3U5ZA

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 46
structure length 186
sequence length 186
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zA03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zA02
3U61A 3U60A 3U5ZA
chains in the Genus database with same CATH superfamily
3D8LA 3U60A 7CATA 1X37A 1YE9A 2GNOA 2Z3XA 3CTWB 3M0EA 2LVOC 2V1CA 3HZJA 3BOSA 2JNHA 4MGIE 3E46A 3ZC7B 2F4VM 2R9GA 3PNVA 1DGHA 3RGSA 4M0DA 2M60A 3W0LB 2CE7A 3KXEC 4JI3M 1SXJA 2R4JA 2BJVA 4DR7M 1R5LA 4MGZE 4NSOB 3HU2A 1XMQM 2VIIA 4LZZA 2DWMA 1NV9A 1AUAA 1YLAA 3T15A 3GRYA 4LFBM 4QHTA 4IBIA 2ZTDA 1ZQ9A 1EE8A 1HQCA 5DYGA 3AOEC 3CGWA 5EXPA 4ZPXA 1G41A 2BJWA 4HL4A 2ZAMA 3ZH9B 1HNWM 1GO5A 1IN8A 2XF3A 4YY3M 1XMOM 1D0MA 1BVSA 4L15A 5IWAM 2M5ZA 1HJPA 1NJGA 4GC5A 4JI5M 1QANA 3QYBA 2KRUA 1UM8A 3AFHA 2DWZB 2OQ4A 1GLNA 4IBFA 3GLIE 1PM5A 2Z4RA 4MM3B 2MROB 2MJ5B 2WSFF 4MGKE 2YQZA 2Q2EB 2C9OA 3GLGA 4X64M 3FRIA 3SASA 3DA1A 4KHPM 2HHHM 4DV4M 3GRVA 5FSWA 4PDGA 4NSRA 3HU3A 4IJFA 3KOYE 3L27A 1TTEA 1OFHA 3NWLA 4LGMA 4LRSA 2R46A 5EP1A 3GLHE 4L4UA 4JI7M 3SFZA 2XFSA 4II7A 3ILKA 3OTOM 4X66M 1DGGA 2JXNA 4PCZA 4P17A 3J2PB 2D7GA 2KEBA 2YNMD 2KNVA 3IG8A 3FTCA 4LCBA 5KO3A 2V6ZM 1NSFA 4YHHM 5LMUM 1VDLA 5FTKA 3BXWA 4IBBA 3FTEA 1QZEA 3FUUA 3KOWE 1L2CA 2JY5A 3AOEA 3A46A 3JR5A 1HNXM 3MJ5A 4L6V6 2R45A 4M0WA 1EFUB 1QQWA 3HU1A 1LV7A 3U61A 2OPFA 4DV1M 1OIPA 1IBLM 3H4MA 3GO8A 1IN4A 3U6MA 3M6AA 2K47A 2F5QA 2G8LA 2OO9A 1TR8A 3CF2A 1TDHA 2DWLA 2R6FA 2KNZA 3HJQA 1XB2B 2XZUA 4I81A 4R71A 3UGJA 1L2BA 4QOZC 4AG5A 1QDRA 2C9CA 3K1JA 4CHTB 4TUWA 1RU3A 1N33M 3A98B 1NNUC 1TH2A 4GHAA 3B9PA 2KZUA 4Y28F 2O25A 1OKSA 1XXHB 4MB7A 4DR5M 3A45A 3SBJA 1ZMVA 3HJ8A 3E21A 3AJIB 2B3TA 2H1RA 2C5RA 2JP7A 1QDTA 2DHYA 2HCBA 2NQ8C 1LTMA 4KT0F 5ITRA 1HNZM 2QCUA 3FUVA 3U5ZA 3VDPA 3J7AS 2N35A 3HHWA 4IBGA 1PJTA 2DAIA 4JXJA 5DFLA 4JI0M 2EUCA 2XSZA 2R44A 1QUTA 4GIPA 4G4QA 2W82A 2HKJA 5GKNA 2CHVA 5DYIA 1QUSA 1UFZA 3GLGE 2UXBM 2KXEA 2G3QA 1G4AE 3GLFA 4G4OA 2UUBM 1IQPA 4B7FA 1R4GA 4AQYM 3TWLA 1G59A 3C9PA 2XGNA 2CV1A 1J09A 4Z8XA 1MX0A 2ZM6M 4NC6A 4XK8F 2A5YB 3HWSA 1W5SA 3KW6A 5EXTA 3K92A 3WHLA 4MGHA 3VK7A 3T6PA 4B3RM 4RKUF 1WGLA 2CHQA 4JI2M 1T43A 4DV7M 4FWGA 1IXRC 1V92A 3GPXA 5EP4A 2XLJA 5BR8M 1N32M 2QBYB 1J7KA 3TL4X 2BWBA 4LY6A 2DI0A 3NBIA 4WW0A 1GL6A 3J81S 2CRUA 2F5OA 2DZNB 3T38A 3HHYA 2Z8YM 3J27B 2CV0A 3W67A 3H4JA 4IJEA 3K9PA 3WHKA 3KP1E 4AKIA 1Z5BA 5FTMA 2WSEF 3MHVC 3VKGA 5FTNA 3U6EA 2QZ4A 3ES5A 1QYRA 4LJ8A 4IBCA 5LMNM 2KW0A 3DZDA 4I8OA 2OOBA 2XSZD 3RC8A 3GQ5A 2JA2A 1WGNA 2EKFA 3GLHB 1Q39A 3LCUA 4UN2B 2UUCM 4FCVA 5DNYA 4LF7M 4LJ5A 1GKIA 2JY7A 4NRWA 1VEKA 3GQ4A 3SYKA 2Y0TA 4LF8M 4HEOA 4AG6A 4S12A 4LJ6A 4G6ZA 3L28A 1OIZA 2ZBKB 3HHXA 3LQQA 3U6LA 3HGIA 3L29A 1MU5A 1VQ1A 3KS8A 1G8PA 2H5XA 1XWIA 2O5RA 3FTFA 4GKJM 3V76A 4GHLA 5KPTA 4GC9A 4OVZB 4G4RA 2R0IA 3M7GA 1T6OA 2O01F 1JB0F 3B7NA 5A2QS 1OAIA 3LQRA 4CISA 3SYLA 4AKGA 3U6OA 1J5EM 1C1KA 2LHCA 3VLFB 4D82A 4DUYM 2QW6A 4RNAA 1JR3A 2Y0QA 2CHGA 3KSJA 3HJSA 4FW9A 2DZOB 1KFVA 2DZLA 1SXJD 2CV2A 4KO8A 3FE3A 4X62M 2KDLA 5ITYA 4JI1M 1GL7A 1QAQA 4XBOA 2LNHC 3L25A 5ITTA 4X65M 2R65A 4XGIA 3GPYA 1D0LA 3GRRA 1R2YA 4G4NA 1VG5A 5EXXA 1N34M 4LG2A 4CIZA 1L8QA 1R6BX 3Q8XA 3SHFA 3U6SA 2J5YA 4AW4A 3KFUG 1WR1B 3E4RA 4NRVA 2DVWB 1K82A 1D2NA 1XC8A 1G71A 2DAMA 3EIHA 4DV0M 3QYEA 1NY6A 2LVPC 3UMMA 4JI6M 4K0KM 1L1TA 3J80S 2VQEM 4DR3M 1XXHA 2ERCA 2QPAA 3GLGB 1QAOA 1OQYA 2D7EA 4LJAA 1L2DA 4D80A 1IBKM 5C1BA 2L4EA 2L09A 3BGEA 2C98A 1VEGA 3SHGB 1YSYA 3GRUA 1SXJE 3TPZA 3UZUA 3LVWA 1IXSB 2F5NA 4Q7JA 4BB9A 3F92A 3IECA 4B3TM 