3U5ZA

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 46
structure length 186
sequence length 186
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zA03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zA02
3U61A 3U60A 3U5ZA
chains in the Genus database with same CATH superfamily
2L4FA 1TDHA 4M9ZA 4RKUF 1R2YA 1L2DA 2RGHA 3IHPA 3JR5A 3OTOM 5ITYA 3UK6A 1QUTA 1Q02A 3A42A 3U6OA 1ORYB 3BOSA 1YLAA 1YSYA 2R4JA 4HEOA 2EKFA 2QBYB 1ZQ9A 4QHTA 4MGIE 2KRKA 3T1HM 4NC6A 3W68A 3QWLA 1VDDA 5DYGA 1BVSA 4DUZM 2F5PA 2L7HA 2W82A 4X65M 2KZSA 1XMQM 4GHLA 1E94E 3ILKA 2KDLA 1OIPA 3W0LB 4A3VB 3GRUA 2F5OA 5IT9S 2QZ4A 4JI8M 2CEAA 4FW9A 3FTEA 4DV5M 1IFYA 4B3TM 3TWLA 2R62A 3U6SA 1SG9A 2EJSA 4ANRA 3SHGB 2DHRA 1NJFA 1X37A 2RKOA 1NNJA 1KYIA 4GC5A 3CF0A 4IBGA 4D80A 3B7NA 3UZUA 2C9OA 2ZAMA 4AW4A 3M0EA 1HNZM 4MGHA 3KP1E 3K2LA 3T6PA 3GLIB 4DV2M 4JN6A 1VEJA 3GRRA 2QCUA 4AG6A 3GPUA 2ZM6M 2A5YB 3RGSA 2Y21A 2K47A 3TWKA 3U6MA 4GEWA 5L8RF 1XWIA 1J09A 2DAKA 2L6OA 4LFAM 3K9OA 1D2NA 8CATA 4AKIA 3K1JA 1QQWA 2LTUA 5FTLA 2VQFM 3AL0C 2YFQA 4B08A 4G4RA 3PNYA 1OIZA 2EUCA 2ERCA 2LVAA 4M0DA 4GHAA 4X66M 3PVSA 1Q39A 1TH3A 1L2CA 3SHFA 3A98B 3ZH9B 3FTDA 4JI7M 5LMUM 4QNMA 2KNVA 1XHBA 5C1BA 1VEKA 2K9DA 5IREB 2F5NA 2KW0A 4XGIA 2R65A 4NSOB 4REZA 4JYAM 2D7HA 4M9SA 4Z6YA 5ITTA 4LF7M 1GJSA 3H4JA 1Z5AA 1V92A 2VF8A 4OW0A 4LJ9A 4K0KM 3KSXA 1G71A 2G8LA 5BR8M 1T3TA 2ZAOA 1ZMUA 3GO8A 2XZUA 3HJ8A 4LZJA 1SXJD 4LJAA 2HHHM 1QVRA 2G5GX 3BXWA 2R6FA 3AOEC 3HHXA 1W5SA 2K0BX 4II7A 1WIVA 2CHVA 2DZLA 3L2AA 1OAOC 4CIZA 2QNJA 5KO3A 3ZC7B 3CGWA 4I5SA 1N34M 1Z59A 3GLFA 3B74A 2L7IA 2X49A 2FOIC 3FD9A 1Q3BA 3GLGE 4DR3M 3EIEA 3J2PB 1K3XA 5F3WA 1VG5A 1DGHA 3C3EA 1WXQA 3FRHA 3R8FA 2DNAA 2XZFA 1K82A 4KT0F 1D0KA 2BNKA 1Z6TA 2KNAA 2Z8YM 2XGNA 1L1TA 1NSFA 3DOAA 2DWZB 1NV8A 2HKJA 4B7GA 3KP0E 2C98A 2OOAA 4B3SM 2XFSA 1N75A 1HT1E 3DA1A 4I81A 4AKGA 2BWBA 1SXJA 5EQTA 4LJ5A 5EP3A 3GLHE 3KFUG 4DUYM 2VIIA 3B7ZA 3SASA 3HHWA 4IBKA 2LXEA 4F1IA 4DR6M 2J5YA 3E21A 1HNXM 4G3OA 4LJ4A 3T38A 1YE9A 3LVVA 1DGGA 1J7KA 1MN3A 2DENA 3U6EA 1I94M 2OPFA 1NV9A 1K3WA 3J80S 2XEPA 4MGYE 3TWMA 3E4RA 3TQSA 3W0FA 4FD2A 3GP1A 2MR9A 4LGYA 2XSZA 3VK7A 3HHYA 5C18A 4IJFA 1R4GA 1ZAEA 1QYRA 2JY5A 2JXNA 4YY3M 3GLFB 3KOXE 2CHQA 4PD2A 2FFJA 4GMQA 5A2QS 1GL6A 4TUWA 1IN8A 5DYIA 1DGHB 1HR0M 2JA2A 4GIPA 1C7YA 1G41A 2LVNC 2LVQD 3HJSA 1PM5A 4DBGB 3J7AS 3NWLA 2R18A 1ZV1A 3U6QA 1ZMVA 3VKHA 2G3QA 2R45A 3AV0A 3HGIA 1G59A 4RF1A 2MROB 2EKKA 3WHKA 1XB2B 3TPZA 5JI3E 2HL7A 3MHVC 2QP9X 3U60A 3RFWA 4MGZE 2J7NA 1NHWC 1TH2A 1PJTA 1IY1A 4DV3M 1SXJB 2KNZA 3U6LA 4LF4M 4NOOB 2R46A 3LQQA 2MGWA 3AJIB 3AFHA 3LMMA 3MJ5A 5KQ8A 5ITXE 2XLJA 1H6UA 3R9XB 3KXEC 2B3TA 3SYLA 4GKKM 2JZ0A 3SARA 1PJQA 2Z4SA 2V1CA 4FWGA 3GLIE 4JXJA 4HLQA 2Z4RA 3D8BA 4Z8XA 2Y20A 3Q8XA 5FTKA 1DO2A 3J27B 4LG2A 4IIWA 4BB9A 2JP7A 4DR4M 2YQZA 3RE8A 1IXSA 2DVWB 2HWJA 1IQPA 1P3QQ 3HJQA 4AG5A 1JR3D 4B3RM 4CHDA 1QDTA 4L6V6 4QOZC 3LCVB 2LBCA 2WSCF 3FYCA 2DI0A 4I4LA 3KW6A 1T6OA 4AZFA 4DV7M 2UUBM 3GQ5A 2DZNB 2LWXA 2V6ZM 1IY0A 1XXHA 3T1YM 3J81S 4M9XA 2R4EA 1Z5BA 1VDLA 1CUKA 1R5LA 1SXJC 1TF0B 1WHCA 2CV2A 1R6BX 3HZJA 4G4QA 2QQ8A 5FTNA 4JI3M 3CF6E 3FTCA 3FYDA 1RU3A 2DZOB 1JB0F 1LTMA 1MX0A 3K9PA 1GL7A 2DWNA 4F2LA 4DV6M 4AQYM 4FWHA 3U60B 4JI6M 2HAKA 3IECA 4LFBM 3CTWB 2RRUA 4G4NA 4JI2M 3KSJA 3M7GA 3HKPA 3SBJA 2F5SA 2Z7JA 2JY6B 2XFTA 4CISA 3VDUA 1JR3A 3AOGA 3ZQJA 3SYKA 3KS4A 2YR0A 2D7GA 1DGBA 3L29A 3U6PA 4LRTA 4JI5M 1JQJC 4MM3B 4KODA 3E46A 4RF0A 3FRIA 3VK8A 2CV0A 2KEBA 1XNRM 1OFIA 1IXSB 2QENA 4LJ8A 1L8QA 3QAUA 3SMSA 4LF6M 1WR1B 2CV1A 2XSZD 