1IIBA 3OCYA 1HTTA 2X8AA 2O3RA 2VXYA 5C35A 2C61A 3BXHA 1IHOA 4HQFA 4I9GA 4QO8A 1DIHA 2YFYA 3IEPA 5BW5A 1HMYA 1P9RA 3PFHA 3CLUD 4OLHA 4HEJA 1UZUA 4FT4A 3AL0C 3ZCVA 4LOHA 3F3MA 3N75A 4CMBA 4TN5A 2EJBA 3MTBA 4IVNA 4E4TA 1QIIA 1FPMA 2XB4A 2XNCA 1WGLA 3HM2A 4OW0A 3CXRA 1NL3A 1W5TA 4P3PA 1GZVA 4EP1A 1X7DA 1NZFA 5TS2A 3RSOA 3EDRA 3KT3A 2YN0A 4CEHA 4D3XA 4U2KA 4NXNB 4BDSA 1JEEA 4M1SA 3B8HA 4YCDA 4REZA 5LVAA 3CCFA 3BZWA 3JQBC 5FLYA 4RM3A 1EHIA 2CNDA 3JVVA 3AU8A 2PUJA 1NQTA 3O1LA 1A1VA 3QPDA 4HH1A 3KD2A 1YBHA 1DXOA 4BO4A 3HLYA 4X94A 3NWBA 3AZPA 2R6CA 1KO4A 2RSLA 4JUBA 3DNMA 1ZA1A 5M7EA 3EWNA 4D8TA 1U2DA 1X7WA 3CQ9A 4LOKA 4DV5M 5ALQA 3WGIA 3GEEA 3AHJA 5H1YA 3DVAA 3W7AA 1WV0A 4NI5A 1L5NA 1JIQA 1SBTA 3GY0A 5LA6F 1GGEA 2P62A 2FPXA 4QYSA 3I6IA 1L8AA 5IUKC 1N5RA 1QQ5A 4B5KA 1SC1A 2K7ZA 3NOVA 4K9DA 3AERB 3CGGA 3QW2A 3M6FA 3SMSA 4KODA 2GEFA 3D43A 4LSMA 4ITQA 1B8VA 4J16C 3K8ZA 3FUWA 4MUIA 4YMLA 5REQA 4WDQA 1QCZA 2CHVA 1ZD3A 3GFBA 3MGCA 1QCCA 3FNEA 4F11A 3TSZA 3K0EA 3WLLA 1W19A 2CLKB 2UUBM 3ZX4A 2WQ6A 4R3UC 1RABA 1C1HA 5FWYA 1GCIA 3OAAA 3H7AA 1N9ZA 1I4TD 4LZZA 3FWZA 5FPTA 5KOHA 3ERCA 4J03A 3EFOA 4JIGA 3PCXA 2OWEA 4HO1X 2YINC 4HZUB 4FGLA 1PFGA 5IM4F 2VCYA 4AP6A 5TPWA 1H66A 4MTCA 3PA8A 3ZUPA 3X1DA 5KTTA 4BKMA 1EGHA 4MUAA 4N39A 5TB5A 2YDXA 2BCJQ 3CSUA 5H02A 2XBLA 2OXTA 1PBTA 5K4GA 3UAXA 4PAOA 3FNIA 3G9ZA 3AIMA 3IULA 1Y63A 1RXIA 1ADBA 1MOZA 2GD2A 3WLEA 3L7NA 2HMWA 3RS4A 3OOWA 3HJUA 1W0KA 2A14A 1N2BA 1VSVA 4H15A 2VWGA 2FHPA 3I5XA 4AUKA 2QENA 4ENUA 3TINA 1PWZA 2H5XA 1Z3IX 2JBAA 2HWYA 4B2IA 5FBQB 2NO7A 3HBNA 2YY5A 2IOHA 4X7RA 5IKPA 4FT2A 5BVHA 1P1RA 4B6PA 4KRYA 3ILKA 4Y9TA 2WAAA 1SKAA 4MP6A 1AC5A 2H52A 3ELUA 3EPHA 5E26A 4I9FA 2WB2A 3LPCA 2LD4A 3HPRA 1TM7E 4QWMA 2LE0A 2BPOA 2IV3A 1T1JA 1KMIY 5IPFA 2PDAA 2YZ2A 4D45A 4ZCMA 1C7YA 2Y1DA 3BFKA 2YUIA 4KSBA 4C4TA 3CW9A 5ITXE 4R7ZA 5CXUA 3U37A 2A1IA 3SPXA 2RH8A 3S6JA 4P3YA 2FPPA 7MDHA 