4DR4M 1HR0M 1JR3D 5E26A 3RC3A 1TH3A 1K3WA 1MN3A 1PGYA 2K9DA 4NOOB 3SARA 1R7RA 3SAWA 3AV0A 3K9OA 4B08A 2QSFX 3ZCBB 2HL7A 3DOAA 1AIPC 1OFIA 2DXIA 2DENA 2F5PA 1TF0B 4QNMA 2YFQA 8CATA 4I5SA 4OX9M 4JV5M 1NO1A 2KZSA 3FRHA 3HX3A 2RRUA 2FNAA 3B7ZA 2DAGA 4PT5A 1I4WA 2LBCA 2R4EA 3U6PA 1OAOC 2DKLA 1E9SA 3B89A 4NXNM 1IBMM 4F1IA 5ITXA 1EIJA 4KLNA 1HT1E 3LW5F 1ZMWA 3KP0E 3PNYA 1XNQM 2J7OA 2YR0A 1IFYA 4QHSA 3VK8A 2FFJA 2J7NA 1DO0A 4FWHA 2L7HA 2I7PA 2JZ1A 3TQSA 4B3MM 1PJSA 3CF6E 3TE6A 4DV2M 2L2DA 1FNNA 1JR3E 3B74A 5E6JA 5FTLA 3UJNA 2ZTCA 4LF6M 2EJSA 3CF0A 1MW5A 2CP8A 2KA6B 3KSXA 4B3SM 2DHRA 3FD9A 3SC3A 2XFTA 4A3VB 2L6OA 2KHHA 3I51A 3W0FA 3GLHA 3U5ZB 1IXZA 3GLIB 2FH0A 4QNRA 1IY2A 4LRTA 5ITQA 4GEWA 1OTRA 2JY6B 3T1YM 4W5WA 4L8RC 4GRIA 1YUBA 1N77A 3VFDA 1MJGM 3CTDA 1TDZA 4CHDA 4DV5M 1XXHE 3LMMA 1HQYE 1GVNA 1NV8A 3DFZA 4PDIA 5F3WA 3R9XB 2VF8A 1N78A 3GPPA 2LVAA 5JI3E 1NJFA 4AKHA 4DR2M 5L8RF 2F5SA 3I4YA 4FCWA 4ITQA 1NVMA 4WURA 1QZMA 2AHMA 2RGHA 2FS1A 4LJ4A 2KNAA 1C7YA 3K2LA 4M9ZA 1QVRA 3C3DA 4WP2A 2CEAA 1HT2E 4EIWA 1R2ZA 5EJCA 2JY8A 2I7NA 2LTUA 3LCVB 2QQ8A 2BNKA 5EP2A 1Z5CA 4PD2A 2VDBB 3HY5A 3U6QA 4RF0A 1GJTA 1K3XA 1V33A 1IY0A 3BBZA 4HLQA 4P16A 4FD2A 5BPVA 4BBAA 2WZJA 3FYDA 5EXSA 4DUZM 2Z7JA 3VDUA 3U60B 2APLA 4F2LA 2RKOA 3R8FA 3U6CA 2CWBA 3RGPA 4FCTA 1WIVA 4M9SA 1DGHB 1Z6TA 5ITXE 4NL4H 4IBJA 1N36M 3MK6A 3HHZA 4D81A 1G3IA 1SXJB 4MH0E 3L26A 2MR9A 2L7IA 3ZQJA 4GITA 1NHGC 3GLFE 4LJ9A 4AZFA 4DV3M 3RFWA 3FUXA 1PJIA 3SATA 4NXMM 5JI2E 5IT9S 1ZAEA 3U6DA 1Z59A 4Z6YA 2MGWA 3THGA 2JUJA 4JI8M 2G5GX 1NNJA 1JQJC 1OJLA 3FUWA 3I04M 2K0BX 1E32A 5C18A 2Y20A 2FE8A 1CUKA 3SAUA 3SMSA 3C58A 1E9RA 4OW0A 4KODA 5EP3A 5KPRA 2X4AA 3PFIA 1IN7A 1XHBA 4FVMA 2JZ0A 4GH9A 1P3QQ 3L2AA 4MGYE 2ZAOA 2UUAM 4LFAM 1IXSA 4GKKM 2DNAA 3EIEA 1E94E 4GMQA 1A5TA 2GQFA 1DGFA 1PJQA 2EKKA 2UU9M 3GPUA 4RF1A 4LF4M 2DWNA 5FLXS 2X49A 2JWSA 3KOXE 1F4IA 4REZA 3GP1A 4LFCM 2HWJA 2QHOB 1SG9A 1Y8GA 4M9XA 3FUTA 1V34A 1H6UA 5EQTA 1TH4A 4R7GA 5FTJA 4L16A 2LHGA 1KYIA 1TGUA 3E9SA 1WJ7A 4IBDA 2LWXA 3SMPA 2R62A 2P5TA 1I94M 4IBEA 2Z4SA 4LZJA 4DV6M 2MH8A 2FOIC 4CGYB 5IZ7D 5KPZA 1L1ZA 4B7GA 2BWEA 3QAUA 1Q3BA 3IHPA 4IBKA 4JN6A 3AOGA 3FTDA 1IN5A 2C99A 1DO2A 1ZMUA 2L4FA 4DR6M 3HKPA 3U61B 4R3DA 2C96A 3KS4A 1VDDA 2EO2A 3NBXX 1ZV1A 2DAEA 3Q8GA 1NY5A 1DGBA 2LXEA 4QOSA 2QNJA 3TWMA 2XH9A 3QWLA 2VQFM 2EA0A 1ORYB 1D0KA 2D7HA 2UXCM 4JI4M 2QBYA 3I4VA 4I4LA 4LF9M 2K6BA 1GABA 2E5LM 1T3TA 4OU7A 4L78A 3SAVA 1GJSA 1IM2A 1QAMA 4G3OA 1Z5AA 3GLIA 2Y21A 4DBGB 5ITUA 2X8AA 4IIWA 4BLCA 1WXQA 3AKZA 5H37D 2XZFA 2V1UA 3JR4A 1VEJA 2CFOA 1Q02A 1SXJC 1IN6A 1N75A 3D8BA 2QENA 2XEPA 3IG5A 3RE8A 3W68A 3A42A 4CJ6A 3LVVA 4DR1M 2QP9X 1IY1A 5KQ8A 2RGOA 3FKEA 4LJ7A 3B7QA 2ZANA 2UXDM 3T1HM 4AI6A 2LH0A 3KVWA 4LF5M 1S3SA 4JYAM 1Q3CA 4ANRA 2HAKA 3GQ3A 2LVQD 3FYCA 3AL0C 3MMPA 5IREB 1KSFX 1PJJA 3C3EA 2CUZA 2KRKA 3KDSE 2VF7A 1WHCA 1FJGM 3K8ZA 4B7HA 1XNRM 2R18A 1W5TA 2LVNC 4LGYA 3GLFB 1NHWC 4FWDA 3TWKA 1DV0A 2OOAA 2WSCF 3KOZE 3PXGA 3I01M 3VKHA 3JAMS 1PRBA 3UK6A 4OVZA 5KQDA 2DAKA 3J7BA 3PVSA
chains in the Genus database with same CATH topology