2D7EA 1G4AE 1T43A 4LY6A 1IM2A 1TH4A 3C9PA 3PXGA 1DO0A 4R71A 4W5WA 3AKZA 2KRUA 2M5ZA 1NY6A 1PJSA 1XXHB 4KHPM 3M6AA 4MGKE 1EIJA 1PGYA 3FUTA 4LRSA 4OVZA 3U61A 3H4MA 1OQYA 2N35A 3LQRA 2YNMD 2JUJA 3B9PA 3I01M 4UN2B 3RC3A 1PJJA 2OO9A 1MJGM 2C9CA 4BBAA 3NBIA 3QYEA 1IN4A 3Q8GA 3RGPA 3SFZA 1WJ7A 4DR1M 1NY5A 2RGOA 4PT5A 1E32A 1KSFX 3V76A 4XK8F 3L26A 1QAMA 4DV0M 2UUAM 4LF5M 1OTRA 4G4OA 2DWMA 3FE3A 3SATA 3VFDA 1IBLM 2LVPC 1QDRA 4GITA 5EP2A 5FLXS 3GQ4A 3SAUA 2O5RA 4DV4M 1N77A 1NVMA 2KHHA 2O25A 1AUAA 4R3DA 1OJLA 5EXTA 5BPVA 2CRUA 2APLA 4FCVA 3GLFE 4EIWA 2CUZA 4D81A 3I04M 4NRVA 1J5EM 3UJNA 4LFCM 2ZTCA 4R7GA 3KS8A 2Y0TA 2FNAA 2L2DA 2CHGA 4QNRA 2UUCM 3HU2A 4PDIA 3A45A 2LNHC 2UXBM 1QUSA 3TE6A 4D82A 3DFZA 3J7BA 1VEGA 4DR7M 4FVMA 4P16A 3I4YA 4NXMM 2BJWA 4X62M 3GPPA 4B3MM 4NSRA 2C99A 3C3DA 4CJ6A 4L15A 2DAEA 3PFIA 2LHGA 3BBZA 2L4EA 3KOYE 2XH9A 3L27A 4QOSA 3U61B 4OVZB 5IWAM 3GRYA 1SXJE 1D0MA 2JNHA 2LHCA 2ZANA 2EA0A 2VF7A 5LMNM 1QAQA 1YUBA 1PRBA 1FNNA 4KO8A 1N32M 2P5TA 2WSFF 2X4AA 4L16A 2MH8A 3FUUA 3B89A 4IBEA 5KPTA 1IN6A 1HNWM 3RC8A 4OX9M 5E6JA 3LCUA 1EE8A 2R44A 3UGJA 5ITQA 4DR5M 2R0IA 2GQFA 1Y8GA 3U6CA 3FUVA 5EP1A 2LVOC 2K6BA 1V33A 2QHOB 4RNAA 4X64M 4ITQA 3HY5A 2JY8A 2R9GA 2DAMA 1NJGA 1HJPA 1GABA 3GQ3A 1AIPC 3IG8A 2ZBKB 1N36M 4P17A 5GKNA 2KXEA 4IBFA 2F5QA 3GLGA 2H1RA 3MK6A 5JI2E 4LJ6A 1R7RA 1MW5A 3ES5A 3FUWA 3LVWA 3JAMS 4WURA 1L2BA 3DZDA 4LZZA 2LH0A 3HU1A 4L4UA 3T15A 2Y0QA 4AKHA 2JZ1A 2FH0A 2DWLA 4L8RC 1NNUC 5KQDA 4LF8M 4FWDA 5FTJA 1IBKM 4WW0A 1WGNA 3VLFB 2CP8A 3BGEA 1OKSA 1IY2A 2UXCM 3IG5A 3KVWA 3LW5F 2AHMA 4M0WA 4ZPXA 1HQYE 4CGYB 3GPXA 1Z5CA 4GH9A 4L78A 1LV7A 2H5XA 3EIHA 4I8OA 3ZCBB 3VKGA 3GRVA 3GLHA 4IBBA 3U6DA 4PCZA 1QZEA 5EP4A 2DXIA 1WGLA 4QHSA 1TTEA 3I4VA 1OAIA 3SC3A 1QANA 4PDGA 1TDZA 4IBDA 1N78A 3K92A 2BJVA 1A5TA 5DFLA 3UMMA 1NHGC 5EXSA 5ITRA 2GNOA 1NO1A 4LCBA 2KZUA 3GPYA 2UU9M 2V1UA 1FJGM 3WHLA 7CATA 5ITUA 3HHZA 4NXNM 3SAWA 1PJIA 1R2ZA 4LJ7A 2DHYA 1G8PA 5EXPA 2CWBA 1QZMA 3KOWE 1GVNA 5KPRA 3U5ZA 4Y28F 2QW6A 4GC9A 1GJTA 2I7PA 3QYBA 1XC8A 4MH0E 5DNYA 4JV5M 3MMPA 2WZJA 4IBCA 3HX3A 4XBOA 4Q7JA 1N33M 2J7OA 3CTDA 1IBMM 3FKEA 5FSWA 4CHTB 3FUXA 3GLGB 2FS1A 3HWSA 3I51A 4JI4M 2F4VM 3L25A 1XXHE 2MJ5B 1UM8A 3B7QA 1VQ1A 3SAVA 3F92A 2QBYA 1HT2E 2VQEM 3L28A 2Z3XA 4AI6A 4WP2A 4FCTA 3SMPA 4GRIA 2DAIA 3D8LA 2JY7A 4FCWA 1G3IA 4LF9M 4S12A 1GLNA 1I4WA 2CFOA 2Q2EB 2QPAA 5E26A 3A46A 4DV1M 4BLCA 2WSEF 5H37D 4GKJM 1DV0A 1DGFA 3JR4A 1S3SA 4JI0M 3VDPA 1QAOA 4NRWA 2FE8A 1E9RA 5FTMA 3GLHB 2C96A 1Q3CA 2VDBB 1IN5A 4MB7A 1JR3E 1TR8A 5ITXA 3KOZE 3FTFA 3K8ZA 3C58A 1IXRC 1XMOM 1F4IA 2ZTDA 2DKLA 3PNVA 4YHHM 5IZ7D 3E9SA 2I7NA 2JWSA 2O01F 5KPZA 1GO5A 1ZMWA 2EO2A 2OQ4A 2E5LM 2HCBA 4KLNA 1IN7A 3NBXX 3GLIA 5EXXA 5EJCA 2UXDM 2QSFX 1MU5A 1W5TA 2BWEA 2KA6B 2L09A 4HL4A 4IBIA 4IBJA 1EFUB 2M60A 2NQ8C 4LGMA 2CE7A 2OOBA 3U5ZB 2C5RA 3AOEA 1HQCA 1V34A 3TL4X 1E9SA 1GKIA 3THGA 4IJEA 3CF2A 1XNQM 1KFVA 1D0LA 2DAGA 4JI1M 2X8AA 3HU3A 3W67A 3KDSE 1C1KA 1OFHA 4NL4H 4B7HA 4G6ZA 4B7FA 1L1ZA 1UFZA 2XF3A 4DR2M 1TGUA 1IXZA 4OU7A
chains in the Genus database with same CATH topology