3LU1A 4DOMA 1AKMA 1GYRA 2BOVA 2HIGA 1QF6A 4D9BA 3GDWA 3G5TA 1SB9A 1V7CA 5FUBA 1T8YA 4YJ2A 1M2FA 4AUEA 5KIAA 2Q4EA 3I9KA 3FCXA 3CA8A 2N35A 1OH8A 4R1UA 3AFIA 5H3CA 2QX8A 5IJZA 2BLNA 3I2YX 4F2PA 3KJIA 3U49A 2GR9A 4EHKA 1D1TA 1KZ1A 4LG2A 3N0WA 3AHGA 5DW0A 3GEBA 4FGJA 3PFFA 3NHJA 1HZJA 4QJBA 3L9WA 1E58A 3ED1A 2J4FA 1Y7TA 1MGOA 2X2PA 4EFNA 4UE6A 3DW1X 4OQDA 5B7QA 4H7EA 3VPBA 3IKTA 3CM0A 1MVOA 2OD7A 2GPYA 2DQSA 2O6LA 5DB4A 1XDUA 2GBIA 3W2HA 1NXVA 4XRGA 4A10A 4FNMA 2V4MA 2XW6A 4ETIA 3GWGA 2XUKA 3T35A 1OIPA 3PWTA 3R9WA 2HQOA 1XRNA 4LOIA 1S01A 5ANRB 3AP1A 4HGPA 4OO3A 3MTDA 2AUMA 1YSCA 1B3BA 1DRKA 2L2QA 3SJZA 4WKCA 1GNRA 4BNTA 2A9QA 3H1TA 1KQGA 2EJUA 2R3SA 5FWAA 5KOJB 4GMGA 2J7NA 1MR3F 1JL3A 4NCBA 1PQUA 1TA9A 1K88A 2ZTSA 5BUQA 1TK2A 2ZBQA 4MP8A 4MGYE 2EGUA 5G1NA 3KKOA 5TVKA 2NO6A 2GZDA 5G3YA 3VNUA 1DC3A 1W4LA 5KTKA 1OFVA 1PGOA 3SBOA 3CWQA 3NTXA 4O3MA 3HDTA 4LOJA 1KBOA 4JB8A 3L7DA 4DLVA 3V8QA 3IR6A 4H3SA 2D4AA 2OV3A 1XPRA 2VF5X 3KQVA 4X3OA 2WMYA 4R1QA 2ZBPA 1XEFA 4FC6A 3OOYA 4BLQA 3NH6A 1JEYA 5CH8A 1KRHA 4PG8A 2CKMA 1J00A 2GM4A 4GHAA 1MVNA 1ZGJA 3U3OA 2PJUA 2PAAA 1DC6A 1BWPA 2F9LA 2EBFX 1TQ4A 4DR3M 4JVSB 3VPSA 4DDKA 1U6KA 2WU8A 1VZ3A 4Z1OA 5JPCA 2IHNA 2BEUB 3BF7A 4WXYB 4A2PA 4B09A 2NNWB 2WW8A 4F6CA 2AFHB 3T9AA 5KTSA 3AIOA 2GZRA 3KJZA 3ZWWA 4JLSA 4UFPA 1ZBQA 4XLLA 1X7XB 5FBHA 2NXNA 1XMSA 4WEQA 1UEIA 3FI0A 3X1KA 3S55A 4ARIA 3BD7A 4HKTA 2WT8A 2FRDA 4IQFA 5KCMA 5JG7A 4UPVA 3E3AA 3KZVA 4YDQA 2OZVA 1I4LD 3LK7A 5TVGA 3QM1A 3QXJA 1HDZA 2BE9A 3CO0S 4AMVA 1DOHA 1LLQA 3JYLA 3O1HB 2IDJA 4Z7JA 4MGZE 4RLFA 2D0IA 5CITA 4WKPA 4DYDA 3AZQA 1XZLA 4LBVA 3PUHA 4KDEA 2PUFA 2P8JA 4P0PB 4N03A 4ZVQA 3QRWA 2H65A 4J90A 2Q7DA 1FJ2A 3NWPA 4GEWA 1CJTC 3GUHA 1GUYA 2FZWA 2O20A 1BJTA 5FL3A 2IH2A 3WL5A 2J9FA 2Q6OA 3AFNA 4FHDA 3WVNA 2V7TA 4ZWNA 1OYOA 1E9BA 1N7JA 3ICPA 1JDUA 4JCCA 1L6RA 1BOFA 2QTGA 2EZ9A 4AKIA 3GCDA 1EM8A 4QBFA 2WPNA 4JR2A 3K73O 