3D8LA 3U60A 7CATA 1X37A 1YE9A 2Z3XA 2GNOA 3CTWB 3M0EA 2V1CA 4MGIE 3BOSA 3ZC7B 2R9GA 2F4VM 3PNVA 1DGHA 3RGSA 4M0DA 2M60A 3W0LB 2CE7A 3KXEC 4JI3M 1SXJA 2R4JA 2BJVA 4DR7M 4MGZE 4NSOB 3HU2A 1XMQM 2VIIA 4LZZA 2DWMA 3T15A 4LFBM 3GRYA 4QHTA 4IBIA 1ZQ9A 1EE8A 1HQCA 5DYGA 3AOEC 5EXPA 4ZPXA 1G41A 2BJWA 4HL4A 2ZAMA 3ZH9B 1HNWM 1IN8A 2XF3A 4YY3M 1XMOM 4L15A 5IWAM 2M5ZA 4JI5M 1NJGA 4GC5A 1QANA 2KRUA 1UM8A 3AFHA 2DWZB 2OQ4A 1GLNA 4IBFA 3GLIE 1PM5A 2Z4RA 4MM3B 4MGKE 2YQZA 2Q2EB 2C9OA 3GLGA 4X64M 3SASA 3DA1A 4KHPM 2HHHM 4DV4M 3GRVA 5FSWA 4PDGA 4NSRA 3HU3A 4IJFA 3KOYE 3L27A 4LGMA 1OFHA 3NWLA 4LRSA 5EP1A 2R46A 3JAMS 4L4UA 4JI7M 3GLHE 3SFZA 2XFSA 4II7A 3ILKA 3OTOM 4X66M 1DGGA 4PCZA 3J2PB 2D7GA 2KEBA 2YNMD 3IG8A 3FTCA 4LCBA 5KO3A 2V6ZM 1NSFA 4YHHM 5LMUM 5FTKA 4IBBA 3FTEA 3FUUA 1L2CA 3KOWE 3A46A 3AOEA 3JR5A 1HNXM 3MJ5A 2R45A 4M0WA 1QQWA 3HU1A 1LV7A 3U61A 2OPFA 4DV1M 1IBLM 3H4MA 3GO8A 1IN4A 3U6MA 3M6AA 2K47A 2F5QA 2G8LA 3CF2A 1TDHA 2DWLA 3HJQA 2XZUA 4I81A 1L2BA 3UGJA 4QOZC 4AG5A 2C9CA 3K1JA 4CHTB 4TUWA 1N33M 3A98B 1NNUC 1TH2A 4GHAA 3B9PA 2KZUA 1XXHB 4MB7A 4DR5M 3A45A 3SBJA 3HJ8A 3AJIB 2C5RA 2H1RA 2NQ8C 2HCBA 5ITRA 1HNZM 2QCUA 3FUVA 3U5ZA 3VDPA 3J7AS 3HHWA 4IBGA 4JXJA 4JI0M 2EUCA 2XSZA 4GIPA 4G4QA 2W82A 2HKJA 5GKNA 2CHVA 5DYIA 3GLGE 2UXBM 2KXEA 3GLFA 1G4AE 4G4OA 2UUBM 1IQPA 4B7FA 4AQYM 1G59A 3TWLA 2XGNA 2CV1A 1J09A 4Z8XA 1MX0A 2ZM6M 2A5YB 3HWSA 1W5SA 3KW6A 5EXTA 3K92A 3WHLA 4MGHA 3VK7A 4B3RM 2CHQA 4JI2M 4DV7M 4FWGA 1IXRC 3GPXA 5EP4A 2XLJA 5BR8M 1N32M 2QBYB 1J7KA 3TL4X 4LY6A 3NBIA 4WW0A 1GL6A 3J81S 2F5OA 2DZNB 3T38A 3HHYA 2CV0A 3J27B 4IJEA 3WHKA 3KP1E 4AKIA 1Z5BA 5FTMA 3MHVC 3VKGA 5FTNA 3U6EA 2QZ4A 3ES5A 1QYRA 4LJ8A 4IBCA 5LMNM 2KW0A 3DZDA 4I8OA 2XSZD 3RC8A 3GQ5A 2JA2A 3GLHB 1Q39A 2UUCM 4FCVA 5DNYA 4LF7M 4LJ5A 1GKIA 4NRWA 3GQ4A 3SYKA 2Y0TA 4LF8M 4AG6A 4S12A 4LJ6A 4G6ZA 3L28A 2ZBKB 3HHXA 3LQQA 3L29A 3HGIA 1MU5A 3KS8A 1G8PA 2O5RA 1XWIA 3FTFA 4GKJM 4GHLA 5KPTA 4GC9A 4OVZB 4G4RA 3M7GA 5A2QS 3LQRA 3SYLA 4AKGA 3U6OA 1J5EM 1C1KA 3VLFB 4D82A 4DUYM 2QW6A 4RNAA 1JR3A 2Y0QA 2CHGA 3KSJA 3HJSA 4FW9A 2DZOB 1KFVA 1SXJD 2CV2A 4KO8A 4X62M 5ITYA 4JI1M 1GL7A 1QAQA 4XBOA 2LNHC 3L25A 5ITTA 4X65M 2R65A 4XGIA 3GPYA 3GRRA 1R2YA 4G4NA 5EXXA 1N34M 4LG2A 1L8QA 1R6BX 3Q8XA 3SHFA 3U6SA 4AW4A 3KFUG 3E4RA 4NRVA 2DVWB 1K82A 1D2NA 1XC8A 3EIHA 4DV0M 1NY6A 4K0KM 3UMMA 4JI6M 1L1TA 3J80S 2VQEM 4DR3M 1XXHA 2ERCA 2QPAA 3GLGB 1QAOA 2D7EA 4LJAA 1L2DA 4D80A 1IBKM 5C1BA 3BGEA 2L09A 2C98A 3SHGB 1YSYA 3GRUA 1SXJE 3TPZA 3UZUA 3LVWA 1IXSB 2F5NA 4BB9A 4DR4M 4B3TM 1HR0M 1JR3D 5E26A 3RC3A 1TH3A 1K3WA 4NOOB 3SARA 1R7RA 3SAWA 3AV0A 4B08A 3ZCBB 2HL7A 3DOAA 1OFIA 2DXIA 2F5PA 4QNMA 2YFQA 8CATA 4I5SA 4OX9M 4JV5M 2KZSA 2FNAA 4PT5A 1I4WA 2R4EA 3U6PA 1E9SA 4NXNM 1IBMM 5ITXA 4KLNA 1HT1E 3KP0E 3PNYA 1XNQM 2J7OA 2YR0A 4QHSA 3VK8A 2FFJA 2J7NA 1DO0A 4FWHA 2L7HA 2I7PA 3TQSA 4B3MM 3TE6A 3CF6E 4DV2M 1FNNA 1JR3E 5E6JA 5FTLA 3UJNA 4LF6M 3CF0A 1MW5A 2KA6B 3KSXA 4B3SM 2DHRA 3FD9A 2XFTA 4A3VB 2L6OA 3I51A 3W0FA 3GLHA 3U5ZB 1IXZA 3GLIB 4QNRA 1IY2A 4LRTA 5ITQA 3T1YM 4W5WA 4L8RC 4GRIA 1YUBA 1N77A 3VFDA 3CTDA 1TDZA 4CHDA 4DV5M 3LMMA 1XXHE 1HQYE 1GVNA 3DFZA 4PDIA 5F3WA 3R9XB 1N78A 3GPPA 5JI3E 1NJFA 4AKHA 4DR2M 2F5SA 3I4YA 4FCWA 4ITQA 1NVMA 4WURA 1QZMA 2AHMA 2RGHA 4LJ4A 3K2LA 4M9ZA 1QVRA 2CEAA 1HT2E 4EIWA 1R2ZA 5EJCA 2I7NA 2BNKA 5EP2A 1Z5CA 4PD2A 3U6QA 4RF0A 1K3XA 1IY0A 4HLQA 4P16A 5BPVA 4FD2A 4CISA 4BBAA 5EXSA 3FYDA 3U60B 4DUZM 2Z7JA 3VDUA 3R8FA 2RKOA 3U6CA 3RGPA 4FCTA 4M9SA 1DGHB 1Z6TA 5ITXE 4NL4H 4IBJA 1N36M 3MK6A 3HHZA 4D81A 1G3IA 1SXJB 4MH0E 3L26A 2L7IA 3GLFE 4GITA 1NHGC 4DV3M 4LJ9A 4AZFA 3SATA 3RFWA 3FUXA 1PJIA 4NXMM 5IT9S 5JI2E 1ZAEA 3U6DA 1Z59A 4Z6YA 3THGA 4JI8M 2G5GX 1NNJA 1JQJC 1OJLA 3FUWA 1E32A 5C18A 2Y20A 2FE8A 3SAUA 3SMSA 3C58A 1E9RA 4OW0A 4KODA 5EP3A 5KPRA 2X4AA 3PFIA 1IN7A 1XHBA 4FVMA 4GH9A 4MGYE 3L2AA 5IREB 3SC3A 2ZAOA 2UUAM 4LFAM 4GKKM 3EIEA 1E94E 4GMQA 1A5TA 1DGFA 2UU9M 3GPUA 4RF1A 4LF4M 2DWNA 5FLXS 2X49A 3KOXE 4REZA 3GP1A 4LFCM 4M9XA 3FUTA 1H6UA 5EQTA 