1TDHA 4M9ZA 1R2YA 1L2DA 2RGHA 3JR5A 3OTOM 5ITYA 3UK6A 3A42A 3U6OA 1ORYB 3BOSA 2R4JA 1YSYA 2QBYB 1ZQ9A 4QHTA 4MGIE 2KRKA 3T1HM 3QWLA 1VDDA 5DYGA 4DUZM 2F5PA 2L7HA 2W82A 4X65M 2KZSA 1XMQM 4GHLA 1E94E 3ILKA 3W0LB 4A3VB 3GRUA 2F5OA 5IT9S 2QZ4A 4JI8M 2CEAA 4FW9A 3FTEA 4DV5M 4B3TM 3TWLA 2R62A 3U6SA 1NNJA 3SHGB 2DHRA 1NJFA 1X37A 2RKOA 1KYIA 4GC5A 3CF0A 4IBGA 4D80A 3UZUA 2C9OA 2ZAMA 4AW4A 3M0EA 1HNZM 4MGHA 3KP1E 3K2LA 3GLIB 4DV2M 4JN6A 3GRRA 2QCUA 4AG6A 3GPUA 2ZM6M 2A5YB 3RGSA 2Y21A 2K47A 3TWKA 3U6MA 1XWIA 1J09A 2L6OA 4LFAM 1D2NA 8CATA 4AKIA 3K1JA 1QQWA 5FTLA 2VQFM 3AL0C 2YFQA 4B08A 4G4RA 3PNYA 2EUCA 2ERCA 4M0DA 4GHAA 4X66M 3PVSA 1Q39A 1TH3A 1L2CA 3SHFA 3A98B 3ZH9B 3FTDA 4JI7M 5LMUM 4QNMA 1XHBA 5C1BA 5IREB 2F5NA 2KW0A 4XGIA 2R65A 4NSOB 4REZA 4JYAM 2D7HA 4M9SA 4Z6YA 5ITTA 4LF7M 1Z5AA 4OW0A 4LJ9A 4K0KM 3KSXA 2G8LA 3GO8A 5BR8M 1T3TA 2ZAOA 2XZUA 3HJ8A 4LZJA 1SXJD 4LJAA 2HHHM 1QVRA 2G5GX 3AOEC 3HHXA 1W5SA 4II7A 2CHVA 3L2AA 5KO3A 3ZC7B 4I5SA 1N34M 1Z59A 3GLFA 2L7IA 2X49A 2FOIC 3FD9A 1Q3BA 3GLGE 4DR3M 3EIEA 3J2PB 1K3XA 5F3WA 1DGHA 1WXQA 3R8FA 2XZFA 1K82A 2BNKA 1Z6TA 1L1TA 2XGNA 1NSFA 3DOAA 2DWZB 2HKJA 4B7GA 3KP0E 2C98A 4B3SM 2XFSA 1N75A 1HT1E 3DA1A 4I81A 4AKGA 1SXJA 5EQTA 4LJ5A 5EP3A 3GLHE 3KFUG 4DUYM 2VIIA 3SASA 3HHWA 4IBKA 2LXEA 4DR6M 1HNXM 3T38A 4LJ4A 1YE9A 3LVVA 1DGGA 1J7KA 3U6EA 1I94M 2OPFA 1K3WA 3J80S 2XEPA 4MGYE 3TWMA 3E4RA 3TQSA 3W0FA 4FD2A 3GP1A 4LGYA 2XSZA 3VK7A 3HHYA 5C18A 4IJFA 1ZAEA 1QYRA 4YY3M 3GLFB 3KOXE 2CHQA 4PD2A 2FFJA 4GMQA 5A2QS 1GL6A 4TUWA 1IN8A 5DYIA 1DGHB 1HR0M 2JA2A 4GIPA 1G41A 1PM5A 3HJSA 3J7AS 3NWLA 2R18A 3U6QA 3VKHA 2R45A 3HGIA 3AV0A 1G59A 4RF1A 5JI3E 3WHKA 3TPZA 3U60A 2HL7A 3MHVC 2QP9X 3RFWA 4MGZE 2J7NA 1NHWC 1TH2A 4DV3M 1IY1A 4LF4M 1SXJB 3U6LA 4NOOB 2R46A 3LQQA 3AJIB 3AFHA 3LMMA 3MJ5A 5KQ8A 5ITXE 2XLJA 1H6UA 3R9XB 3KXEC 3SYLA 4GKKM 3SARA 2Z4SA 2V1CA 4FWGA 3GLIE 4JXJA 4HLQA 2Z4RA 3D8BA 4Z8XA 2Y20A 3Q8XA 5FTKA 1DO2A 3J27B 4LG2A 4IIWA 4BB9A 4DR4M 2YQZA 3RE8A 2DVWB 1IQPA 3HJQA 4AG5A 1JR3D 4B3RM 4CHDA 4QOZC 3FYCA 4I4LA 3KW6A 4AZFA 4DV7M 2UUBM 3GQ5A 2DZNB 2LWXA 2V6ZM 1IY0A 1XXHA 3T1YM 3J81S 4M9XA 2R4EA 1Z5BA 1SXJC 2CV2A 1R6BX 4G4QA 5FTNA 4JI3M 3CF6E 3FTCA 3FYDA 2DZOB 2DWNA 1MX0A 1GL7A 4DV6M 4AQYM 4FWHA 3U60B 4JI6M 4LFBM 3CTWB 4G4NA 4JI2M 3KSJA 3M7GA 3HKPA 3SBJA 2F5SA 2Z7JA 4CISA 2XFTA 3VDUA 1JR3A 3AOGA 3SYKA 3KS4A 2YR0A 2D7GA 1DGBA 3L29A 3U6PA 4LRTA 4JI5M 1JQJC 4MM3B 4KODA 4RF0A 3VK8A 2CV0A 2KEBA 1XNRM 1OFIA 1IXSB 2QENA 4LJ8A 1L8QA 3QAUA 3SMSA 4LF6M 2CV1A 2XSZD 2D7EA 1G4AE 4LY6A 1IM2A 1TH4A 3PXGA 1DO0A 4W5WA 3AKZA 2KRUA 1NY6A 2M5ZA 1XXHB 4KHPM 3M6AA 4MGKE 3FUTA 3U61A 4LRSA 4OVZA 3H4MA 3LQRA 2YNMD 3B9PA 3RC3A 1PJJA 2C9CA 4BBAA 3NBIA 1IN4A 3RGPA 3SFZA 4DR1M 1NY5A 2RGOA 4PT5A 1E32A 1KSFX 4DV0M 3L26A 1QAMA 2UUAM 4LF5M 4G4OA 2DWMA 3SATA 3VFDA 1IBLM 4GITA 3GQ4A 5EP2A 5FLXS 3SAUA 2O5RA 4DV4M 1N77A 1NVMA 4R3DA 1OJLA 5EXTA 5BPVA 4FCVA 3GLFE 4EIWA 2CUZA 4D81A 4NRVA 1J5EM 3UJNA 4LFCM 4R7GA 3KS8A 2Y0TA 2FNAA 2CHGA 4QNRA 2UUCM 3HU2A 4PDIA 3A45A 2LNHC 2UXBM 3TE6A 4D82A 3DFZA 3J7BA 4DR7M 4FVMA 4P16A 3I4YA 4NXMM 2BJWA 4X62M 3GPPA 4B3MM 4NSRA 2C99A 4L15A 3PFIA 3KOYE 2XH9A 3L27A 4QOSA 3U61B 4OVZB 5IWAM 3GRYA 1SXJE 2ZANA 2EA0A 5LMNM 1QAQA 1YUBA 4KO8A 1FNNA 1N32M 2P5TA 2X4AA 4L16A 3FUUA 4IBEA 5KPTA 1IN6A 1HNWM 3RC8A 4OX9M 5E6JA 1EE8A 3UGJA 5ITQA 4DR5M 3U6CA 3FUVA 5EP1A 4RNAA 4X64M 4ITQA 2R9GA 1NJGA 3GQ3A 3IG8A 2ZBKB 1N36M 5GKNA 2KXEA 4IBFA 2F5QA 3GLGA 2H1RA 3MK6A 5JI2E 4LJ6A 1R7RA 1MW5A 3ES5A 3FUWA 3LVWA 3JAMS 4WURA 1L2BA 3DZDA 4LZZA 2LH0A 3HU1A 4L4UA 3T15A 2Y0QA 4AKHA 2DWLA 4L8RC 1NNUC 5KQDA 4LF8M 4FWDA 5FTJA 1IBKM 4WW0A 3VLFB 3BGEA 1IY2A 2UXCM 3IG5A 3KVWA 4M0WA 2AHMA 4ZPXA 1HQYE 4CGYB 3GPXA 1Z5CA 4GH9A 4L78A 1LV7A 4I8OA 3EIHA 3ZCBB 3VKGA 3GRVA 3GLHA 4IBBA 3U6DA 4PCZA 5EP4A 2DXIA 4QHSA 3I4VA 3SC3A 1QANA 4PDGA 1TDZA 4IBDA 1N78A 3K92A 2BJVA 1A5TA 3UMMA 1NHGC 5EXSA 5ITRA 2GNOA 4LCBA 2KZUA 3GPYA 2UU9M 2V1UA 1FJGM 3WHLA 7CATA 5ITUA 3HHZA 4NXNM 3SAWA 1PJIA 1R2ZA 4LJ7A 1G8PA 5EXPA 1QZMA 