3U5ZA

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
total genus 46
structure length 186
sequence length 186
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zA03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zA02
3U5ZA 3U60A 3U61A
chains in the Genus database with same CATH superfamily
3SAVA 2QSFX 3RFWA 5KQDA 3U61A 4K0KM 1QZMA 3FUVA 4MGYE 3W0LB 4MGIE 2R9GA 1DGBA 1G59A 1NY5A 4QHSA 3SASA 1HJPA 3LCUA 1IY2A 2K9DA 3Q8GA 1HNWM 3I01M 3TWLA 4MB7A 4MM3B 1XXHE 1NY6A 2L2DA 2Z8YM 3LQQA 4DV2M 4WP2A 4NRWA 4LJ5A 1NO1A 1WR1B 1QAOA 2ZTCA 3D8BA 5FLXS 4WURA 2G8LA 1QUTA 2XH9A 2L4FA 3FYDA 4FVMA 2DXIA 1G3IA 4B3TM 1Q3BA 2OO9A 4LJ7A 2W82A 5ITRA 2DWNA 3AV0A 4AKGA 1J09A 1Q39A 4B3SM 3HU1A 4PD2A 4G4QA 3VLFB 1T6OA 1W5SA 1W5TA 1LTMA 3KOWE 3KXEC 5FTJA 3KOYE 3SBJA 2LHGA 4Z8XA 3DOAA 3KS4A 4CIZA 4AKHA 2DENA 2R46A 3EIEA 4X62M 1D0KA 2R0IA 2X4AA 4AKIA 2VQFM 1K82A 3RGSA 1WGNA 2LVPC 1H6UA 3GRYA 4L6V6 2F5PA 2LHCA 4PDGA 3FD9A 1XXHB 1XWIA 3GLGE 2BNKA 2LVNC 3DA1A 1OQYA 1TH2A 2GQFA 4F1IA 4PDIA 3SARA 1QVRA 1GJSA 3CGWA 4QOZC 4RNAA 3BOSA 1GJTA 2KRKA 4XBOA 4PCZA 1L2CA 4NXMM 2DAGA 4LFAM 2HHHM 1FNNA 2OOBA 2NQ8C 3K2LA 2L09A 4YY3M 4OU7A 3KOXE 5KQ8A 1XHBA 2K6BA 5DFLA 1L1TA 2DHRA 4A3VB 4LF8M 2DAEA 1MN3A 2KW0A 4DV5M 5C1BA 2E5LM 4UN2B 4FD2A 3MK6A 1LV7A 2ZAMA 2HWJA 4FCWA 4NC6A 1D2NA 3CF6E 3SYKA 3LVWA 2HCBA 3TE6A 2EKKA 3LCVB 1Z5CA 1N77A 3VDUA 4GRIA 1R7RA 5F3WA 4HEOA 2CV1A 2ERCA 3KS8A 2L4EA 2C5RA 2KZSA 4KT0F 4JI0M 4DR3M 1FJGM 5KPZA 3HX3A 3U6PA 2QCUA 2H1RA 2CV0A 2JP7A 4KHPM 2L6OA 1HNZM 4QHTA 3SMPA 1YSYA 2XF3A 4DR5M 1PJJA 4LF9M 1VG5A 2CE7A 1NJGA 1VDDA 2JXNA 2HKJA 2QQ8A 1Z6TA 2C98A 3B7ZA 4JI1M 4X65M 1XB2B 1TF0B 1XMQM 4P17A 3AOGA 2MROB 3L26A 1AUAA 3FUUA 3UJNA 4IBGA 2V1UA 4L15A 2QENA 3U6QA 1PM5A 2CHGA 2UUBM 3PNVA 4DR4M 4D81A 3GLGB 1XNQM 3H4JA 3PVSA 3GLIA 5EQTA 1TTEA 2CWBA 3FTDA 4GC5A 3SHGB 2O01F 4JYAM 2XSZD 5ITUA 2UXCM 2DI0A 4Z6YA 1ZMUA 1TH4A 4AI6A 2JNHA 1SXJE 2MJ5B 3HHYA 5A2QS 2J5YA 2G3QA 3J2PB 1NNJA 4JN6A 3L27A 4OX9M 3PNYA 4LZJA 5E26A 1MU5A 2C9CA 2JZ1A 4DR1M 4JI5M 2XSZA 5EJCA 4JI4M 4M0WA 1NNUC 3U61B 4BBAA 2RKOA 4G3OA 5KPRA 5FSWA 1DO2A 2EO2A 3HZJA 2LNHC 4FWGA 3GLGA 3A45A 2J7OA 1KFVA 3GLFA 3U6OA 2RGHA 4OVZA 3FUTA 5EP4A 3GQ4A 2FFJA 2YNMD 3HWSA 3KP0E 4AZFA 3GQ5A 2D7GA 1K3XA 3GLIE 3QYBA 2MR9A 3HJ8A 3VKGA 5DYIA 1R4GA 2DKLA 4DV6M 3KOZE 2Y0TA 1D0LA 2L7HA 2LH0A 5ITXA 4D82A 2MH8A 3J7BA 2QPAA 3W0FA 1DGFA 3IG5A 2JWSA 3TL4X 3AFHA 4P16A 3KDSE 1IY0A 2F5NA 1SXJB 4JI2M 3K1JA 4LJ6A 1N78A 2WZJA 4AW4A 1IN7A 1QAMA 3K92A 2Z4RA 3RGPA 3GPPA 2DZLA 3M7GA 3J80S 1Q3CA 2DWLA 1G4AE 2WSFF 4IBJA 5IREB 3H4MA 3SHFA 1QYRA 1NV9A 4DV3M 2KA6B 1IY1A 8CATA 4LF6M 1L8QA 3TPZA 3L29A 3U5ZA 1S3SA 3ZC7B 3U60A 5IZ7D 1IBKM 2UUCM 4I8OA 2H5XA 3SC3A 4B7FA 1L2DA 3ES5A 4M9SA 2KNZA 1IXRC 5ITYA 5ITXE 3JR5A 4JV5M 2RGOA 2J7NA 4QNMA 3MJ5A 4D80A 4KO8A 1DGHA 3JR4A 7CATA 4Y28F 2FS1A 1GABA 4AQYM 4G6ZA 3T1YM 2M5ZA 3HHWA 2LVAA 4DR7M 3TQSA 5EXSA 1QUSA 2FE8A 5LMUM 3E21A 3U5ZB 3LQRA 3JAMS 3GP1A 2O25A 4DR2M 1C7YA 3VK7A 2C96A 1NHGC 1HQYE 1Y8GA 4REZA 2VDBB 1PJTA 2F4VM 4W5WA 5C18A 3U6CA 3QAUA 1OAOC 2HAKA 2AHMA 3LVVA 4XGIA 2DAMA 3AOEC 3KSXA 2K0BX 5FTLA 1GO5A 3SAWA 2BJVA 3VFDA 1N32M 5GKNA 2APLA 3SMSA 4GKJM 3MHVC 2YQZA 4NL4H 2R6FA 2XLJA 1Z5BA 3HJQA 4DV7M 2QBYA 2Z4SA 3GPXA 3T1HM 4FW9A 3FTCA 1OTRA 1A5TA 1QDRA 2FNAA 2OPFA 2L7IA 2M60A 3HKPA 2JUJA 2F5QA 1T43A 2CEAA 3FRIA 4I4LA 1VQ1A 4GIPA 4IBEA 1ZQ9A 3KSJA 3UZUA 4AG5A 3I4VA 3B7NA 1V33A 1OKSA 2UUAM 1UFZA 4MGKE 1Q02A 3FTFA 3DFZA 2G5GX 1Z59A 4G4NA 1E9SA 5FTKA 4NXNM 1NJFA 3U6MA 4LGYA 2ZBKB 2EJSA 4IBKA 1HNXM 2JA2A 