1TH4A 4R7GA 5FTJA 4L16A 1KYIA 1TGUA 3E9SA 4IBDA 2LWXA 3SMPA 2R62A 2P5TA 1I94M 4IBEA 2Z4SA 4LZJA 4DV6M 2FOIC 4CGYB 5IZ7D 5KPZA 1L1ZA 4B7GA 3QAUA 1Q3BA 4IBKA 4JN6A 3AOGA 3FTDA 1IN5A 2C99A 1DO2A 4DR6M 3HKPA 3U61B 4R3DA 2C96A 3KS4A 1VDDA 2EO2A 3TWMA 1NY5A 1DGBA 2LXEA 4QOSA 2XH9A 3QWLA 2VQFM 2EA0A 1ORYB 2D7HA 2UXCM 4JI4M 2QBYA 3I4VA 4I4LA 4LF9M 2E5LM 1T3TA 4OU7A 4L78A 3SAVA 1IM2A 1QAMA 1Z5AA 3GLIA 2Y21A 5ITUA 2X8AA 4IIWA 4BLCA 1WXQA 3AKZA 5H37D 2XZFA 2V1UA 3JR4A 3D8BA 2CFOA 1SXJC 3RE8A 3IG5A 1IN6A 1N75A 2QENA 2XEPA 3U6LA 3A42A 3LVVA 4DR1M 2QP9X 1IY1A 5KQ8A 2RGOA 3FKEA 4LJ7A 4AI6A 2ZANA 2UXDM 3T1HM 2LH0A 3KVWA 4LF5M 1S3SA 4JYAM 1Q3CA 3GQ3A 3FYCA 3AL0C 1KSFX 1PJJA 2CUZA 2KRKA 3KDSE 1FJGM 3K8ZA 4B7HA 1XNRM 2R18A 1W5TA 3GLFB 4LGYA 1NHWC 4FWDA 3TWKA 3PXGA 3KOZE 3VKHA 3UK6A 4OVZA 5KQDA 3J7BA 3PVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U60 A;  3U5Z A; 
#chains in the Genus database with same CATH topology
 3D8L A;  3U60 A;  7CAT A;  1X37 A;  1YE9 A;  2GNO A;  2Z3X A;  3CTW B;  3M0E A;  2LVO C;  2V1C A;  3HZJ A;  3BOS A;  2JNH A;  4MGI E;  3E46 A;  3ZC7 B;  2F4V M;  2R9G A;  3PNV A;  1DGH A;  3RGS A;  4M0D A;  2M60 A;  3W0L B;  2CE7 A;  3KXE C;  4JI3 M;  1SXJ A;  2R4J A;  2BJV A;  4DR7 M;  1R5L A;  4MGZ E;  4NSO B;  3HU2 A;  1XMQ M;  2VII A;  4LZZ A;  2DWM A;  1NV9 A;  1AUA A;  1YLA A;  3T15 A;  3GRY A;  4LFB M;  4QHT A;  4IBI A;  2ZTD A;  1ZQ9 A;  1EE8 A;  1HQC A;  5DYG A;  3AOE C;  3CGW A;  5EXP A;  4ZPX A;  1G41 A;  2BJW A;  4HL4 A;  2ZAM A;  3ZH9 B;  1HNW M;  1GO5 A;  1IN8 A;  2XF3 A;  4YY3 M;  1XMO M;  1D0M A;  1BVS A;  4L15 A;  5IWA M;  2M5Z A;  1HJP A;  1NJG A;  4GC5 A;  4JI5 M;  1QAN A;  3QYB A;  2KRU A;  1UM8 A;  3AFH A;  2DWZ B;  2OQ4 A;  1GLN A;  4IBF A;  3GLI E;  1PM5 A;  2Z4R A;  4MM3 B;  2MRO B;  2MJ5 B;  2WSF F;  4MGK E;  2YQZ A;  2Q2E B;  2C9O A;  3GLG A;  4X64 M;  3FRI A;  3SAS A;  3DA1 A;  4KHP M;  2HHH M;  4DV4 M;  3GRV A;  5FSW A;  4PDG A;  4NSR A;  3HU3 A;  4IJF A;  3KOY E;  3L27 A;  1TTE A;  1OFH A;  3NWL A;  4LGM A;  4LRS A;  2R46 A;  5EP1 A;  3GLH E;  4L4U A;  4JI7 M;  3SFZ A;  2XFS A;  4II7 A;  3ILK A;  3OTO M;  4X66 M;  1DGG A;  2JXN A;  4PCZ A;  4P17 A;  3J2P B;  2D7G A;  2KEB A;  2YNM D;  2KNV A;  3IG8 A;  3FTC A;  4LCB A;  5KO3 A;  2V6Z M;  1NSF A;  4YHH M;  5LMU M;  1VDL A;  5FTK A;  3BXW A;  4IBB A;  3FTE A;  1QZE A;  3FUU A;  3KOW E;  1L2C A;  2JY5 A;  3AOE A;  3A46 A;  3JR5 A;  1HNX M;  3MJ5 A;  4L6V 6;  2R45 A;  4M0W A;  1EFU B;  1QQW A;  3HU1 A;  1LV7 A;  3U61 A;  2OPF A;  4DV1 M;  1OIP A;  1IBL M;  3H4M A;  3GO8 A;  1IN4 A;  3U6M A;  3M6A A;  2K47 A;  2F5Q A;  2G8L A;  2OO9 A;  1TR8 A;  3CF2 A;  1TDH A;  2DWL A;  2R6F A;  2KNZ A;  3HJQ A;  1XB2 B;  2XZU A;  4I81 A;  4R71 A;  3UGJ A;  1L2B A;  4QOZ C;  4AG5 A;  1QDR A;  2C9C A;  3K1J A;  4CHT B;  4TUW A;  1RU3 A;  1N33 M;  3A98 B;  1NNU C;  1TH2 A;  4GHA A;  3B9P A;  2KZU A;  4Y28 F;  2O25 A;  1OKS A;  1XXH B;  4MB7 A;  4DR5 M;  3A45 A;  3SBJ A;  1ZMV A;  3HJ8 A;  3E21 A;  3AJI B;  2B3T A;  2H1R A;  2C5R A;  2JP7 A;  1QDT A;  2DHY A;  2HCB A;  2NQ8 C;  1LTM A;  4KT0 F;  5ITR A;  1HNZ M;  2QCU A;  3FUV A;  3U5Z A;  3VDP A;  3J7A S;  2N35 A;  3HHW A;  4IBG A;  1PJT A;  2DAI A;  4JXJ A;  5DFL A;  4JI0 M;  2EUC A;  2XSZ A;  2R44 A;  1QUT A;  4GIP A;  4G4Q A;  2W82 A;  2HKJ A;  5GKN A;  2CHV A;  5DYI A;  1QUS A;  1UFZ A;  3GLG E;  2UXB M;  2KXE A;  2G3Q A;  1G4A E;  3GLF A;  4G4O A;  2UUB M;  1IQP A;  4B7F A;  1R4G A;  4AQY M;  3TWL A;  1G59 A;  3C9P A;  2XGN