3KOWE 1GVNA 5KPRA 3U5ZA 2QW6A 4GC9A 1XC8A 2I7PA 4MH0E 5DNYA 4JV5M 4IBCA 4XBOA 1N33M 2J7OA 3CTDA 1IBMM 3FKEA 5FSWA 4CHTB 3FUXA 3GLGB 3HWSA 3I51A 4JI4M 2F4VM 3L25A 3SAVA 1XXHE 1UM8A 2QBYA 1HT2E 2VQEM 3L28A 2Z3XA 4AI6A 4FCTA 3SMPA 4GRIA 3D8LA 4FCWA 1G3IA 4LF9M 4S12A 1GLNA 1I4WA 2CFOA 2Q2EB 2QPAA 5E26A 3A46A 4DV1M 4BLCA 5H37D 4GKJM 1DGFA 3JR4A 1S3SA 4JI0M 3VDPA 1QAOA 4NRWA 2FE8A 1E9RA 5FTMA 3GLHB 2C96A 1Q3CA 1IN5A 4MB7A 5ITXA 3FTFA 1JR3E 3KOZE 3K8ZA 3C58A 1IXRC 1XMOM 3PNVA 4YHHM 5IZ7D 3E9SA 2I7NA 5KPZA 2EO2A 2OQ4A 2E5LM 2HCBA 4KLNA 1IN7A 3GLIA 5EXXA 5EJCA 2UXDM 1MU5A 1W5TA 2KA6B 2L09A 4HL4A 4IBIA 4IBJA 2M60A 2NQ8C 4LGMA 2CE7A 2C5RA 3U5ZB 3AOEA 1HQCA 3TL4X 1E9SA 1GKIA 3THGA 4IJEA 3CF2A 1XNQM 1KFVA 4JI1M 2X8AA 3HU3A 3KDSE 1C1KA 1OFHA 4NL4H 4B7HA 4G6ZA 4B7FA 1L1ZA 2XF3A 4DR2M 1TGUA 1IXZA 4OU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U60 A;  3U5Z A; 
#chains in the Genus database with same CATH topology
 2L4F A;  1TDH A;  4M9Z A;  4RKU F;  1R2Y A;  1L2D A;  2RGH A;  3IHP A;  3JR5 A;  3OTO M;  5ITY A;  3UK6 A;  1QUT A;  1Q02 A;  3A42 A;  3U6O A;  1ORY B;  3BOS A;  1YLA A;  1YSY A;  2R4J A;  4HEO A;  2EKF A;  2QBY B;  1ZQ9 A;  4QHT A;  4MGI E;  2KRK A;  3T1H M;  4NC6 A;  3W68 A;  3QWL A;  1VDD A;  5DYG A;  1BVS A;  4DUZ M;  2F5P A;  2L7H A;  2W82 A;  4X65 M;  2KZS A;  1XMQ M;  4GHL A;  1E94 E;  3ILK A;  2KDL A;  1OIP A;  3W0L B;  4A3V B;  3GRU A;  2F5O A;  5IT9 S;  2QZ4 A;  4JI8 M;  2CEA A;  4FW9 A;  3FTE A;  4DV5 M;  1IFY A;  4B3T M;  3TWL A;  2R62 A;  3U6S A;  1SG9 A;  2EJS A;  4ANR A;  3SHG B;  2DHR A;  1NJF A;  1X37 A;  2RKO A;  1NNJ A;  1KYI A;  4GC5 A;  3CF0 A;  4IBG A;  4D80 A;  3B7N A;  3UZU A;  2C9O A;  2ZAM A;  4AW4 A;  3M0E A;  1HNZ M;  4MGH A;  3KP1 E;  3K2L A;  3T6P A;  3GLI B;  4DV2 M;  4JN6 A;  1VEJ A;  3GRR A;  2QCU A;  4AG6 A;  3GPU A;  2ZM6 M;  2A5Y B;  3RGS A;  2Y21 A;  2K47 A;  3TWK A;  3U6M A;  4GEW A;  5L8R F;  1XWI A;  1J09 A;  2DAK A;  2L6O A;  4LFA M;  3K9O A;  1D2N A;  8CAT A;  4AKI A;  3K1J A;  1QQW A;  2LTU A;  5FTL A;  2VQF M;  3AL0 C;  2YFQ A;  4B08 A;  4G4R A;  3PNY A;  1OIZ A;  2EUC A;  2ERC A;  2LVA A;  4M0D A;  4GHA A;  4X66 M;  3PVS A;  1Q39 A;  1TH3 A;  1L2C A;  3SHF A;  3A98 B;  3ZH9 B;  3FTD A;  4JI7 M;  5LMU M;  4QNM A;  2KNV A;  1XHB A;  5C1B A;  1VEK A;  2K9D A;  5IRE B;  2F5N A;  2KW0 A;  4XGI A;  2R65 A;  4NSO B;  4REZ A;  4JYA M;  2D7H A;  4M9S A;  4Z6Y A;  5ITT A;  4LF7 M;  1GJS A;  3H4J A;  1Z5A A;  1V92 A;  2VF8 A;  4OW0 A;  4LJ9 A;  4K0K M;  3KSX A;  1G71 A;  2G8L A;  5BR8 M;  1T3T A;  2ZAO A;  1ZMU A;  3GO8 A;  2XZU A;  3HJ8 A;  4LZJ A;  1SXJ D;  4LJA A;  2HHH M;  1QVR A;  2G5G X;  3BXW A;  2R6F A;  3AOE C;  3HHX A;  1W5S A;  2K0B X;  4II7 A;  1WIV A;  2CHV A;  2DZL A;  3L2A A;  1OAO C;  4CIZ A;  2QNJ A;  5KO3 A;  3ZC7 B;  3CGW A;  4I5S A;  1N34 M;  1Z59 A;  3GLF A;  3B74 A;  2L7I A;  2X49 A;  2FOI C;  3FD9 A;  1Q3B A;  3GLG E;  4DR3 M;  3EIE A;  3J2P B;  1K3X A;  5F3W A;  1VG5 A;  1DGH A;  3C3E A;  1WXQ A;  3FRH A;  3R8F A;  2DNA A;  2XZF A;  1K82 A;  4KT0 F;  1D0K A;  2BNK A;  1Z6T A;  2KNA A;  2Z8Y M;  2XGN A;  1L1T A;  1NSF A;  3DOA A;  2DWZ B;  1NV8 A;  2HKJ A;  4B7G A;  3KP0 E;  2C98 A;  2OOA A;  4B3S M;  2XFS A;  1N75 A;  1HT1 E;  3DA1 A;  4I81 A;  4AKG A;  2BWB A;  1SXJ A;  5EQT A;  4LJ5 A;  5EP3 A;  3GLH E;  3KFU G;  4DUY M;  2VII A;  3B7Z A;  3SAS A;  3HHW A;  4IBK A;  2LXE A;  4F1I A;  4DR6 M;  2J5Y A;  3E21 A;  1HNX M;  4G3O A;  4LJ4 A;  3T38 A;  1YE9 A;  3LVV A;  1DGG A;  1J7K