1VDLA 1GKIA 4F2LA 5FTNA 1DGGA 3HHZA 4B7HA 3HHXA 1JR3E 4DR6M 1SG9A 4R71A 4DUYM 4GH9A 4G4OA 2FH0A 1VEJA 5EP1A 1SXJA 4KODA 3ZQJA 2CV2A 3C3DA 3U6DA 2X49A 4DUZM 2KZUA 3HJSA 3PXGA 4ZPXA 5KPTA 1Z5AA 3L2AA 1EE8A 2DAIA 2MGWA 1MX0A 2R4JA 2LXEA 2DNAA 2LVOC 1PJSA 1IM2A 2B3TA 2R65A 2QBYB 2FOIC 5IWAM 1EIJA 2DWZB 3RC3A 2P5TA 4OVZB 4LZZA 3C58A 4IBFA 3FE3A 4RF0A 1N75A 3C9PA 4FWHA 3W68A 3OTOM 1R2YA 2Z7JA 3U6SA 1EFUB 1G8PA 3ZH9B 3SYLA 4LJ8A 4DV0M 4RF1A 3E46A 3AKZA 2JY5A 3CF0A 3GQ3A 1VEGA 3VK8A 4S12A 4LF4M 2BWBA 1R2ZA 3K9OA 1IN5A 4FCVA 5FTMA 1TDZA 3BBZA 2KHHA 4ITQA 1WXQA 1IN8A 4KLNA 4GKKM 1HR0M 3GPUA 1R6BX 3HY5A 2K47A 4L16A 1ZMWA 3AOEA 4FWDA 3VKHA 1G71A 2VF7A 1F4IA 1WHCA 3VDPA 4L8RC 4LRSA 2EA0A 2CHVA 4CISA 5DNYA 5LMNM 1BVSA 3GLIB 3A98B 1TR8A 3NBXX 2DAKA 3DZDA 4R3DA 3WHLA 4ANRA 1ZV1A 3L28A 1P3QQ 3V76A 5JI2E 2C9OA 4LJ9A 5EP3A 1E9RA 1IN4A 3K9PA 4JI7M 1IXSA 3FTEA 4LJ4A 3CTDA 3GLHE 4M9ZA 2QW6A 2DZNB 4I5SA 4B08A 1IBLM 3KP1E 3SFZA 4Q7JA 3GLHB 3Q8XA 1PJQA 1TDHA 5BPVA 1OJLA 5EXTA 3J7AS 2BWEA 1QDTA 3IG8A 2A5YB 1QZEA 2KNAA 1NSFA 2Y0QA 2OOAA 1NVMA 2C99A 2Y20A 3AJIB 2VQEM 1GL7A 2YR0A 1QANA 1YUBA 4GITA 2CHQA 3KFUG 4IJFA 2KEBA 3QYEA 3FKEA 2HL7A 5EXXA 4M0DA 3NBIA 1IXZA 4RKUF 4L4UA 3U6LA 1SXJC 4JI8M 3KVWA 2KNVA 5IT9S 1JB0F 4NOOB 1JR3A 2ZTDA 4FCTA 4DV1M 2QZ4A 1L2BA 3GLFB 4HL4A 2EUCA 1GLNA 3B7QA 1WIVA 2R62A 3W67A 2QHOB 4AG6A 1HT2E 2JY8A 1KSFX 3GRRA 3FUXA 3I04M 1C1KA 1QAQA 3B74A 3E4RA 1OFIA 4R7GA 4B7GA 4CJ6A 3SAUA 1WGLA 3RC8A 1PGYA 1CUKA 2I7PA 1JR3D 2N35A 2X8AA 3A42A 1RU3A 3HU2A 3M6AA 3A46A 1MW5A 2KXEA 1N36M 3SATA 2LTUA 4GC9A 1VEKA 1OIPA 3GLFE 4DV4M 1YLAA 5JI3E 4LF5M 2LBCA 2WSEF 1IXSB 2KDLA 5H37D 3T6PA 4WW0A 2Y21A 1SXJD 3LMMA 1I94M 3GRUA 3TWMA 1IN6A 1R5LA 2DWMA 3IHPA 1PJIA 3U6EA 1N33M 4G4RA 1X37A 3HU3A 3T15A 2QNJA 3B9PA 3CF2A 4LFBM 3J81S 4GHLA 4OW0A 2D7HA 2V1CA 4JI6M 4X66M 2QP9X 4II7A 1I4WA 3T38A 4LG2A 1HT1E 1XMOM 2R45A 2BJWA 2XEPA 3ZCBB 4DBGB 1TGUA 5KO3A 1N34M 2XZUA 2GNOA 3L25A 3NWLA 2CRUA 3EIHA 4IBDA 5ITQA 1GVNA 4QNRA 4B3MM 2LVQD 1G41A 1D0MA 1UM8A 3BGEA 2CFOA 1OAIA 2ZANA 4MH0E 1J7KA 2JY7A 3PFIA 3FRHA 4X64M 2UU9M 5E6JA 2Q2EB 4LJAA 4NSRA 1NV8A 1ZAEA 4JI3M 2DZOB 3GO8A 2F5SA 4GHAA 4IBCA 3FYCA 3GLHA 2Z3XA 2R18A 4L78A 3GPYA 4PT5A 3R9XB 4LFCM 1NHWC 4HLQA 4EIWA 4QOSA 5L8RF 2VIIA 3KW6A 5EP2A 2XFSA 3UGJA 1TH3A 4B3RM 1YE9A 4BB9A 3HGIA 3UMMA 4MGHA 4XK8F 3M0EA 1KYIA 3QWLA 1JQJC 3C3EA 3TWKA 4IBIA 2D7EA 3LW5F 2YFQA 2UXDM 4M9XA 3IECA 1AIPC 3MMPA 4YHHM 1V92A 2VF8A 3RE8A 1IFYA 1GL6A 1XC8A 4MGZE 3GRVA 1HQCA 2CP8A 2V6ZM 1WJ7A 4IIWA 1T3TA 5EXPA 1PRBA 3CTWB 5ITTA 3U60B 4BLCA 3FUWA 1QQWA 3ILKA 4LGMA 2XGNA 3AL0C 1L1ZA 4NSOB 1IQPA 1XXHA 3D8LA 3F92A 2EKFA 1MJGM 1ZMVA 2DHYA 4LY6A 3I4YA 2R4EA 2UXBM 4CHDA 1J5EM 1IBMM 3B89A 2XZFA 2DVWB 4LRTA 4CHTB 3THGA 1E94E 4CGYB 4GMQA 1XNRM 2CUZA 2JZ0A 4LCBA 2KRUA 2ZM6M 3R8FA 4JXJA 1E32A 2O5RA 1ORYB 4NRVA 3I51A 5BR8M 1DV0A 4GEWA 1K3WA 1OFHA 2F5OA 2JY6B 2R44A 1DO0A 1OIZA 2XFTA 2LWXA 4I81A 4IBBA 3J27B 3UK6A 4IJEA 1V34A 3BXWA 1DGHB 3WHKA 2RRUA 2ZAOA 5DYGA 4TUWA 4LF7M 3K8ZA 2WSCF 2I7NA 2OQ4A 3E9SA
chains in the Genus database with same CATH topology