A;  2CV1 A;  1J09 A;  4Z8X A;  1MX0 A;  2ZM6 M;  4NC6 A;  4XK8 F;  2A5Y B;  3HWS A;  1W5S A;  3KW6 A;  5EXT A;  3K92 A;  3WHL A;  4MGH A;  3VK7 A;  3T6P A;  4B3R M;  4RKU F;  1WGL A;  2CHQ A;  4JI2 M;  1T43 A;  4DV7 M;  4FWG A;  1IXR C;  1V92 A;  3GPX A;  5EP4 A;  2XLJ A;  5BR8 M;  1N32 M;  2QBY B;  1J7K A;  3TL4 X;  2BWB A;  4LY6 A;  2DI0 A;  3NBI A;  4WW0 A;  1GL6 A;  3J81 S;  2CRU A;  2F5O A;  2DZN B;  3T38 A;  3HHY A;  2Z8Y M;  3J27 B;  2CV0 A;  3W67 A;  3H4J A;  4IJE A;  3K9P A;  3WHK A;  3KP1 E;  4AKI A;  1Z5B A;  5FTM A;  2WSE F;  3MHV C;  3VKG A;  5FTN A;  3U6E A;  2QZ4 A;  3ES5 A;  1QYR A;  4LJ8 A;  4IBC A;  5LMN M;  2KW0 A;  3DZD A;  4I8O A;  2OOB A;  2XSZ D;  3RC8 A;  3GQ5 A;  2JA2 A;  1WGN A;  2EKF A;  3GLH B;  1Q39 A;  3LCU A;  4UN2 B;  2UUC M;  4FCV A;  5DNY A;  4LF7 M;  4LJ5 A;  1GKI A;  2JY7 A;  4NRW A;  1VEK A;  3GQ4 A;  3SYK A;  2Y0T A;  4LF8 M;  4HEO A;  4AG6 A;  4S12 A;  4LJ6 A;  4G6Z A;  3L28 A;  1OIZ A;  2ZBK B;  3HHX A;  3LQQ A;  3U6L A;  3HGI A;  3L29 A;  1MU5 A;  1VQ1 A;  3KS8 A;  1G8P A;  2H5X A;  1XWI A;  2O5R A;  3FTF A;  4GKJ M;  3V76 A;  4GHL A;  5KPT A;  4GC9 A;  4OVZ B;  4G4R A;  2R0I A;  3M7G A;  1T6O A;  2O01 F;  1JB0 F;  3B7N A;  5A2Q S;  1OAI A;  3LQR A;  4CIS A;  3SYL A;  4AKG A;  3U6O A;  1J5E M;  1C1K A;  2LHC A;  3VLF B;  4D82 A;  4DUY M;  2QW6 A;  4RNA A;  1JR3 A;  2Y0Q A;  2CHG A;  3KSJ A;  3HJS A;  4FW9 A;  2DZO B;  1KFV A;  2DZL A;  1SXJ D;  2CV2 A;  4KO8 A;  3FE3 A;  4X62 M;  2KDL A;  5ITY A;  4JI1 M;  1GL7 A;  1QAQ A;  4XBO A;  2LNH C;  3L25 A;  5ITT A;  4X65 M;  2R65 A;  4XGI A;  3GPY A;  1D0L A;  3GRR A;  1R2Y A;  4G4N A;  1VG5 A;  5EXX A;  1N34 M;  4LG2 A;  4CIZ A;  1L8Q A;  1R6B X;  3Q8X A;  3SHF A;  3U6S A;  2J5Y A;  4AW4 A;  3KFU G;  1WR1 B;  3E4R A;  4NRV A;  2DVW B;  1K82 A;  1D2N A;  1XC8 A;  1G71 A;  2DAM A;  3EIH A;  4DV0 M;  3QYE A;  1NY6 A;  2LVP C;  3UMM A;  4JI6 M;  4K0K M;  1L1T A;  3J80 S;  2VQE M;  4DR3 M;  1XXH A;  2ERC A;  2QPA A;  3GLG B;  1QAO A;  1OQY A;  2D7E A;  4LJA A;  1L2D A;  4D80 A;  1IBK M;  5C1B A;  2L4E A;  2L09 A;  3BGE A;  2C98 A;  1VEG A;  3SHG B;  1YSY A;  3GRU A;  1SXJ E;  3TPZ A;  3UZU A;  3LVW A;  1IXS B;  2F5N A;  4Q7J A;  4BB9 A;  3F92 A;  3IEC A;  4B3T M;  4DR4 M;  1HR0 M;  1JR3 D;  5E26 A;  3RC3 A;  1TH3 A;  1K3W A;  1MN3 A;  1PGY A;  2K9D A;  4NOO B;  3SAR A;  1R7R A;  3SAW A;  3AV0 A;  3K9O A;  4B08 A;  2QSF X;  3ZCB B;  2HL7 A;  3DOA A;  1AIP C;  1OFI A;  2DXI A;  2DEN A;  2F5P A;  1TF0 B;  4QNM A;  2YFQ A;  8CAT A;  4I5S A;  4OX9 M;  4JV5 M;  1NO1 A;  2KZS A;  3FRH A;  3HX3 A;  2RRU A;  2FNA A;  3B7Z A;  2DAG A;  4PT5 A;  1I4W A;  2LBC A;  2R4E A;  3U6P A;  1OAO C;  2DKL A;  1E9S A;  3B89 A;  4NXN M;  1IBM M;  4F1I A;  5ITX A;  1EIJ A;  4KLN A;  1HT1 E;  3LW5 F;  1ZMW A;  3KP0 E;  3PNY A;  1XNQ M;  2J7O A;  2YR0 A;  1IFY A;  4QHS A;  3VK8 A;  2FFJ A;  2J7N A;  1DO0 A;  4FWH A;  2L7H A;  2I7P A;  2JZ1 A;  3TQS A;  4B3M M;  1PJS A;  3CF6 E;  3TE6 A;  4DV2 M;  2L2D A;  1FNN A;  1JR3 E;  3B74 A;  5E6J A;  5FTL A;  3UJN A;  2ZTC A;  4LF6 M;  2EJS A;  3CF0 A;  1MW5 A;  2CP8 A;  2KA6 B;  3KSX A;  4B3S M;  2DHR A;  3FD9 A;  3SC3 A;  2XFT A;  4A3V B;  2L6O A;  2KHH A;  3I51 A;  3W0F A;  3GLH A;  3U5Z B;  1IXZ A;  3GLI B;  2FH0 A;  4QNR A;  1IY2 A;  4LRT A;  5ITQ A;  4GEW A;  1OTR A;  2JY6 B;  3T1Y M;  4W5W A;  4L8R C;  4GRI A;  1YUB A;  1N77 A;  3VFD A;  1MJG M;  3CTD A;  1TDZ A;  4CHD A;  4DV5 M;  1XXH E;  3LMM A;  1HQY E;  1GVN A;  1NV8 A;  3DFZ A;  4PDI