A;  1MN3 A;  2DEN A;  3U6E A;  1I94 M;  2OPF A;  1NV9 A;  1K3W A;  3J80 S;  2XEP A;  4MGY E;  3TWM A;  3E4R A;  3TQS A;  3W0F A;  4FD2 A;  3GP1 A;  2MR9 A;  4LGY A;  2XSZ A;  3VK7 A;  3HHY A;  5C18 A;  4IJF A;  1R4G A;  1ZAE A;  1QYR A;  2JY5 A;  2JXN A;  4YY3 M;  3GLF B;  3KOX E;  2CHQ A;  4PD2 A;  2FFJ A;  4GMQ A;  5A2Q S;  1GL6 A;  4TUW A;  1IN8 A;  5DYI A;  1DGH B;  1HR0 M;  2JA2 A;  4GIP A;  1C7Y A;  1G41 A;  2LVN C;  2LVQ D;  3HJS A;  1PM5 A;  4DBG B;  3J7A S;  3NWL A;  2R18 A;  1ZV1 A;  3U6Q A;  1ZMV A;  3VKH A;  2G3Q A;  2R45 A;  3AV0 A;  3HGI A;  1G59 A;  4RF1 A;  2MRO B;  2EKK A;  3WHK A;  1XB2 B;  3TPZ A;  5JI3 E;  2HL7 A;  3MHV C;  2QP9 X;  3U60 A;  3RFW A;  4MGZ E;  2J7N A;  1NHW C;  1TH2 A;  1PJT A;  1IY1 A;  4DV3 M;  1SXJ B;  2KNZ A;  3U6L A;  4LF4 M;  4NOO B;  2R46 A;  3LQQ A;  2MGW A;  3AJI B;  3AFH A;  3LMM A;  3MJ5 A;  5KQ8 A;  5ITX E;  2XLJ A;  1H6U A;  3R9X B;  3KXE C;  2B3T A;  3SYL A;  4GKK M;  2JZ0 A;  3SAR A;  1PJQ A;  2Z4S A;  2V1C A;  4FWG A;  3GLI E;  4JXJ A;  4HLQ A;  2Z4R A;  3D8B A;  4Z8X A;  2Y20 A;  3Q8X A;  5FTK A;  1DO2 A;  3J27 B;  4LG2 A;  4IIW A;  4BB9 A;  2JP7 A;  4DR4 M;  2YQZ A;  3RE8 A;  1IXS A;  2DVW B;  2HWJ A;  1IQP A;  1P3Q Q;  3HJQ A;  4AG5 A;  1JR3 D;  4B3R M;  4CHD A;  1QDT A;  4L6V 6;  4QOZ C;  3LCV B;  2LBC A;  2WSC F;  3FYC A;  2DI0 A;  4I4L A;  3KW6 A;  1T6O A;  4AZF A;  4DV7 M;  2UUB M;  3GQ5 A;  2DZN B;  2LWX A;  2V6Z M;  1IY0 A;  1XXH A;  3T1Y M;  3J81 S;  4M9X A;  2R4E A;  1Z5B A;  1VDL A;  1CUK A;  1R5L A;  1SXJ C;  1TF0 B;  1WHC A;  2CV2 A;  1R6B X;  3HZJ A;  4G4Q A;  2QQ8 A;  5FTN A;  4JI3 M;  3CF6 E;  3FTC A;  3FYD A;  1RU3 A;  2DZO B;  1JB0 F;  1LTM A;  1MX0 A;  3K9P A;  1GL7 A;  2DWN A;  4F2L A;  4DV6 M;  4AQY M;  4FWH A;  3U60 B;  4JI6 M;  2HAK A;  3IEC A;  4LFB M;  3CTW B;  2RRU A;  4G4N A;  4JI2 M;  3KSJ A;  3M7G A;  3HKP A;  3SBJ A;  2F5S A;  2Z7J A;  2JY6 B;  2XFT A;  4CIS A;  3VDU A;  1JR3 A;  3AOG A;  3ZQJ A;  3SYK A;  3KS4 A;  2YR0 A;  2D7G A;  1DGB A;  3L29 A;  3U6P A;  4LRT A;  4JI5 M;  1JQJ C;  4MM3 B;  4KOD A;  3E46 A;  4RF0 A;  3FRI A;  3VK8 A;  2CV0 A;  2KEB A;  1XNR M;  1OFI A;  1IXS B;  2QEN A;  4LJ8 A;  1L8Q A;  3QAU A;  3SMS A;  4LF6 M;  1WR1 B;  2CV1 A;  2XSZ D;  2D7E A;  1G4A E;  1T43 A;  4LY6 A;  1IM2 A;  1TH4 A;  3C9P A;  3PXG A;  1DO0 A;  4R71 A;  4W5W A;  3AKZ A;  2KRU A;  2M5Z A;  1NY6 A;  1PJS A;  1XXH B;  4KHP M;  3M6A A;  4MGK E;  1EIJ A;  1PGY A;  3FUT A;  4LRS A;  4OVZ A;  3U61 A;  3H4M A;  1OQY A;  2N35 A;  3LQR A;  2YNM D;  2JUJ A;  3B9P A;  3I01 M;  4UN2 B;  3RC3 A;  1PJJ A;  2OO9 A;  1MJG M;  2C9C A;  4BBA A;  3NBI A;  3QYE A;  1IN4 A;  3Q8G A;  3RGP A;  3SFZ A;  1WJ7 A;  4DR1 M;  1NY5 A;  2RGO A;  4PT5 A;  1E32 A;  1KSF X;  3V76 A;  4XK8 F;  3L26 A;  1QAM A;  4DV0 M;  2UUA M;  4LF5 M;  1OTR A;  4G4O A;  2DWM A;  3FE3 A;  3SAT A;  3VFD A;  1IBL M;  2LVP C;  1QDR A;  4GIT A;  5EP2 A;  5FLX S;  3GQ4 A;  3SAU A;  2O5R A;  4DV4 M;  1N77 A;  1NVM A;  2KHH A;  2O25 A;  1AUA A;  4R3D A;  1OJL A;  5EXT A;  5BPV A;  2CRU A;  2APL A;  4FCV A;  3GLF E;  4EIW A;  2CUZ A;  4D81 A;  3I04 M;  4NRV A;  1J5E M;  3UJN A;  4LFC M;  2ZTC A;  4R7G A;  3KS8 A;  2Y0T A;  2FNA A;  2L2D A;  2CHG A;  4QNR A;  2UUC M;  3HU2 A;  4PDI A;  3A45 A;  2LNH C;  2UXB M;  1QUS A;  3TE6 A;  4D82 A;  3DFZ A;  3J7B A;  1VEG A;  4DR7 M;  4FVM A;  4P16 A;  3I4Y A;  4NXM M;  2BJW A;  4X62 M;  3GPP A;  4B3M M;  4NSR A;  2C99 A;  3C3D A;  4CJ6 A;  4L15 A;  2DAE A;  3PFI A;  2LHG A;  3BBZ A;  2L4E A;  3KOY E;  2XH9 A;  3L27 A;  4QOS A;  3U61 B;  4OVZ B;  5IWA M;  3GRY A;  1SXJ E;  1D0M A;  2JNH A;  2LHC A;  2ZAN A;  2EA0 A;  2VF7 A;  5LMN M;  1QAQ A;  1YUB A;  1PRB A;  1FNN A;  4KO8 A;  1N32 M;  2P5T A;  2WSF F;  2X4A A;  4L16 A;  2MH8 A;  3FUU A;  3B89 A;  4IBE A;  5KPT A;  1IN6 A;  1HNW M;  3RC8 A;  4OX9 M;  5E6J A;  3LCU A;  1EE8 A;  2R44 A;  3UGJ A;  5ITQ A;  4DR5 M;  2R0I A;  2GQF A;  1Y8G A;  3U6C A;  3FUV A;  5EP1 A;  2LVO C;  2K6B A;  1V33 A;  2QHO B;  4RNA A;  4X64 M;  4ITQ A;  3HY5 A;  2JY8 A;  2R9G A;  2DAM A;  1NJG A;  1HJP A;  1GAB A;  3GQ3 A;  1AIP C;  3IG8 A;  2ZBK B;  1N36 M;  4P17 A;  5GKN A;  2KXE A;  4IBF A;  2F5Q A;  3GLG A;  2H1R A;  3MK6 A;  5JI2 E;  4LJ6 A;  1R7R A;  1MW5 A;  3ES5 A;  3FUW A;  3LVW A;  3JAM S;  4WUR A;  1L2B A;  3DZD A;  4LZZ A;  2LH0 A;  3HU1 A;  4L4U A;  3T15 A;  2Y0Q A;  4AKH A;  2JZ1 A;  2FH0 A;  2DWL A;  4L8R C;  1NNU C;  5KQD A;  4LF8 M;  4FWD A;  5FTJ A;  1IBK M;  4WW0 A;  1WGN A;  3VLF B;  2CP8 A;  3BGE A;  1OKS A;  1IY2 A;  2UXC M;  3IG5 A;  3KVW A;  3LW5 F;  2AHM A;  4M0W A;  4ZPX A;  1HQY E;  4CGY B;  3GPX A;  1Z5C A;  4GH9 A;  4L78 A;  1LV7 A;  2H5X A;  3EIH A;  4I8O A;  3ZCB B;  3VKG A;  3GRV A;  3GLH A;  4IBB A;  3U6D A;  4PCZ A;  1QZE A;  5EP4 A;  2DXI A;  1WGL A;  4QHS A;  1TTE A;  3I4V A;  1OAI A;  3SC3 A;  1QAN A;  4PDG A;  1TDZ A;  4IBD A;  1N78 A;  3K92 A;  2BJV A;  1A5T A;  5DFL A;  3UMM A;  1NHG C;  5EXS A;  5ITR A;  2GNO A;  1NO1 A;  4LCB A;  2KZU A;  3GPY A;  2UU9 M;  2V1U A;  1FJG M;  3WHL A;  7CAT A;  5ITU A;  3HHZ A;  4NXN M;  3SAW A;  1PJI A;  1R2Z A;  4LJ7 A;  2DHY A;  1G8P A;  5EXP A;  2CWB A;  1QZM A;  3KOW E;  1GVN A;  5KPR A;  3U5Z A;  4Y28 F;  2QW6 A;  4GC9 A;  1GJT A;  2I7P A;  3QYB A;  1XC8 A;  4MH0 E;  5DNY A;  4JV5 M;  3MMP A;  2WZJ A;  4IBC A;  3HX3 A;  4XBO A;  4Q7J A;  1N33 M;  2J7O A;  3CTD A;  1IBM M;  3FKE A;  5FSW A;  4CHT B;  3FUX A;  3GLG B;  2FS1 A;  3HWS A;  3I51 A;  4JI4 M;  2F4V M;  3L25 A;  1XXH E;  2MJ5 B;  1UM8 A;  3B7Q A;  1VQ1 A;  3SAV A;  3F92 A;  2QBY A;  1HT2 E;  2VQE M;  3L28 A;  2Z3X A;  4AI6 A;  4WP2 A;  4FCT A;  3SMP A;  4GRI A;  2DAI A;  3D8L A;  2JY7 A;  4FCW A;  1G3I A;  4LF9 M;  4S12 A;  1GLN A;  1I4W A;  2CFO A;  2Q2E B;  2QPA A;  5E26 A;  3A46 A;  4DV1 M;  4BLC A;  2WSE F;  5H37 D;  4GKJ M;  1DV0 A;  1DGF A;  3JR4 A;  1S3S A;  4JI0 M;  3VDP A;  1QAO A;  4NRW A;  2FE8 A;  1E9R A;  5FTM A;  3GLH B;  2C96 A;  1Q3C A;  2VDB B;  1IN5 A;  4MB7 A;  1JR3 E;  1TR8 A;  5ITX A;  3KOZ E;  3FTF A;  3K8Z A;  3C58 A;  1IXR C;  1XMO M;  1F4I A;  2ZTD A;  2DKL A;  3PNV A;  4YHH M;  5IZ7 D;  3E9S A;  2I7N A;  2JWS A;  2O01 F;  5KPZ A;  1GO5 A;  1ZMW A;  2EO2 A;  2OQ4 A;  2E5L M;  2HCB A;  4KLN A;  1IN7 A;  3NBX X;  3GLI A;  5EXX A;  5EJC A;  2UXD M;  2QSF X;  1MU5 A;  1W5T A;  2BWE A;  2KA6 B;  2L09 A;  4HL4 A;  4IBI A;  4IBJ A;  1EFU B;  2M60 A;  2NQ8 C;  4LGM A;  2CE7 A;  2OOB A;  3U5Z B;  2C5R A;  3AOE A;  1HQC A;  1V34 A;  3TL4 X;  1E9S A;  1GKI A;  3THG A;  4IJE A;  3CF2 A;  1XNQ M;  1KFV A;  1D0L A;  2DAG A;  4JI1 M;  2X8A A;  3HU3 A;  3W67 A;  3KDS E;  1C1K A;  1OFH A;  4NL4 H;  4B7H A;  4G6Z A;  4B7F A;  1L1Z A;  1UFZ A;  2XF3 A;  4DR2 M;  1TGU A;  1IXZ A;  4OU7 A; 
#chains in the Genus database with same CATH homology