2C1ZA 1Y8QA 2FZKA 3E82A 1ESMA 3U4CA 2GVNA 3GB9A 1US8B 3ZIAA 4PQEA 2P4HX 3GMSA 3ADOA 4G1EB 3I2FA 2CFOA 4Y7CA 3OCWA 3CX8A 1CYEA 4UUAA 4EYGA 1T43A 3AKZA 3FHOA 3GJ4A 3PXUA 4H3HB 5TEVA 4NBTA 1UK8A 2UXDM 3TIIA 2H92A 4YLEA 1Z0IA 3DZ8A 4X1YA 5HP4A 4QARA 1PEDA 1JVNA 2ZVPX 1J5XA 4AICA 1MV5A 2ZETA 3A37A 1X8JA 1K4YA 2PSJA 3RV3A 1RKXA 1K89A 5H80A 4K88A 5DHSA 3SAJA 1G63A 2PLFA 5CDGA 3CNLA 4IDCA 3STHA 3L0YA 1V8ZA 3VR4D 5CH3A 4WCFA 2HBZA 4GHLA 4KWHA 4N5LA 1UUFA 1NTRA 4O2AA 1VKZA 2IRWA 5TS3A 4D5GA 2R9GA 3BRCA 4QNRA 2OAGA 1OLSB 3AB3A 1ISHA 2JIBA 4OQZA 3E9DA 2ZEJA 4OB6A 3KKQA 1WUKS 1KIAA 2V4UA 1LPOA 3R1IA 1NC3A 1ZH2A 3LS2A 3EH1A 3HS3A 3AVQA 3QXCA 4NWIA 4ZVLA 3UK6A 2JDID 4EHHA 3NNDA 4DLNA 2ZTMA 3BTSA 3K8YA 4L7QA 1NOKA 4BXOA 1L7QA 4CM4B 3WRXC 4HSGA 4KN6A 1RYMA 1ZQ9A 4P33A 1K6IA 3HHZA 4H4CA 4BBPA 3J7TA 2V8OA 2XGJA 3CLSC 4E2XA 5I45A 1O87A 3ZR4B 1RYBA 2F8MA 3NIDB 1H3FA 3R0JA 3QXXA 1DWQA 3FYUC 4BNKA 1XMOM 4O4LA 4D3DA 4Q3NA 4ID3A 4QLOA 2JLSA 2HF8A 4TKMA 2FV8A 5T7BA 4FTWA 2I7XA 2B4TO 2Q3FA 3OE7D 3WBKA 4OGKA 4I6GA 5C3MA 3VYWA 3MJCA 4CJ6A 3R75A 1ZVJA 1D7AA 5JTUA 1PJJA 4I08A 1QF7A 5JTTA 2OLKA 4OJTA 2ZSKA 3EQ9A 1PK7A 3WGLA 1XO1A 3HUDA 2QXYA 1DINA 4IFEA 1E64A 5JO0A 4TQAA 4YUVA 5EIXA 3OKPA 5DV9A 4ZD6A 1JRLA 3CJRA 2Z5LA 1DJLA 1TLLA 2W6ID 3HN7A 2IE0A 1OZHA 5AKYA 4H7IA 4RHCA 4LFBB 2NUAB 3AO0B 3KD3A 1QQTA 3M6IA 1G6HA 4UU0A 1POXA 4S3MA 4LPSA 1FY2A 1HRDA 4H1UA 3PFBA 3PGLA 1PL8A 4L3VA 2ZB4A 4GYWA 2VNIA 1DZ3A 4CG0A 1IPHA 3TUIC 1GTZA 1L1QA 1C3EA 3KT8A 3GC6A 4MGKE 3EVFA 2PKQP 2XXAB 1K7SN 4Y1RB 2AJCA 3RS8A 4IWYA 2C58A 4E70A 3RHZA 2XRMA 1TJNA 4CLEA 3LP5A 2Z2YA 2W6ZA 4Z0TA 4RCVA 2CVOA 4P7GA 3G0OA 3H6KA 1YJQA 2Q1TA 1YFLA 1CEEA 3TIVA 2OYSA 3L0BA 4GKKM 1H2EA 1XTIA 4OHKA 4PPGA 2CUKA 2HF7A 3GLQA 3GFQA 4BV8A 4AYTA 2V7XA 3D6FA 3RK1A 4KEAA 2OHGA 1HNZM 3FFXA 1PL0A 3DGEC 3KEQA 2Y1OA 2FEAA 1W85B 2OP0A 3IHWA 1ZUNA 1YHYA 4MLCA 3TBFA 1UFRA 4IG9A 4D80A 3WK7A 