A;  5F3W A;  3R9X B;  2VF8 A;  1N78 A;  3GPP A;  2LVA A;  5JI3 E;  1NJF A;  4AKH A;  4DR2 M;  5L8R F;  2F5S A;  3I4Y A;  4FCW A;  4ITQ A;  1NVM A;  4WUR A;  1QZM A;  2AHM A;  2RGH A;  2FS1 A;  4LJ4 A;  2KNA A;  1C7Y A;  3K2L A;  4M9Z A;  1QVR A;  3C3D A;  4WP2 A;  2CEA A;  1HT2 E;  4EIW A;  1R2Z A;  5EJC A;  2JY8 A;  2I7N A;  2LTU A;  3LCV B;  2QQ8 A;  2BNK A;  5EP2 A;  1Z5C A;  4PD2 A;  2VDB B;  3HY5 A;  3U6Q A;  4RF0 A;  1GJT A;  1K3X A;  1V33 A;  1IY0 A;  3BBZ A;  4HLQ A;  4P16 A;  4FD2 A;  5BPV A;  4BBA A;  2WZJ A;  3FYD A;  5EXS A;  4DUZ M;  2Z7J A;  3VDU A;  3U60 B;  2APL A;  4F2L A;  2RKO A;  3R8F A;  3U6C A;  2CWB A;  3RGP A;  4FCT A;  1WIV A;  4M9S A;  1DGH B;  1Z6T A;  5ITX E;  4NL4 H;  4IBJ A;  1N36 M;  3MK6 A;  3HHZ A;  4D81 A;  1G3I A;  1SXJ B;  4MH0 E;  3L26 A;  2MR9 A;  2L7I A;  3ZQJ A;  4GIT A;  1NHG C;  3GLF E;  4LJ9 A;  4AZF A;  4DV3 M;  3RFW A;  3FUX A;  1PJI A;  3SAT A;  4NXM M;  5JI2 E;  5IT9 S;  1ZAE A;  3U6D A;  1Z59 A;  4Z6Y A;  2MGW A;  3THG A;  2JUJ A;  4JI8 M;  2G5G X;  1NNJ A;  1JQJ C;  1OJL A;  3FUW A;  3I04 M;  2K0B X;  1E32 A;  5C18 A;  2Y20 A;  2FE8 A;  1CUK A;  3SAU A;  3SMS A;  3C58 A;  1E9R A;  4OW0 A;  4KOD A;  5EP3 A;  5KPR A;  2X4A A;  3PFI A;  1IN7 A;  1XHB A;  4FVM A;  2JZ0 A;  4GH9 A;  1P3Q Q;  3L2A A;  4MGY E;  2ZAO A;  2UUA M;  4LFA M;  1IXS A;  4GKK M;  2DNA A;  3EIE A;  1E94 E;  4GMQ A;  1A5T A;  2GQF A;  1DGF A;  1PJQ A;  2EKK A;  2UU9 M;  3GPU A;  4RF1 A;  4LF4 M;  2DWN A;  5FLX S;  2X49 A;  2JWS A;  3KOX E;  1F4I A;  4REZ A;  3GP1 A;  4LFC M;  2HWJ A;  2QHO B;  1SG9 A;  1Y8G A;  4M9X A;  3FUT A;  1V34 A;  1H6U A;  5EQT A;  1TH4 A;  4R7G A;  5FTJ A;  4L16 A;  2LHG A;  1KYI A;  1TGU A;  3E9S A;  1WJ7 A;  4IBD A;  2LWX A;  3SMP A;  2R62 A;  2P5T A;  1I94 M;  4IBE A;  2Z4S A;  4LZJ A;  4DV6 M;  2MH8 A;  2FOI C;  4CGY B;  5IZ7 D;  5KPZ A;  1L1Z A;  4B7G A;  2BWE A;  3QAU A;  1Q3B A;  3IHP A;  4IBK A;  4JN6 A;  3AOG A;  3FTD A;  1IN5 A;  2C99 A;  1DO2 A;  1ZMU A;  2L4F A;  4DR6 M;  3HKP A;  3U61 B;  4R3D A;  2C96 A;  3KS4 A;  1VDD A;  2EO2 A;  3NBX X;  1ZV1 A;  2DAE A;  3Q8G A;  1NY5 A;  1DGB A;  2LXE A;  4QOS A;  2QNJ A;  3TWM A;  2XH9 A;  3QWL A;  2VQF M;  2EA0 A;  1ORY B;  1D0K A;  2D7H A;  2UXC M;  4JI4 M;  2QBY A;  3I4V A;  4I4L A;  4LF9 M;  2K6B A;  1GAB A;  2E5L M;  1T3T A;  4OU7 A;  4L78 A;  3SAV A;  1GJS A;  1IM2 A;  1QAM A;  4G3O A;  1Z5A A;  3GLI A;  2Y21 A;  4DBG B;  5ITU A;  2X8A A;  4IIW A;  4BLC A;  1WXQ A;  3AKZ A;  5H37 D;  2XZF A;  2V1U A;  3JR4 A;  1VEJ A;  2CFO A;  1Q02 A;  1SXJ C;  1IN6 A;  1N75 A;  3D8B A;  2QEN A;  2XEP A;  3IG5 A;  3RE8 A;  3W68 A;  3A42 A;  4CJ6 A;  3LVV A;  4DR1 M;  2QP9 X;  1IY1 A;  5KQ8 A;  2RGO A;  3FKE A;  4LJ7 A;  3B7Q A;  2ZAN A;  2UXD M;  3T1H M;  4AI6 A;  2LH0 A;  3KVW A;  4LF5 M;  1S3S A;  4JYA M;  1Q3C A;  4ANR A;  2HAK A;  3GQ3 A;  2LVQ D;  3FYC A;  3AL0 C;  3MMP A;  5IRE B;  1KSF X;  1PJJ A;  3C3E A;  2CUZ A;  2KRK A;  3KDS E;  2VF7 A;  1WHC A;  1FJG M;  3K8Z A;  4B7H A;  1XNR M;  2R18 A;  1W5T A;  2LVN C;  4LGY A;  3GLF B;  1NHW C;  4FWD A;  3TWK A;  1DV0 A;  2OOA A;  2WSC F;  3KOZ E;  3PXG A;  3I01 M;  3VKH A;  3JAM S;  1PRB A;  3UK6 A;  4OVZ A;  5KQD A;  2DAK A;  3J7B A;  3PVS A; 
#chains in the Genus database with same CATH homology