 1TDH A;  4M9Z A;  1R2Y A;  1L2D A;  2RGH A;  3JR5 A;  3OTO M;  5ITY A;  3UK6 A;  3A42 A;  3U6O A;  1ORY B;  3BOS A;  2R4J A;  1YSY A;  2QBY B;  1ZQ9 A;  4QHT A;  4MGI E;  2KRK A;  3T1H M;  3QWL A;  1VDD A;  5DYG A;  4DUZ M;  2F5P A;  2L7H A;  2W82 A;  4X65 M;  2KZS A;  1XMQ M;  4GHL A;  1E94 E;  3ILK A;  3W0L B;  4A3V B;  3GRU A;  2F5O A;  5IT9 S;  2QZ4 A;  4JI8 M;  2CEA A;  4FW9 A;  3FTE A;  4DV5 M;  4B3T M;  3TWL A;  2R62 A;  3U6S A;  1NNJ A;  3SHG B;  2DHR A;  1NJF A;  1X37 A;  2RKO A;  1KYI A;  4GC5 A;  3CF0 A;  4IBG A;  4D80 A;  3UZU A;  2C9O A;  2ZAM A;  4AW4 A;  3M0E A;  1HNZ M;  4MGH A;  3KP1 E;  3K2L A;  3GLI B;  4DV2 M;  4JN6 A;  3GRR A;  2QCU A;  4AG6 A;  3GPU A;  2ZM6 M;  2A5Y B;  3RGS A;  2Y21 A;  2K47 A;  3TWK A;  3U6M A;  1XWI A;  1J09 A;  2L6O A;  4LFA M;  1D2N A;  8CAT A;  4AKI A;  3K1J A;  1QQW A;  5FTL A;  2VQF M;  3AL0 C;  2YFQ A;  4B08 A;  4G4R A;  3PNY A;  2EUC A;  2ERC A;  4M0D A;  4GHA A;  4X66 M;  3PVS A;  1Q39 A;  1TH3 A;  1L2C A;  3SHF A;  3A98 B;  3ZH9 B;  3FTD A;  4JI7 M;  5LMU M;  4QNM A;  1XHB A;  5C1B A;  5IRE B;  2F5N A;  2KW0 A;  4XGI A;  2R65 A;  4NSO B;  4REZ A;  4JYA M;  2D7H A;  4M9S A;  4Z6Y A;  5ITT A;  4LF7 M;  1Z5A A;  4OW0 A;  4LJ9 A;  4K0K M;  3KSX A;  2G8L A;  3GO8 A;  5BR8 M;  1T3T A;  2ZAO A;  2XZU A;  3HJ8 A;  4LZJ A;  1SXJ D;  4LJA A;  2HHH M;  1QVR A;  2G5G X;  3AOE C;  3HHX A;  1W5S A;  4II7 A;  2CHV A;  3L2A A;  5KO3 A;  3ZC7 B;  4I5S A;  1N34 M;  1Z59 A;  3GLF A;  2L7I A;  2X49 A;  2FOI C;  3FD9 A;  1Q3B A;  3GLG E;  4DR3 M;  3EIE A;  3J2P B;  1K3X A;  5F3W A;  1DGH A;  1WXQ A;  3R8F A;  2XZF A;  1K82 A;  2BNK A;  1Z6T A;  1L1T A;  2XGN A;  1NSF A;  3DOA A;  2DWZ B;  2HKJ A;  4B7G A;  3KP0 E;  2C98 A;  4B3S M;  2XFS A;  1N75 A;  1HT1 E;  3DA1 A;  4I81 A;  4AKG A;  1SXJ A;  5EQT A;  4LJ5 A;  5EP3 A;  3GLH E;  3KFU G;  4DUY M;  2VII A;  3SAS A;  3HHW A;  4IBK A;  2LXE A;  4DR6 M;  1HNX M;  3T38 A;  4LJ4 A;  1YE9 A;  3LVV A;  1DGG A;  1J7K A;  3U6E A;  1I94 M;  2OPF A;  1K3W A;  3J80 S;  2XEP A;  4MGY E;  3TWM A;  3E4R A;  3TQS A;  3W0F A;  4FD2 A;  3GP1 A;  4LGY A;  2XSZ A;  3VK7 A;  3HHY A;  5C18 A;  4IJF A;  1ZAE A;  1QYR A;  4YY3 M;  3GLF B;  3KOX E;  2CHQ A;  4PD2 A;  2FFJ A;  4GMQ A;  5A2Q S;  1GL6 A;  4TUW A;  1IN8 A;  5DYI A;  1DGH B;  1HR0 M;  2JA2 A;  4GIP A;  1G41 A;  1PM5 A;  3HJS A;  3J7A S;  3NWL A;  2R18 A;  3U6Q A;  3VKH A;  2R45 A;  3HGI A;  3AV0 A;  1G59 A;  4RF1 A;  5JI3 E;  3WHK A;  3TPZ A;  3U60 A;  2HL7 A;  3MHV C;  2QP9 X;  3RFW A;  4MGZ E;  2J7N A;  1NHW C;  1TH2 A;  4DV3 M;  1IY1 A;  4LF4 M;  1SXJ B;  3U6L A;  4NOO B;  2R46 A;  3LQQ A;  3AJI B;  3AFH A;  3LMM A;  3MJ5 A;  5KQ8 A;  5ITX E;  2XLJ A;  1H6U A;  3R9X B;  3KXE C;  3SYL A;  4GKK M;  3SAR A;  2Z4S A;  2V1C A;  4FWG A;  3GLI E;  4JXJ A;  4HLQ A;  2Z4R A;  3D8B A;  4Z8X A;  2Y20 A;  3Q8X A;  5FTK A;  1DO2 A;  3J27 B;  4LG2 A;  4IIW A;  4BB9 A;  4DR4 M;  2YQZ A;  3RE8 A;  2DVW B;  1IQP A;  3HJQ A;  4AG5 A;  1JR3 D;  4B3R M;  4CHD A;  4QOZ C;  3FYC A;  4I4L A;  3KW6 A;  4AZF A;  4DV7 M;  2UUB M;  3GQ5 A;  2DZN B;  2LWX A;  2V6Z M;  1IY0 A;  1XXH A;  3T1Y M;  3J81 S;  4M9X A;  2R4E A;  1Z5B A;  1SXJ C;  2CV2 A;  1R6B X;  4G4Q A;  5FTN A;  4JI3 M;  3CF6 E;  3FTC A;  3FYD A;  2DZO B;  2DWN A;  1MX0 A;  1GL7 A;  4DV6 M;  4AQY M;  4FWH A;  3U60 B;  4JI6 M;  4LFB M;  3CTW B;  4G4N A;  4JI2 M;  3KSJ A;  3M7G A;  3HKP A;  3SBJ A;  2F5S A;  2Z7J A;  4CIS A;  2XFT A;  3VDU A;  1JR3 A;  3AOG A;  3SYK A;  3KS4 A;  2YR0 A;  2D7G A;  1DGB A;  3L29 A;  3U6P A;  4LRT A;  4JI5 M;  1JQJ C;  4MM3 B;  4KOD A;  4RF0 A;  3VK8 A;  2CV0 A;  2KEB A;  1XNR M;  1OFI A;  1IXS B;  2QEN A;  4LJ8 A;  1L8Q A;  3QAU A;  3SMS A;  4LF6 M;  2CV1 A;  