3SAVA 3RFWA 5KQDA 3U61A 4K0KM 1QZMA 3FUVA 4MGYE 3W0LB 4MGIE 2R9GA 1DGBA 1G59A 1NY5A 4QHSA 3SASA 1IY2A 1HNWM 3TWLA 4MB7A 4MM3B 1XXHE 1NY6A 3LQQA 4DV2M 4NRWA 4LJ5A 3D8BA 1QAOA 5FLXS 4WURA 2G8LA 3FYDA 2XH9A 4FVMA 2DXIA 4B3TM 1G3IA 1Q3BA 4LJ7A 2W82A 5ITRA 2DWNA 3AV0A 4AKGA 1J09A 1Q39A 4B3SM 3HU1A 4PD2A 4G4QA 3VLFB 1W5SA 1W5TA 3KXEC 3KOWE 5FTJA 3KOYE 3SBJA 4Z8XA 3DOAA 3KS4A 4AKHA 2R46A 3EIEA 4X62M 2X4AA 4AKIA 2VQFM 1K82A 3RGSA 1H6UA 3GRYA 2F5PA 4PDGA 3FD9A 1XXHB 1XWIA 3GLGE 2BNKA 4PDIA 3DA1A 1TH2A 3SARA 1QVRA 4QOZC 4RNAA 3BOSA 2KRKA 4XBOA 4PCZA 1L2CA 4NXMM 4LFAM 2HHHM 1FNNA 2NQ8C 3K2LA 2L09A 4YY3M 4OU7A 3KOXE 5KQ8A 1XHBA 1L1TA 2DHRA 4A3VB 4LF8M 2KW0A 4DV5M 5C1BA 2E5LM 4FD2A 3MK6A 1LV7A 2ZAMA 4FCWA 1D2NA 3CF6E 3SYKA 3LVWA 2HCBA 3TE6A 1Z5CA 1N77A 3VDUA 4GRIA 1R7RA 5F3WA 2CV1A 3KS8A 2ERCA 2C5RA 2KZSA 4JI0M 4DR3M 1FJGM 5KPZA 3U6PA 2QCUA 2H1RA 2CV0A 4KHPM 2L6OA 1HNZM 4QHTA 3SMPA 1YSYA 2XF3A 4DR5M 1PJJA 4LF9M 2CE7A 1NJGA 1VDDA 2HKJA 1Z6TA 2C98A 4JI1M 4X65M 1XMQM 3AOGA 3L26A 3FUUA 3UJNA 4IBGA 2V1UA 4L15A 2QENA 3U6QA 1PM5A 2CHGA 2UUBM 3PNVA 4DR4M 4D81A 3GLGB 1XNQM 3PVSA 3GLIA 5EQTA 3FTDA 4GC5A 3SHGB 4JYAM 2XSZD 5ITUA 2UXCM 4Z6YA 1TH4A 4AI6A 1SXJE 3HHYA 5A2QS 3J2PB 1NNJA 4JN6A 3L27A 4OX9M 3PNYA 4LZJA 5E26A 1MU5A 2C9CA 4DR1M 4JI5M 2XSZA 5EJCA 4JI4M 4M0WA 1NNUC 3U61B 4BBAA 2RKOA 5KPRA 5FSWA 1DO2A 2EO2A 2LNHC 4FWGA 3GLGA 3A45A 2J7OA 1KFVA 3GLFA 3U6OA 2RGHA 4OVZA 3FUTA 3E9SA 5EP4A 3GQ4A 2YNMD 2FFJA 3HWSA 3KP0E 4AZFA 3GQ5A 2D7GA 1K3XA 3GLIE 3HJ8A 3VKGA 5DYIA 4DV6M 3KOZE 2Y0TA 2LH0A 2L7HA 4D82A 5ITXA 2DWMA 3J7BA 2QPAA 3W0FA 1DGFA 3IG5A 3TL4X 3AFHA 4P16A 3KDSE 1IY0A 2F5NA 1SXJB 4JI2M 3K1JA 4LJ6A 1N78A 4AW4A 1IN7A 1QAMA 3K92A 2Z4RA 3RGPA 3GPPA 3M7GA 3J80S 2DWLA 1Q3CA 1G4AE 4IBJA 5IREB 3H4MA 3SHFA 1QYRA 4DV3M 2KA6B 1IY1A 8CATA 4LF6M 1L8QA 3TPZA 3L29A 3U5ZA 1S3SA 3ZC7B 3U60A 5IZ7D 1IBKM 2UUCM 4I8OA 3SC3A 4B7FA 1L2DA 3ES5A 4M9SA 5ITXE 1IXRC 5ITYA 4JV5M 3JR5A 2RGOA 2J7NA 4QNMA 3MJ5A 4D80A 4KO8A 1DGHA 3JR4A 7CATA 4AQYM 4G6ZA 3T1YM 2M5ZA 3HHWA 4DR7M 3TQSA 5EXSA 2FE8A 5LMUM 3U5ZB 3LQRA 3JAMS 3GP1A 4DR2M 3VK7A 2C96A 1NHGC 1HQYE 4REZA 2F4VM 4W5WA 5C18A 3U6CA 3QAUA 3LVVA 2AHMA 4XGIA 3AOEC 3KSXA 5FTLA 2BJVA 3VFDA 1N32M 5GKNA 3SMSA 4GKJM 3MHVC 2YQZA 4NL4H 2XLJA 1Z5BA 4DV7M 2QBYA 2Z4SA 3GPXA 3T1HM 4FW9A 3FTCA 1A5TA 2FNAA 2OPFA 2L7IA 2M60A 3HKPA 2F5QA 2CEAA 4I4LA 4GIPA 4IBEA 1ZQ9A 3KSJA 3UZUA 4AG5A 3I4VA 2UUAM 4MGKE 3FTFA 3DFZA 2G5GX 1Z59A 4G4NA 1E9SA 5FTKA 4NXNM 1NJFA 3U6MA 4LGYA 2ZBKB 4IBKA 1HNXM 2JA2A 1GKIA 5FTNA 1DGGA 3HHZA 4B7HA 3HHXA 4DR6M 1JR3E 4DUYM 4GH9A 4G4OA 5EP1A 1SXJA 4KODA 2CV2A 3U6DA 2X49A 4DUZM 2KZUA 3HJSA 3PXGA 4ZPXA 5KPTA 1Z5AA 3L2AA 1EE8A 1MX0A 2R4JA 2LXEA 2R65A 1IM2A 2QBYB 2FOIC 5IWAM 2DWZB 3RC3A 2P5TA 4OVZB 4LZZA 3C58A 4IBFA 4RF0A 1N75A 4FWHA 3OTOM 1R2YA 2Z7JA 3U6SA 3ZH9B 1G8PA 3SYLA 4LJ8A 4DV0M 4RF1A 3AKZA 3GQ3A 3CF0A 3VK8A 4S12A 4LF4M 1R2ZA 1IN5A 4FCVA 5FTMA 1TDZA 4ITQA 4GKKM 1WXQA 1IN8A 4KLNA 1HR0M 3GPUA 1R6BX 2K47A 4L16A 3AOEA 4FWDA 3VKHA 3VDPA 4L8RC 4LRSA 2EA0A 2CHVA 4CISA 5DNYA 5LMNM 3GLIB 3A98B 3DZDA 4R3DA 3WHLA 3L28A 5JI2E 2C9OA 4LJ9A 5EP3A 1IN4A 1E9RA 4JI7M 3FTEA 4LJ4A 3CTDA 4M9ZA 3GLHE 2QW6A 2DZNB 4I5SA 4B08A 1IBLM 3KP1E 3SFZA 3GLHB 3Q8XA 1TDHA 5BPVA 1OJLA 5EXTA 3J7AS 3IG8A 2A5YB 1NSFA 2Y0QA 3AJIB 1NVMA 2C99A 2Y20A 2VQEM 1GL7A 2YR0A 1QANA 1YUBA 4GITA 2CHQA 3KFUG 4IJFA 2KEBA 3FKEA 2HL7A 5EXXA 4M0DA 3NBIA 1IXZA 3U6LA 4L4UA 4JI8M 1SXJC 5IT9S 3KVWA 4NOOB 1JR3A 4FCTA 4DV1M 2QZ4A 1L2BA 3GLFB 4HL4A 2EUCA 1GLNA 2R62A 4AG6A 1HT2E 3GRRA 1KSFX 3FUXA 1C1KA 1QAQA 3E4RA 3SAUA 1OFIA 4R7GA 4B7GA 3RC8A 2I7PA 2X8AA 3A42A 1JR3D 3M6AA 3A46A 3HU2A 1MW5A 2KXEA 1N36M 3SATA 4GC9A 4DV4M 3GLFE 5JI3E 4LF5M 1IXSB 5H37D 4WW0A 2Y21A 1SXJD 3LMMA 1I94M 3GRUA 3TWMA 1IN6A 1N33M 1PJIA 3U6EA 4G4RA 1X37A 3HU3A 3T15A 3B9PA 4LFBM 3CF2A 3J81S 4GHLA 4OW0A 2D7HA 2V1CA 4JI6M 4X66M 2QP9X 4II7A 1I4WA 3T38A 4LG2A 1HT1E 1XMOM 2R45A 2BJWA 2XEPA 3ZCBB 1TGUA 5KO3A 1N34M 2XZUA 3L25A 2GNOA 3NWLA 3EIHA 4IBDA 5ITQA 1GVNA 4QNRA 4B3MM 1G41A 3BGEA 1UM8A 2CFOA 2ZANA 4MH0E 1J7KA 3PFIA 4X64M 2UU9M 5E6JA 2Q2EB 4LJAA 4NSRA 1ZAEA 4JI3M 2DZOB 3GO8A 2F5SA 4GHAA 4IBCA 3GLHA 3FYCA 2Z3XA 2R18A 4L78A 3GPYA 4PT5A 3R9XB 4LFCM 1NHWC 4HLQA 4EIWA 4QOSA 2VIIA 3KW6A 5EP2A 2XFSA 3UGJA 1TH3A 4B3RM 1YE9A 4BB9A 3HGIA 3UMMA 4MGHA 3M0EA 1KYIA 3QWLA 1JQJC 3TWKA 4IBIA 2D7EA 2YFQA 2UXDM 4M9XA 4YHHM 3RE8A 1GL6A 1XC8A 4MGZE 3GRVA 1HQCA 2V6ZM 4IIWA 5EXPA 1T3TA 5ITTA 3CTWB 3U60B 4BLCA 3FUWA 1QQWA 3ILKA 4LGMA 2XGNA 3AL0C 1L1ZA 4NSOB 1IQPA 1XXHA 3D8LA 4LY6A 3I4YA 2R4EA 2UXBM 4CHDA 1J5EM 1IBMM 2XZFA 2DVWB 4LRTA 4CHTB 3THGA 1E94E 4CGYB 4GMQA 1XNRM 2CUZA 4LCBA 2ZM6M 2KRUA 3R8FA 4JXJA 1E32A 2O5RA 1ORYB 4NRVA 3I51A 5BR8M 1K3WA 1OFHA 2F5OA 1DO0A 4IBBA 2XFTA 2LWXA 4I81A 3J27B 3UK6A 4IJEA 1DGHB 3WHKA 2ZAOA 5DYGA 4TUWA 4LF7M 3K8ZA 3SAWA 2I7NA 2OQ4A 3HJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5Z A;  3U60 A;  3U61 A; 
#chains in the Genus database with same CATH topology
 3SAV A;  2QSF X;  3RFW A;  5KQD A;  3U61 A;  4K0K M;  1QZM A;  3FUV A;  4MGY E;  3W0L B;  4MGI E;  2R9G A;  1DGB A;  1G59 A;  1NY5 A;  4QHS A;  3SAS A;  1HJP A;  3LCU A;  1IY2 A;  2K9D A;  3Q8G A;  1HNW M;  3I01 M;  3TWL A;  4MB7 A;  4MM3 B;  1XXH E;  1NY6 A;  2L2D A;  2Z8Y M;  3LQQ A;  4DV2 M;  4WP2 A;  4NRW A;  4LJ5 A;  1NO1 A;  1WR1 B;  1QAO A;  2ZTC A;  3D8B A;  5FLX S;  4WUR A;  2G8L A;  1QUT A;  2XH9 A;  2L4F A;  3FYD A;  4FVM A;  2DXI A;  1G3I A;  4B3T M;  1Q3B A;  2OO9 A;  4LJ7 A;  2W82 A;  5ITR A;  2DWN A;  3AV0 A;  4AKG A;  1J09 A;  1Q39 A;  4B3S M;  3HU1 A;  4PD2 A;  4G4Q A;  3VLF B;  1T6O A;  1W5S A;  1W5T A;  1LTM A;  3KOW E;  3KXE C;  5FTJ A;  3KOY E;  3SBJ A;  2LHG A;  4Z8X A;  3DOA A;  3KS4 A;  4CIZ A;  4AKH A;  2DEN A;  2R46 A;  3EIE A;  4X62 M;  1D0K A;  2R0I A;  2X4A A;  4AKI A;  2VQF M;  1K82 A;  3RGS A;  1WGN A;  2LVP C;  1H6U A;  3GRY A;  4L6V 6;  2F5P A;  2LHC A;  4PDG A;  3FD9 A;  1XXH B;  1XWI A;  3GLG E;  2BNK A;  2LVN C;  3DA1 A;  1OQY A;  1TH2 A;  2GQF A;  4F1I A;  4PDI A;  3SAR A;  1QVR A;  1GJS A;  3CGW A;  4QOZ C;  4RNA A;  3BOS A;  1GJT A;  2KRK A;  4XBO A;  4PCZ A;  1L2C A;  4NXM M;  2DAG A;  4LFA M;  2HHH M;  1FNN A;  2OOB A;  2NQ8 C;  3K2L A;  2L09 A;  4YY3 M;  4OU7 A;  3KOX E;  5KQ8 A;  1XHB A;  2K6B A;  5DFL A;  1L1T A;  2DHR A;  4A3V B;  4LF8 M;  2DAE A;  1MN3 A;  2KW0 A;  4DV5 M;  5C1B A;  2E5L M;  4UN2 B;  4FD2 A;  3MK6 A;  1LV7 A;  2ZAM A;  2HWJ A;  4FCW A;  4NC6 A;  1D2N A;  3CF6 E;  3SYK A;  3LVW A;  2HCB A;  3TE6 A;  2EKK A;  3LCV B;  1Z5C A;  1N77 A;  3VDU A;  4GRI A;  1R7R A;  5F3W A;  4HEO A;  2CV1 A;  2ERC A;  3KS8 A;  2L4E A;  2C5R A;  2KZS A;  4KT0 F;  4JI0 M;  4DR3 M;  1FJG M;  5KPZ A;  3HX3 A;  3U6P A;  2QCU A;  2H1R A;  2CV0 A;  2JP7 A;  4KHP M;  2L6O A;  1HNZ M;  4QHT A;  3SMP A;  1YSY A;  2XF3 A;  4DR5 M;  1PJJ A;  4LF9 M;  1VG5 A;  2CE7 A;  1NJG A;  1VDD A;  2JXN A;  2HKJ A;  2QQ8 A;  1Z6T A;  2C98 A;  3B7Z A;  4JI1 M;  4X65 M;  1XB2 B;  1TF0 B;  1XMQ M;  4P17 A;  3AOG A;  2MRO B;  3L26 A;  1AUA A;  3FUU A;  3UJN A;  4IBG A;  2V1U A;  4L15 A;  2QEN A;  3U6Q A;  1PM5 A;  2CHG A;  2UUB M;  3PNV A;  4DR4 M;  4D81 A;  3GLG B;  1XNQ M;  3H4J A;  3PVS A;  3GLI A;  5EQT A;  1TTE A;  2CWB A;  3FTD A;  4GC5 A;  3SHG B;  2O01 F;  4JYA M;  2XSZ D;  5ITU A;  2UXC M;  2DI0 A;  4Z6Y A;  1ZMU A;  1TH4 A;  4AI6 A;  2JNH A;  1SXJ E;  2MJ5 B;  3HHY A;  5A2Q S;  2J5Y A;  2G3Q A;  3J2P B;  1NNJ A;  4JN6 A;  3L27 A;  4OX9 M;  3PNY A;  4LZJ A;  5E26 A;  1MU5 A;  2C9C A;  2JZ1 A;  4DR1 M;  4JI5 