 3D8L A;  3U60 A;  7CAT A;  1X37 A;  1YE9 A;  2Z3X A;  2GNO A;  3CTW B;  3M0E A;  2V1C A;  4MGI E;  3BOS A;  3ZC7 B;  2R9G A;  2F4V M;  3PNV A;  1DGH A;  3RGS A;  4M0D A;  2M60 A;  3W0L B;  2CE7 A;  3KXE C;  4JI3 M;  1SXJ A;  2R4J A;  2BJV A;  4DR7 M;  4MGZ E;  4NSO B;  3HU2 A;  1XMQ M;  2VII A;  4LZZ A;  2DWM A;  3T15 A;  4LFB M;  3GRY A;  4QHT A;  4IBI A;  1ZQ9 A;  1EE8 A;  1HQC A;  5DYG A;  3AOE C;  5EXP A;  4ZPX A;  1G41 A;  2BJW A;  4HL4 A;  2ZAM A;  3ZH9 B;  1HNW M;  1IN8 A;  2XF3 A;  4YY3 M;  1XMO M;  4L15 A;  5IWA M;  2M5Z A;  4JI5 M;  1NJG A;  4GC5 A;  1QAN A;  2KRU A;  1UM8 A;  3AFH A;  2DWZ B;  2OQ4 A;  1GLN A;  4IBF A;  3GLI E;  1PM5 A;  2Z4R A;  4MM3 B;  4MGK E;  2YQZ A;  2Q2E B;  2C9O A;  3GLG A;  4X64 M;  3SAS A;  3DA1 A;  4KHP M;  2HHH M;  4DV4 M;  3GRV A;  5FSW A;  4PDG A;  4NSR A;  3HU3 A;  4IJF A;  3KOY E;  3L27 A;  4LGM A;  1OFH A;  3NWL A;  4LRS A;  5EP1 A;  2R46 A;  3JAM S;  4L4U A;  4JI7 M;  3GLH E;  3SFZ A;  2XFS A;  4II7 A;  3ILK A;  3OTO M;  4X66 M;  1DGG A;  4PCZ A;  3J2P B;  2D7G A;  2KEB A;  2YNM D;  3IG8 A;  3FTC A;  4LCB A;  5KO3 A;  2V6Z M;  1NSF A;  4YHH M;  5LMU M;  5FTK A;  4IBB A;  3FTE A;  3FUU A;  1L2C A;  3KOW E;  3A46 A;  3AOE A;  3JR5 A;  1HNX M;  3MJ5 A;  2R45 A;  4M0W A;  1QQW A;  3HU1 A;  1LV7 A;  3U61 A;  2OPF A;  4DV1 M;  1IBL M;  3H4M A;  3GO8 A;  1IN4 A;  3U6M A;  3M6A A;  2K47 A;  2F5Q A;  2G8L A;  3CF2 A;  1TDH A;  2DWL A;  3HJQ A;  2XZU A;  4I81 A;  1L2B A;  3UGJ A;  4QOZ C;  4AG5 A;  2C9C A;  3K1J A;  4CHT B;  4TUW A;  1N33 M;  3A98 B;  1NNU C;  1TH2 A;  4GHA A;  3B9P A;  2KZU A;  1XXH B;  4MB7 A;  4DR5 M;  3A45 A;  3SBJ A;  3HJ8 A;  3AJI B;  2C5R A;  2H1R A;  2NQ8 C;  2HCB A;  5ITR A;  1HNZ M;  2QCU A;  3FUV A;  3U5Z A;  3VDP A;  3J7A S;  3HHW A;  4IBG A;  4JXJ A;  4JI0 M;  2EUC A;  2XSZ A;  4GIP A;  4G4Q A;  2W82 A;  2HKJ A;  5GKN A;  2CHV A;  5DYI A;  3GLG E;  2UXB M;  2KXE A;  3GLF A;  1G4A E;  4G4O A;  2UUB M;  1IQP A;  4B7F A;  4AQY M;  1G59 A;  3TWL A;  2XGN A;  2CV1 A;  1J09 A;  4Z8X A;  1MX0 A;  2ZM6 M;  2A5Y B;  3HWS A;  1W5S A;  3KW6 A;  5EXT A;  3K92 A;  3WHL A;  4MGH A;  3VK7 A;  4B3R M;  2CHQ A;  4JI2 M;  4DV7 M;  4FWG A;  1IXR C;  3GPX A;  5EP4 A;  2XLJ A;  5BR8 M;  1N32 M;  2QBY B;  1J7K A;  3TL4 X;  4LY6 A;  3NBI A;  4WW0 A;  1GL6 A;  3J81 S;  2F5O A;  2DZN B;  3T38 A;  3HHY A;  2CV0 A;  3J27 B;  4IJE A;  3WHK A;  3KP1 E;  4AKI A;  1Z5B A;  5FTM A;  3MHV C;  3VKG A;  5FTN A;  3U6E A;  2QZ4 A;  3ES5 A;  1QYR A;  4LJ8 A;  4IBC A;  5LMN M;  2KW0 A;  3DZD A;  4I8O A;  2XSZ D;  3RC8 A;  3GQ5 A;  2JA2 A;  3GLH B;  1Q39 A;  2UUC M;  4FCV A;  5DNY A;  4LF7 M;  4LJ5 A;  1GKI A;  4NRW A;  3GQ4 A;  3SYK A;  2Y0T A;  4LF8 M;  4AG6 A;  4S12 A;  4LJ6 A;  4G6Z A;  3L28 A;  2ZBK B;  3HHX A;  3LQQ A;  3L29 A;  3HGI A;  1MU5 A;  3KS8 A;  1G8P A;  2O5R A;  1XWI A;  3FTF A;  4GKJ M;  4GHL A;  5KPT A;  4GC9 A;  4OVZ B;  4G4R A;  3M7G A;  5A2Q S;  3LQR A;  3SYL A;  4AKG A;  3U6O A;  1J5E M;  1C1K A;  3VLF B;  4D82 A;  4DUY M;  2QW6 A;  4RNA A;  1JR3 A;  2Y0Q A;  2CHG A;  3KSJ A;  3HJS A;  4FW9 A;  2DZO B;  1KFV A;  1SXJ D;  2CV2 A;  4KO8 A;  4X62 M;  5ITY A;  4JI1 M;  1GL7 A;  1QAQ A;  4XBO A;  2LNH C;  3L25 A;  5ITT A;  4X65 M;  2R65 A;  4XGI A;  3GPY A;  3GRR A;  1R2Y A;  4G4N A;  5EXX A;  1N34 M;  4LG2 A;  1L8Q A;  1R6B X;  3Q8X A;  3SHF A;  3U6S A;  4AW4 A;  3KFU G;  3E4R A;  4NRV A;  2DVW B;  1K82 A;  1D2N A;  1XC8 A;  3EIH A;  4DV0 M;  1NY6 A;  4K0K M;  3UMM A;  4JI6 M;  1L1T A;  3J80 S;  2VQE M;  4DR3 M;  1XXH A;  2ERC A;  2QPA A;  3GLG B;  1QAO A;  2D7E A;  4LJA A;  1L2D A;  4D80 A;  1IBK M;  5C1B A;  3BGE A;  2L09 A;  2C98 A;  3SHG B;  1YSY A;  3GRU A;  1SXJ E;  3TPZ A;  3UZU A;  3LVW A;  