5D6OA 4Q9AA 1U1IA 4BFLA 1C30B 1NURA 3W4JA 4MWOA 4CUZA 2X8BA 3TRFA 3WA6A 4HYEA 2Q7XA 4B4WA 4DF3A 3ASYA 4HWKA 4MXDA 1E1NA 3C5HA 3K0CC 2G5PA 1KK0A 5HJ5A 5KC8A 1PM5A 3IAHA 2ZJ2A 1XMPA 2D3WA 3GRVA 2PWZA 1F06A 2XEXA 3DLPX 1YOVB 4I1SA 2QSFX 3G88A 4FMDF 4I1VA 4MJXA 2OB2A 5EA2A 1M6HA 2WUGA 2CLCX 1WHSB 4TYYA 3ZW9A 1QG2A 3EYAA 1XHFA 3H1PA 5DBIA 4EZEA 4JI5M 4A36A 3WGMA 3IVCA 3TAUA 2PEYA 2B7LA 4DPKA 3AIIA 3OESA 5BXQC 3A58B 1NW3A 3G0CA 5K6AA 4YHBA 1UPBA 2OKCA 5HCUA 2GXUA 1YE3A 3Q5GA 4AIRA 3VO8A 4D3SA 4CQMB 3G8AA 4KJZA 3CSDA 1Y7HA 5J9FA 4NMLA 4C20A 5C4GB 1DKLA 3JQGB 2R5NA 4FFBB 4PIMA 4KGDA 3RFWA 4NOLA 3QFCA 1RLMA 4RXUA 1COWA 3D0QA 2W6PA 1E3WA 4GMKA 5MFZA 3PFIA 5K0GA 3GJ6A 2UVDA 3AEXA 2HB6A 3PQCA 2ODNA 3Q7QA 3KHSA 4MH0R 3B38A 1AZSC 2GAJA 3L40A 1LK0A 5FEUA 1X15A 1Z39A 3QA9A 3IKVA 5K3FB 4HI0E 5HF8A 1NLFA 4RDHA 4H16A 1CZHA 4NSNA 4QAJA 1P6QA 1O4WA 1HE1C 1ZPDA 2J0EA 1Z2DA 1D0VA 3MQ4A 2VJQA 2WMOB 1AUPA 1Z17A 5CG1A 3GDGA 4JI1M 1E6MA 4KLNA 4II2A 1XDBA 5BN1A 5JEEA 1GRCA 4EECA 2L69A 5AH0A 4YUXA 1RWKA 1KFJB 1DU4A 4DVJA 4QHTA 2I4LA 2RCYA 4MZXA 1AZLA 3B53X 1LTMA 3SHTA 4F92B 4JI0B 5HCIA 2NNLD 3VNQA 5J2TF 3OLVA 2NPIA 2KM1A 4EB6B 4OGFA 3QW4B 4RKFA 5K3AA 3LY8A 3A6EA 1ZD1A 1H4QA 4MRMB 2QJOA 3WL6A 1PEYA 4Y6OA 1FZTA 1N33B 3D2LA 4HPXB 1MJ5A 3T54A 4GPZA 1R6TA 2XUFA 3DDSA 4TZTA 4C89A 5IRCD 2AI2A 3KYJB 1XP5A 3WQBA 1X77A 2JH9A 1ARZA 2F5PA 2FPWA 4ZAYA 3ANXA 1GUAA 1SCKA 1GSHA 2FUNB 1YCGA 5KNDH 3WLAA 2XB6A 1IXYA 4CPDA 2C07A 2IS6A 4HFNA 2P4EA 2TYSB 2PVCA 1KXZA 4JN6B 1YIAA 5ER9A 1IM5A 1JS1X 4X66B 1D2MA 3HJNA 3USCS 1FOEB 3A1DA 5GVSA 1IN8A 2ZTDA 2QBYA 1YIOA 1EP9A 1CQPA 3IAUA 2M60A 1PG2A 1GP2A 3VUFA 3T9DA 1I2MA 3IEKA 2BF7A 5H70A 1TUIA 2AWOA 1M66A 2RHMA 3PX3A 4PNEA 3UPUA 4ZOAA 1J2TA 1UM8A 3GCGA 5BV7A 4UMDA 3SX4A 3VU9A 1I5RA 1JFFA 2YJ4A 1T10A 4HL6A 4CLRB 3KPYA 1BDHA 4J4BA 3SLKA 3IKMB 4PU0A 1ZGBA 4TWRA 1VCOA 2RAVA 2SICE 2FFBA 2HKJA 2PZBA 3RD5A 1ODJA