M;  2XSZ A;  5EJC A;  4JI4 M;  4M0W A;  1NNU C;  3U61 B;  4BBA A;  2RKO A;  4G3O A;  5KPR A;  5FSW A;  1DO2 A;  2EO2 A;  3HZJ A;  2LNH C;  4FWG A;  3GLG A;  3A45 A;  2J7O A;  1KFV A;  3GLF A;  3U6O A;  2RGH A;  4OVZ A;  3FUT A;  5EP4 A;  3GQ4 A;  2FFJ A;  2YNM D;  3HWS A;  3KP0 E;  4AZF A;  3GQ5 A;  2D7G A;  1K3X A;  3GLI E;  3QYB A;  2MR9 A;  3HJ8 A;  3VKG A;  5DYI A;  1R4G A;  2DKL A;  4DV6 M;  3KOZ E;  2Y0T A;  1D0L A;  2L7H A;  2LH0 A;  5ITX A;  4D82 A;  2MH8 A;  3J7B A;  2QPA A;  3W0F A;  1DGF A;  3IG5 A;  2JWS A;  3TL4 X;  3AFH A;  4P16 A;  3KDS E;  1IY0 A;  2F5N A;  1SXJ B;  4JI2 M;  3K1J A;  4LJ6 A;  1N78 A;  2WZJ A;  4AW4 A;  1IN7 A;  1QAM A;  3K92 A;  2Z4R A;  3RGP A;  3GPP A;  2DZL A;  3M7G A;  3J80 S;  1Q3C A;  2DWL A;  1G4A E;  2WSF F;  4IBJ A;  5IRE B;  3H4M A;  3SHF A;  1QYR A;  1NV9 A;  4DV3 M;  2KA6 B;  1IY1 A;  8CAT A;  4LF6 M;  1L8Q A;  3TPZ A;  3L29 A;  3U5Z A;  1S3S A;  3ZC7 B;  3U60 A;  5IZ7 D;  1IBK M;  2UUC M;  4I8O A;  2H5X A;  3SC3 A;  4B7F A;  1L2D A;  3ES5 A;  4M9S A;  2KNZ A;  1IXR C;  5ITY A;  5ITX E;  3JR5 A;  4JV5 M;  2RGO A;  2J7N A;  4QNM A;  3MJ5 A;  4D80 A;  4KO8 A;  1DGH A;  3JR4 A;  7CAT A;  4Y28 F;  2FS1 A;  1GAB A;  4AQY M;  4G6Z A;  3T1Y M;  2M5Z A;  3HHW A;  2LVA A;  4DR7 M;  3TQS A;  5EXS A;  1QUS A;  2FE8 A;  5LMU M;  3E21 A;  3U5Z B;  3LQR A;  3JAM S;  3GP1 A;  2O25 A;  4DR2 M;  1C7Y A;  3VK7 A;  2C96 A;  1NHG C;  1HQY E;  1Y8G A;  4REZ A;  2VDB B;  1PJT A;  2F4V M;  4W5W A;  5C18 A;  3U6C A;  3QAU A;  1OAO C;  2HAK A;  2AHM A;  3LVV A;  4XGI A;  2DAM A;  3AOE C;  3KSX A;  2K0B X;  5FTL A;  1GO5 A;  3SAW A;  2BJV A;  3VFD A;  1N32 M;  5GKN A;  2APL A;  3SMS A;  4GKJ M;  3MHV C;  2YQZ A;  4NL4 H;  2R6F A;  2XLJ A;  1Z5B A;  3HJQ A;  4DV7 M;  2QBY A;  2Z4S A;  3GPX A;  3T1H M;  4FW9 A;  3FTC A;  1OTR A;  1A5T A;  1QDR A;  2FNA A;  2OPF A;  2L7I A;  2M60 A;  3HKP A;  2JUJ A;  2F5Q A;  1T43 A;  2CEA A;  3FRI A;  4I4L A;  1VQ1 A;  4GIP A;  4IBE A;  1ZQ9 A;  3KSJ A;  3UZU A;  4AG5 A;  3I4V A;  3B7N A;  1V33 A;  1OKS A;  2UUA M;  1UFZ A;  4MGK E;  1Q02 A;  3FTF A;  3DFZ A;  2G5G X;  1Z59 A;  4G4N A;  1E9S A;  5FTK A;  4NXN M;  1NJF A;  3U6M A;  4LGY A;  2ZBK B;  2EJS A;  4IBK A;  1HNX M;  2JA2 A;  1VDL A;  1GKI A;  4F2L A;  5FTN A;  1DGG A;  3HHZ A;  4B7H A;  3HHX A;  1JR3 E;  4DR6 M;  1SG9 A;  4R71 A;  4DUY M;  4GH9 A;  4G4O A;  2FH0 A;  1VEJ A;  5EP1 A;  1SXJ A;  4KOD A;  3ZQJ A;  2CV2 A;  3C3D A;  3U6D A;  2X49 A;  4DUZ M;  2KZU A;  3HJS A;  3PXG A;  4ZPX A;  5KPT A;  1Z5A A;  3L2A A;  1EE8 A;  2DAI A;  2MGW A;  1MX0 A;  2R4J A;  2LXE A;  2DNA A;  2LVO C;  1PJS A;  1IM2 A;  2B3T A;  2R65 A;  2QBY B;  2FOI C;  5IWA M;  1EIJ A;  2DWZ B;  3RC3 A;  2P5T A;  4OVZ B;  4LZZ A;  3C58 A;  4IBF A;  3FE3 A;  4RF0 A;  1N75 A;  3C9P A;  4FWH A;  3W68 A;  3OTO M;  1R2Y A;  2Z7J A;  3U6S A;  1EFU B;  1G8P A;  3ZH9 B;  3SYL A;  4LJ8 A;  4DV0 M;  4RF1 A;  3E46 A;  3AKZ A;  2JY5 A;  3CF0 A;  3GQ3 A;  1VEG A;  3VK8 A;  4S12 A;  4LF4 M;  2BWB A;  1R2Z A;  3K9O A;  1IN5 A;  4FCV A;  5FTM A;  1TDZ A;  3BBZ A;  2KHH A;  4ITQ A;  1WXQ A;  1IN8 A;  4KLN A;  4GKK M;  1HR0 M;  3GPU A;  1R6B X;  3HY5 A;  2K47 A;  4L16 A;  1ZMW A;  3AOE A;  4FWD A;  3VKH A;  1G71 A;  2VF7 A;  1F4I A;  1WHC A;  3VDP A;  4L8R C;  4LRS A;  2EA0 A;  2CHV A;  4CIS A;  5DNY A;  5LMN M;  1BVS A;  3GLI B;  3A98 B;  1TR8 A;  3NBX X;  2DAK A;  3DZD A;  4R3D A;  3WHL A;  4ANR A;  1ZV1 A;  3L28 A;  1P3Q Q;  3V76 A;  5JI2 E;  2C9O A;  4LJ9 A;  5EP3 A;  1E9R