2XSZ D;  2D7E A;  1G4A E;  4LY6 A;  1IM2 A;  1TH4 A;  3PXG A;  1DO0 A;  4W5W A;  3AKZ A;  2KRU A;  1NY6 A;  2M5Z A;  1XXH B;  4KHP M;  3M6A A;  4MGK E;  3FUT A;  3U61 A;  4LRS A;  4OVZ A;  3H4M A;  3LQR A;  2YNM D;  3B9P A;  3RC3 A;  1PJJ A;  2C9C A;  4BBA A;  3NBI A;  1IN4 A;  3RGP A;  3SFZ A;  4DR1 M;  1NY5 A;  2RGO A;  4PT5 A;  1E32 A;  1KSF X;  4DV0 M;  3L26 A;  1QAM A;  2UUA M;  4LF5 M;  4G4O A;  2DWM A;  3SAT A;  3VFD A;  1IBL M;  4GIT A;  3GQ4 A;  5EP2 A;  5FLX S;  3SAU A;  2O5R A;  4DV4 M;  1N77 A;  1NVM A;  4R3D A;  1OJL A;  5EXT A;  5BPV A;  4FCV A;  3GLF E;  4EIW A;  2CUZ A;  4D81 A;  4NRV A;  1J5E M;  3UJN A;  4LFC M;  4R7G A;  3KS8 A;  2Y0T A;  2FNA A;  2CHG A;  4QNR A;  2UUC M;  3HU2 A;  4PDI A;  3A45 A;  2LNH C;  2UXB M;  3TE6 A;  4D82 A;  3DFZ A;  3J7B A;  4DR7 M;  4FVM A;  4P16 A;  3I4Y A;  4NXM M;  2BJW A;  4X62 M;  3GPP A;  4B3M M;  4NSR A;  2C99 A;  4L15 A;  3PFI A;  3KOY E;  2XH9 A;  3L27 A;  4QOS A;  3U61 B;  4OVZ B;  5IWA M;  3GRY A;  1SXJ E;  2ZAN A;  2EA0 A;  5LMN M;  1QAQ A;  1YUB A;  4KO8 A;  1FNN A;  1N32 M;  2P5T A;  2X4A A;  4L16 A;  3FUU A;  4IBE A;  5KPT A;  1IN6 A;  1HNW M;  3RC8 A;  4OX9 M;  5E6J A;  1EE8 A;  3UGJ A;  5ITQ A;  4DR5 M;  3U6C A;  3FUV A;  5EP1 A;  4RNA A;  4X64 M;  4ITQ A;  2R9G A;  1NJG A;  3GQ3 A;  3IG8 A;  2ZBK B;  1N36 M;  5GKN A;  2KXE A;  4IBF A;  2F5Q A;  3GLG A;  2H1R A;  3MK6 A;  5JI2 E;  4LJ6 A;  1R7R A;  1MW5 A;  3ES5 A;  3FUW A;  3LVW A;  3JAM S;  4WUR A;  1L2B A;  3DZD A;  4LZZ A;  2LH0 A;  3HU1 A;  4L4U A;  3T15 A;  2Y0Q A;  4AKH A;  2DWL A;  4L8R C;  1NNU C;  5KQD A;  4LF8 M;  4FWD A;  5FTJ A;  1IBK M;  4WW0 A;  3VLF B;  3BGE A;  1IY2 A;  2UXC M;  3IG5 A;  3KVW A;  4M0W A;  2AHM A;  4ZPX A;  1HQY E;  4CGY B;  3GPX A;  1Z5C A;  4GH9 A;  4L78 A;  1LV7 A;  4I8O A;  3EIH A;  3ZCB B;  3VKG A;  3GRV A;  3GLH A;  4IBB A;  3U6D A;  4PCZ A;  5EP4 A;  2DXI A;  4QHS A;  3I4V A;  3SC3 A;  1QAN A;  4PDG A;  1TDZ A;  4IBD A;  1N78 A;  3K92 A;  2BJV A;  1A5T A;  3UMM A;  1NHG C;  5EXS A;  5ITR A;  2GNO A;  4LCB A;  2KZU A;  3GPY A;  2UU9 M;  2V1U A;  1FJG M;  3WHL A;  7CAT A;  5ITU A;  3HHZ A;  4NXN M;  3SAW A;  1PJI A;  1R2Z A;  4LJ7 A;  1G8P A;  5EXP A;  1QZM A;  3KOW E;  1GVN A;  5KPR A;  3U5Z A;  2QW6 A;  4GC9 A;  1XC8 A;  2I7P A;  4MH0 E;  5DNY A;  4JV5 M;  4IBC A;  4XBO A;  1N33 M;  2J7O A;  3CTD A;  1IBM M;  3FKE A;  5FSW A;  4CHT B;  3FUX A;  3GLG B;  3HWS A;  3I51 A;  4JI4 M;  2F4V M;  3L25 A;  3SAV A;  1XXH E;  1UM8 A;  2QBY A;  1HT2 E;  2VQE M;  3L28 A;  2Z3X A;  4AI6 A;  4FCT A;  3SMP A;  4GRI A;  3D8L A;  4FCW A;  1G3I A;  4LF9 M;  4S12 A;  1GLN A;  1I4W A;  2CFO A;  2Q2E B;  2QPA A;  5E26 A;  3A46 A;  4DV1 M;  4BLC A;  5H37 D;  4GKJ M;  1DGF A;  3JR4 A;  1S3S A;  4JI0 M;  3VDP A;  1QAO A;  4NRW A;  2FE8 A;  1E9R A;  5FTM A;  3GLH B;  2C96 A;  1Q3C A;  1IN5 A;  4MB7 A;  5ITX A;  3FTF A;  1JR3 E;  3KOZ E;  3K8Z A;  3C58 A;  1IXR C;  1XMO M;  3PNV A;  4YHH M;  5IZ7 D;  3E9S A;  2I7N A;  5KPZ A;  2EO2 A;  2OQ4 A;  2E5L M;  2HCB A;  4KLN A;  1IN7 A;  3GLI A;  5EXX A;  5EJC A;  2UXD M;  1MU5 A;  1W5T A;  2KA6 B;  2L09 A;  4HL4 A;  4IBI A;  4IBJ A;  2M60 A;  2NQ8 C;  4LGM A;  2CE7 A;  2C5R A;  3U5Z B;  3AOE A;  1HQC A;  3TL4 X;  1E9S A;  1GKI A;  3THG A;  4IJE A;  3CF2 A;  1XNQ M;  1KFV A;  4JI1 M;  2X8A A;  3HU3 A;  3KDS E;  1C1K A;  1OFH A;  4NL4 H;  4B7H A;  4G6Z A;  4B7F A;  1L1Z A;  2XF3 A;  4DR2 M;  1TGU A;  1IXZ A;  4OU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...