1IXS B;  2F5N A;  4BB9 A;  4DR4 M;  4B3T M;  1HR0 M;  1JR3 D;  5E26 A;  3RC3 A;  1TH3 A;  1K3W A;  4NOO B;  3SAR A;  1R7R A;  3SAW A;  3AV0 A;  4B08 A;  3ZCB B;  2HL7 A;  3DOA A;  1OFI A;  2DXI A;  2F5P A;  4QNM A;  2YFQ A;  8CAT A;  4I5S A;  4OX9 M;  4JV5 M;  2KZS A;  2FNA A;  4PT5 A;  1I4W A;  2R4E A;  3U6P A;  1E9S A;  4NXN M;  1IBM M;  5ITX A;  4KLN A;  1HT1 E;  3KP0 E;  3PNY A;  1XNQ M;  2J7O A;  2YR0 A;  4QHS A;  3VK8 A;  2FFJ A;  2J7N A;  1DO0 A;  4FWH A;  2L7H A;  2I7P A;  3TQS A;  4B3M M;  3TE6 A;  3CF6 E;  4DV2 M;  1FNN A;  1JR3 E;  5E6J A;  5FTL A;  3UJN A;  4LF6 M;  3CF0 A;  1MW5 A;  2KA6 B;  3KSX A;  4B3S M;  2DHR A;  3FD9 A;  2XFT A;  4A3V B;  2L6O A;  3I51 A;  3W0F A;  3GLH A;  3U5Z B;  1IXZ A;  3GLI B;  4QNR A;  1IY2 A;  4LRT A;  5ITQ A;  3T1Y M;  4W5W A;  4L8R C;  4GRI A;  1YUB A;  1N77 A;  3VFD A;  3CTD A;  1TDZ A;  4CHD A;  4DV5 M;  3LMM A;  1XXH E;  1HQY E;  1GVN A;  3DFZ A;  4PDI A;  5F3W A;  3R9X B;  1N78 A;  3GPP A;  5JI3 E;  1NJF A;  4AKH A;  4DR2 M;  2F5S A;  3I4Y A;  4FCW A;  4ITQ A;  1NVM A;  4WUR A;  1QZM A;  2AHM A;  2RGH A;  4LJ4 A;  3K2L A;  4M9Z A;  1QVR A;  2CEA A;  1HT2 E;  4EIW A;  1R2Z A;  5EJC A;  2I7N A;  2BNK A;  5EP2 A;  1Z5C A;  4PD2 A;  3U6Q A;  4RF0 A;  1K3X A;  1IY0 A;  4HLQ A;  4P16 A;  5BPV A;  4FD2 A;  4CIS A;  4BBA A;  5EXS A;  3FYD A;  3U60 B;  4DUZ M;  2Z7J A;  3VDU A;  3R8F A;  2RKO A;  3U6C A;  3RGP A;  4FCT A;  4M9S A;  1DGH B;  1Z6T A;  5ITX E;  4NL4 H;  4IBJ A;  1N36 M;  3MK6 A;  3HHZ A;  4D81 A;  1G3I A;  1SXJ B;  4MH0 E;  3L26 A;  2L7I A;  3GLF E;  4GIT A;  1NHG C;  4DV3 M;  4LJ9 A;  4AZF A;  3SAT A;  3RFW A;  3FUX A;  1PJI A;  4NXM M;  5IT9 S;  5JI2 E;  1ZAE A;  3U6D A;  1Z59 A;  4Z6Y A;  3THG A;  4JI8 M;  2G5G X;  1NNJ A;  1JQJ C;  1OJL A;  3FUW A;  1E32 A;  5C18 A;  2Y20 A;  2FE8 A;  3SAU A;  3SMS A;  3C58 A;  1E9R A;  4OW0 A;  4KOD A;  5EP3 A;  5KPR A;  2X4A A;  3PFI A;  1IN7 A;  1XHB A;  4FVM A;  4GH9 A;  4MGY E;  3L2A A;  5IRE B;  3SC3 A;  2ZAO A;  2UUA M;  4LFA M;  4GKK M;  3EIE A;  1E94 E;  4GMQ A;  1A5T A;  1DGF A;  2UU9 M;  3GPU A;  4RF1 A;  4LF4 M;  2DWN A;  5FLX S;  2X49 A;  3KOX E;  4REZ A;  3GP1 A;  4LFC M;  4M9X A;  3FUT A;  1H6U A;  5EQT A;  1TH4 A;  4R7G A;  5FTJ A;  4L16 A;  1KYI A;  1TGU A;  3E9S A;  4IBD A;  2LWX A;  3SMP A;  2R62 A;  2P5T A;  1I94 M;  4IBE A;  2Z4S A;  4LZJ A;  4DV6 M;  2FOI C;  4CGY B;  5IZ7 D;  5KPZ A;  1L1Z A;  4B7G A;  3QAU A;  1Q3B A;  4IBK A;  4JN6 A;  3AOG A;  3FTD A;  1IN5 A;  2C99 A;  1DO2 A;  4DR6 M;  3HKP A;  3U61 B;  4R3D A;  2C96 A;  3KS4 A;  1VDD A;  2EO2 A;  3TWM A;  1NY5 A;  1DGB A;  2LXE A;  4QOS A;  2XH9 A;  3QWL A;  2VQF M;  2EA0 A;  1ORY B;  2D7H A;  2UXC M;  4JI4 M;  2QBY A;  3I4V A;  4I4L A;  4LF9 M;  2E5L M;  1T3T A;  4OU7 A;  4L78 A;  3SAV A;  1IM2 A;  1QAM A;  1Z5A A;  3GLI A;  2Y21 A;  5ITU A;  2X8A A;  4IIW A;  4BLC A;  1WXQ A;  3AKZ A;  5H37 D;  2XZF A;  2V1U A;  3JR4 A;  3D8B A;  2CFO A;  1SXJ C;  3RE8 A;  3IG5 A;  1IN6 A;  1N75 A;  2QEN A;  2XEP A;  3U6L A;  3A42 A;  3LVV A;  4DR1 M;  2QP9 X;  1IY1 A;  5KQ8 A;  2RGO A;  3FKE A;  4LJ7 A;  4AI6 A;  2ZAN A;  2UXD M;  3T1H M;  2LH0 A;  3KVW A;  4LF5 M;  1S3S A;  4JYA M;  1Q3C A;  3GQ3 A;  3FYC A;  3AL0 C;  1KSF X;  1PJJ A;  2CUZ A;  2KRK A;  3KDS E;  1FJG M;  3K8Z A;  4B7H A;  1XNR M;  2R18 A;  1W5T A;  3GLF B;  4LGY A;  1NHW C;  4FWD A;  3TWK A;  3PXG A;  3KOZ E;  3VKH A;  3UK6 A;  4OVZ A;  5KQD A;  3J7B A;  3PVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...