A;  1IN4 A;  3K9P A;  4JI7 M;  1IXS A;  3FTE A;  4LJ4 A;  3CTD A;  3GLH E;  4M9Z A;  2QW6 A;  2DZN B;  4I5S A;  4B08 A;  1IBL M;  3KP1 E;  3SFZ A;  4Q7J A;  3GLH B;  3Q8X A;  1PJQ A;  1TDH A;  5BPV A;  1OJL A;  5EXT A;  3J7A S;  2BWE A;  1QDT A;  3IG8 A;  2A5Y B;  1QZE A;  2KNA A;  1NSF A;  2Y0Q A;  2OOA A;  1NVM A;  2C99 A;  2Y20 A;  3AJI B;  2VQE M;  1GL7 A;  2YR0 A;  1QAN A;  1YUB A;  4GIT A;  2CHQ A;  3KFU G;  4IJF A;  2KEB A;  3QYE A;  3FKE A;  2HL7 A;  5EXX A;  4M0D A;  3NBI A;  1IXZ A;  4RKU F;  4L4U A;  3U6L A;  1SXJ C;  4JI8 M;  3KVW A;  2KNV A;  5IT9 S;  1JB0 F;  4NOO B;  1JR3 A;  2ZTD A;  4FCT A;  4DV1 M;  2QZ4 A;  1L2B A;  3GLF B;  4HL4 A;  2EUC A;  1GLN A;  3B7Q A;  1WIV A;  2R62 A;  3W67 A;  2QHO B;  4AG6 A;  1HT2 E;  2JY8 A;  1KSF X;  3GRR A;  3FUX A;  3I04 M;  1C1K A;  1QAQ A;  3B74 A;  3E4R A;  1OFI A;  4R7G A;  4B7G A;  4CJ6 A;  3SAU A;  1WGL A;  3RC8 A;  1PGY A;  1CUK A;  2I7P A;  1JR3 D;  2N35 A;  2X8A A;  3A42 A;  1RU3 A;  3HU2 A;  3M6A A;  3A46 A;  1MW5 A;  2KXE A;  1N36 M;  3SAT A;  2LTU A;  4GC9 A;  1VEK A;  1OIP A;  3GLF E;  4DV4 M;  1YLA A;  5JI3 E;  4LF5 M;  2LBC A;  2WSE F;  1IXS B;  2KDL A;  5H37 D;  3T6P A;  4WW0 A;  2Y21 A;  1SXJ D;  3LMM A;  1I94 M;  3GRU A;  3TWM A;  1IN6 A;  1R5L A;  2DWM A;  3IHP A;  1PJI A;  3U6E A;  1N33 M;  4G4R A;  1X37 A;  3HU3 A;  3T15 A;  2QNJ A;  3B9P A;  3CF2 A;  4LFB M;  3J81 S;  4GHL A;  4OW0 A;  2D7H A;  2V1C A;  4JI6 M;  4X66 M;  2QP9 X;  4II7 A;  1I4W A;  3T38 A;  4LG2 A;  1HT1 E;  1XMO M;  2R45 A;  2BJW A;  2XEP A;  3ZCB B;  4DBG B;  1TGU A;  5KO3 A;  1N34 M;  2XZU A;  2GNO A;  3L25 A;  3NWL A;  2CRU A;  3EIH A;  4IBD A;  5ITQ A;  1GVN A;  4QNR A;  4B3M M;  2LVQ D;  1G41 A;  1D0M A;  1UM8 A;  3BGE A;  2CFO A;  1OAI A;  2ZAN A;  4MH0 E;  1J7K A;  2JY7 A;  3PFI A;  3FRH A;  4X64 M;  2UU9 M;  5E6J A;  2Q2E B;  4LJA A;  4NSR A;  1NV8 A;  1ZAE A;  4JI3 M;  2DZO B;  3GO8 A;  2F5S A;  4GHA A;  4IBC A;  3FYC A;  3GLH A;  2Z3X A;  2R18 A;  4L78 A;  3GPY A;  4PT5 A;  3R9X B;  4LFC M;  1NHW C;  4HLQ A;  4EIW A;  4QOS A;  5L8R F;  2VII A;  3KW6 A;  5EP2 A;  2XFS A;  3UGJ A;  1TH3 A;  4B3R M;  1YE9 A;  4BB9 A;  3HGI A;  3UMM A;  4MGH A;  4XK8 F;  3M0E A;  1KYI A;  3QWL A;  1JQJ C;  3C3E A;  3TWK A;  4IBI A;  2D7E A;  3LW5 F;  2YFQ A;  2UXD M;  4M9X A;  3IEC A;  1AIP C;  3MMP A;  4YHH M;  1V92 A;  2VF8 A;  3RE8 A;  1IFY A;  1GL6 A;  1XC8 A;  4MGZ E;  3GRV A;  1HQC A;  2CP8 A;  2V6Z M;  1WJ7 A;  4IIW A;  1T3T A;  5EXP A;  1PRB A;  3CTW B;  5ITT A;  3U60 B;  4BLC A;  3FUW A;  1QQW A;  3ILK A;  4LGM A;  2XGN A;  3AL0 C;  1L1Z A;  4NSO B;  1IQP A;  1XXH A;  3D8L A;  3F92 A;  2EKF A;  1MJG M;  1ZMV A;  2DHY A;  4LY6 A;  3I4Y A;  2R4E A;  2UXB M;  4CHD A;  1J5E M;  1IBM M;  3B89 A;  2XZF A;  2DVW B;  4LRT A;  4CHT B;  3THG A;  1E94 E;  4CGY B;  4GMQ A;  1XNR M;  2CUZ A;  2JZ0 A;  4LCB A;  2KRU A;  2ZM6 M;  3R8F A;  4JXJ A;  1E32 A;  2O5R A;  1ORY B;  4NRV A;  3I51 A;  5BR8 M;  1DV0 A;  4GEW A;  1K3W A;  1OFH A;  2F5O A;  2JY6 B;  2R44 A;  1DO0 A;  1OIZ A;  2XFT A;  2LWX A;  4I81 A;  4IBB A;  3J27 B;  3UK6 A;  4IJE A;  1V34 A;  3BXW A;  1DGH B;  3WHK A;  2RRU A;  2ZAO A;  5DYG A;  4TUW A;  4LF7 M;  3K8Z A;  2WSC F;  2I7N A;  2OQ4 A;  3E9S A; 
#chains in the Genus database with same CATH homology
 3SAV A;  3RFW A;  5KQD A;  3U61 A;  4K0K M;  1QZM A;  3FUV A;  4MGY E;  3W0L B;  4MGI E;  2R9G A;  1DGB A;  1G59 A;  1NY5 A;  4QHS A;  3SAS A;  1IY2 A;  1HNW M;  3TWL A;  4MB7 A;  4MM3 B;  1XXH E;  1NY6 A;  3LQQ A;  4DV2 M;  4NRW A;  4LJ5 A;  3D8B A;  1QAO A;  5FLX S;  4WUR A;  2G8L A;  3FYD A;  2XH9 A;  4FVM A;  2DXI A;  4B3T M;  1G3I A;  1Q3B A;  4LJ7 A;  2W82 A;  5ITR A;  2DWN A;  3AV0 A;  4AKG A;  1J09 A;  1Q39 A;  4B3S M;  3HU1 A;  4PD2 A;  4G4Q A;  3VLF B;  1W5S A;  1W5T A;  3KXE C;  3KOW E;  5FTJ A;  3KOY E;  3SBJ A;  4Z8X A;  3DOA A;  3KS4 A;  4AKH A;  2R46 A;  3EIE A;  4X62 M;  2X4A A;  4AKI A;  2VQF M;  1K82 A;  3RGS A;  1H6U A;  3GRY A;  2F5P A;  4PDG A;  3FD9 A;  1XXH B;  1XWI A;  3GLG E;  2BNK A;  4PDI A;  3DA1 A;  1TH2 A;  3SAR A;  1QVR A;  4QOZ C;  4RNA A;  3BOS A;  2KRK A;  4XBO A;  4PCZ A;  1L2C A;  4NXM M;  4LFA M;  2HHH M;  1FNN A;  2NQ8 C;  3K2L A;  2L09 A;  4YY3 M;  4OU7 A;  3KOX E;  5KQ8 A;  1XHB A;  1L1T A;  2DHR A;  4A3V B;  4LF8 M;  2KW0 A;  4DV5 M;  5C1B A;  2E5L M;  4FD2 A;  3MK6 A;  1LV7 A;  2ZAM A;  4FCW A;  1D2N A;  3CF6 E;  3SYK A;  3LVW A;  2HCB A;  3TE6 A;  1Z5C A;  1N77 A;  3VDU A;  4GRI A;  1R7R A;  5F3W A;  2CV1 A;  3KS8 A;  2ERC A;  2C5R A;  2KZS A;  4JI0 M;  4DR3 M;  1FJG M;  5KPZ A;  3U6P A;  2QCU A;  2H1R A;  2CV0 A;  4KHP M;  2L6O A;  1HNZ M;  4QHT A;  3SMP A;  1YSY A;  2XF3 A;  4DR5 M;  1PJJ A;  4LF9 M;  2CE7 A;  1NJG A;  1VDD A;  2HKJ A;  1Z6T A;  2C98 A;  4JI1 M;  4X65 M;  1XMQ M;  3AOG A;  3L26 A;  3FUU A;  3UJN A;  4IBG A;  2V1U A;  4L15 A;  2QEN A;  3U6Q A;  1PM5 A;  2CHG A;  2UUB M;  3PNV A;  4DR4 M;  4D81 A;  3GLG B;  1XNQ M;  3PVS A;  3GLI A;  5EQT A;  3FTD A;  4GC5 A;  3SHG B;  4JYA M;  2XSZ D;  5ITU A;  2UXC M;  4Z6Y A;  1TH4 A;  4AI6 A;  1SXJ E;  3HHY A;  5A2Q S;  3J2P B;  1NNJ A;  4JN6 A;  3L27 A;  4OX9 M;  3PNY A;  4LZJ A;  5E26 A;  1MU5 A;  2C9C A;  4DR1 M;  4JI5 M;  2XSZ A;  5EJC A;  4JI4 M;  4M0W A;  1NNU C;  3U61 B;  4BBA A;  2RKO A;  5KPR A;  5FSW A;  1DO2 A;  2EO2 A;  2LNH C;  4FWG A;  3GLG A;  3A45 A;  2J7O A;  1KFV A;  3GLF A;  3U6O A;  2RGH A;  4OVZ A;  3FUT A;  3E9S A;  5EP4 A;  3GQ4 A;  2YNM D;  2FFJ A;  3HWS A;  3KP0 E;  4AZF A;  3GQ5 A;  2D7G A;  1K3X A;  3GLI E;  3HJ8 A;  3VKG A;  5DYI A;  4DV6 M;  3KOZ E;  2Y0T A;  2LH0 A;  2L7H A;  4D82 A;  5ITX A;  2DWM A;  3J7B A;  2QPA A;  3W0F A;  1DGF A;  3IG5 A;  3TL4 X;  3AFH A;  4P16 A;  3KDS E;  1IY0 A;  2F5N A;  1SXJ B;  4JI2 M;  3K1J A;  4LJ6 A;  1N78 A;  4AW4 A;  1IN7 A;  1QAM A;  3K92 A;  2Z4R A;  3RGP A;  3GPP A;  3M7G A;  3J80 S;  2DWL A;  1Q3C A;  1G4A E;  4IBJ A;  5IRE B;  3H4M A;  3SHF A;  1QYR A;  4DV3 M;  2KA6 B;  1IY1 A;  8CAT A;  4LF6 M;  1L8Q A;  3TPZ A;  3L29 A;  3U5Z A;  1S3S A;  3ZC7 B;  3U60 A;  5IZ7 D;  1IBK M;  2UUC M;  4I8O A;  3SC3 A;  4B7F A;  1L2D A;  3ES5 A;  4M9S A;  5ITX E;  1IXR C;  5ITY A;  4JV5 M;  3JR5 A;  2RGO A;  2J7N A;  4QNM A;  3MJ5 A;  4D80 A;  4KO8 A;  1DGH A;  3JR4 A;  7CAT A;  4AQY M;  4G6Z A;  3T1Y M;  2M5Z A;  3HHW A;  4DR7 M;  3TQS A;  5EXS A;  2FE8 A;  5LMU M;  3U5Z B;  3LQR A;  3JAM S;  3GP1 A;  4DR2 M;  3VK7 A;  2C96 A;  1NHG C;  1HQY E;  4REZ A;  2F4V M;  4W5W A;  5C18 A;  3U6C A;  3QAU A;  3LVV A;  2AHM A;  4XGI A;  3AOE C;  3KSX A;  5FTL A;  2BJV A;  3VFD A;  1N32 M;  5GKN A;  3SMS A;  4GKJ M;  3MHV C;  2YQZ A;  4NL4 H;  2XLJ A;  1Z5B A;  4DV7 M;  2QBY A;  2Z4S A;  3GPX A;  3T1H M;  4FW9 A;  3FTC A;  1A5T A;  2FNA A;  2OPF A;  2L7I A;  2M60 A;  3HKP A;  2F5Q A;  2CEA A;  4I4L A;  4GIP A;  4IBE A;  1ZQ9 A;  3KSJ A;  3UZU A;  4AG5 A;  3I4V A;  2UUA M;  4MGK E;  3FTF A;  3DFZ A;  2G5G X;  1Z59 A;  4G4N A;  1E9S A;  5FTK A;  4NXN M;  1NJF A;  3U6M A;  4LGY A;  2ZBK B;  4IBK A;  1HNX M;  2JA2 A;  1GKI A;  5FTN A;  1DGG A;  3HHZ A;  4B7H A;  3HHX A;  4DR6 M;  1JR3 E;  4DUY M;  4GH9 A;  4G4O A;  5EP1 A;  1SXJ A;  4KOD A;  2CV2 A;  3U6D A;  2X49 A;  4DUZ M;  2KZU A;  3HJS A;  3PXG A;  4ZPX A;  5KPT A;  1Z5A A;  3L2A A;  1EE8 A;  1MX0 A;  2R4J A;  2LXE A;  2R65 A;  1IM2 A;  2QBY B;  2FOI C;  5IWA M;  2DWZ B;  3RC3 A;  2P5T A;  4OVZ B;  4LZZ A;  3C58 A;  4IBF A;  4RF0 A;  1N75 A;  4FWH A;  3OTO M;  1R2Y A;  2Z7J A;  3U6S A;  3ZH9 B;  1G8P A;  3SYL A;  4LJ8 A;  4DV0 M;  4RF1 A;  3AKZ A;  3GQ3 A;  3CF0 A;  3VK8 A;  4S12 A;  4LF4 M;  1R2Z A;  1IN5 A;  4FCV A;  5FTM A;  1TDZ A;  4ITQ A;  4GKK M;  1WXQ A;  1IN8 A;  4KLN A;  1HR0 M;  3GPU A;  1R6B X;  2K47 A;  4L16 A;  3AOE A;  4FWD A;  3VKH A;  3VDP A;  4L8R C;  4LRS A;  2EA0 A;  2CHV A;  4CIS A;  5DNY A;  5LMN M;  3GLI B;  3A98 B;  3DZD A;  4R3D A;  3WHL A;  3L28 A;  5JI2 E;  2C9O A;  4LJ9 A;  5EP3 A;  1IN4 A;  1E9R A;  4JI7 M;  3FTE A;  4LJ4 A;  3CTD A;  4M9Z A;  3GLH E;  2QW6 A;  2DZN B;  4I5S A;  4B08 A;  1IBL M;  3KP1 E;  3SFZ A;  3GLH B;  3Q8X A;  1TDH A;  5BPV A;  1OJL A;  5EXT A;  3J7A S;  3IG8 A;  2A5Y B;  1NSF A;  2Y0Q A;  3AJI B;  1NVM A;  2C99 A;  2Y20 A;  2VQE M;  1GL7 A;  2YR0 A;  1QAN A;  1YUB A;  4GIT A;  2CHQ A;  3KFU G;  4IJF A;  2KEB A;  3FKE A;  2HL7 A;  5EXX A;  4M0D A;  3NBI A;  1IXZ A;  3U6L A;  4L4U A;  4JI8 M;  1SXJ C;  5IT9 S;  3KVW A;  4NOO B;  1JR3 A;  4FCT A;  4DV1 M;  2QZ4 A;  1L2B A;  3GLF B;  4HL4 A;  2EUC A;  1GLN A;  2R62 A;  4AG6 A;  1HT2 E;  3GRR A;  1KSF X;  3FUX A;  1C1K A;  1QAQ A;  3E4R A;  3SAU A;  1OFI A;  4R7G A;  4B7G A;  3RC8 A;  2I7P A;  2X8A A;  3A42 A;  1JR3 D;  3M6A A;  3A46 A;  3HU2 A;  1MW5 A;  2KXE A;  1N36 M;  3SAT A;  4GC9 A;  4DV4 M;  3GLF E;  5JI3 E;  4LF5 M;  1IXS B;  5H37 D;  4WW0 A;  2Y21 A;  1SXJ D;  3LMM A;  1I94 M;  3GRU A;  3TWM A;  1IN6 A;  1N33 M;  1PJI A;  3U6E A;  4G4R A;  1X37 A;  3HU3 A;  3T15 A;  3B9P A;  4LFB M;  3CF2 A;  3J81 S;  4GHL A;  4OW0 A;  2D7H A;  2V1C A;  4JI6 M;  4X66 M;  2QP9 X;  4II7 A;  1I4W A;  3T38 A;  4LG2 A;  1HT1 E;  1XMO M;  2R45 A;  2BJW A;  2XEP A;  3ZCB B;  1TGU A;  5KO3 A;  1N34 M;  2XZU A;  3L25 A;  2GNO A;  3NWL A;  3EIH A;  4IBD A;  5ITQ A;  1GVN A;  4QNR A;  4B3M M;  1G41 A;  3BGE A;  1UM8 A;  2CFO A;  2ZAN A;  4MH0 E;  1J7K A;  3PFI A;  4X64 M;  2UU9 M;  5E6J A;  2Q2E B;  4LJA A;  4NSR A;  1ZAE A;  4JI3 M;  2DZO B;  3GO8 A;  2F5S A;  4GHA A;  4IBC A;  3GLH A;  3FYC A;  2Z3X A;  2R18 A;  4L78 A;  3GPY A;  4PT5 A;  3R9X B;  4LFC M;  1NHW C;  4HLQ A;  4EIW A;  4QOS A;  2VII A;  3KW6 A;  5EP2 A;  2XFS A;  3UGJ A;  1TH3 A;  4B3R M;  1YE9 A;  4BB9 A;  3HGI A;  3UMM A;  4MGH A;  3M0E A;  1KYI A;  3QWL A;  1JQJ C;  3TWK A;  4IBI A;  2D7E A;  2YFQ A;  2UXD M;  4M9X A;  4YHH M;  3RE8 A;  1GL6 A;  1XC8 A;  4MGZ E;  3GRV A;  1HQC A;  2V6Z M;  4IIW A;  5EXP A;  1T3T A;  5ITT A;  3CTW B;  3U60 B;  4BLC A;  3FUW A;  1QQW A;  3ILK A;  4LGM A;  2XGN A;  3AL0 C;  1L1Z A;  4NSO B;  1IQP A;  1XXH A;  3D8L A;  4LY6 A;  3I4Y A;  2R4E A;  2UXB M;  4CHD A;  1J5E M;  1IBM M;  2XZF A;  2DVW B;  4LRT A;  4CHT B;  3THG A;  1E94 E;  4CGY B;  4GMQ A;  1XNR M;  2CUZ A;  4LCB A;  2ZM6 M;  2KRU A;  3R8F A;  4JXJ A;  1E32 A;  2O5R A;  1ORY B;  4NRV A;  3I51 A;  5BR8 M;  1K3W A;  1OFH A;  2F5O A;  1DO0 A;  4IBB A;  2XFT A;  2LWX A;  4I81 A;  3J27 B;  3UK6 A;  4IJE A;  1DGH B;  3WHK A;  2ZAO A;  5DYG A;  4TUW A;  4LF7 M;  3K8Z A;  3SAW A;  2I7N A;  2OQ4 A;  3HJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...