3U5ZA

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
b'SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 46
structure length 186
sequence length 186
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zA03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zA02
3U61A 3U5ZA 3U60A
chains in the Genus database with same CATH superfamily
3MMPA 3QYEA 2LVQD 3TWMA 1GVNA 2R44A 3DOAA 1EE8A 4CISA 3GLGE 4Q7JA 4LZZA 1K3WA 3I51A 1OFIA 1X37A 3SAUA 5EXSA 2CEAA 2LH0A 1W5TA 2Q2EB 1N77A 2FOIC 4AG6A 5ITXE 5ITRA 2CHQA 2DHYA 3TWKA 4F2LA 5KO3A 4II7A 1ZMVA 3FUVA 1H6UA 2LNHC 1GJTA 4JI7M 1T43A 3A98B 4L16A 1D0KA 3HX3A 1Z59A 1OAOC 3E21A 3M6AA 1N75A 2DAKA 3DZDA 2F5SA 3QAUA 2UUCM 4IBJA 3KOYE 3U6SA 2EUCA 2ZAOA 2QHOB 3VKGA 2FH0A 2Z8YM 2DZOB 2H1RA 1E32A 1IXRC 2KNZA 2OQ4A 4JN6A 2DWMA 4D81A 4P17A 3C3EA 3CF0A 4XBOA 5LMUM 2KHHA 1D0LA 4DR6M 2O01F 3GLIE 1IY0A 4NOOB 2I7NA 1OAIA 2UUAM 2I7PA 2X8AA 4IJEA 3VFDA 5A2QS 1A5TA 1PJIA 2CFOA 4KT0F 4HEOA 2OO9A 2W82A 4LJ4A 1GJSA 4DR7M 1P3QQ 3GPPA 1Y8GA 1I4WA 3HU3A 5IZ7D 3ZCBB 3KOXE 3GLGB 4OVZA 2Y0QA 3AKZA 3W0FA 1ZMWA 3HY5A 4IBGA 5EP3A 2RRUA 2YR0A 2FNAA 3NBXX 5DFLA 1GKIA 2DWLA 1D2NA 2DAMA 3H4MA 3SATA 2Y0TA 2DWZB 3PNVA 4DUZM 4UN2B 2KW0A 3KOZE 3T38A 2L4FA 4L8RC 4LF9M 3KSJA 3WHKA 4IBBA 4M9XA 3UGJA 1Q3BA 1WGLA 4FWDA 3K1JA 3U61B 1IM2A 1C1KA 1IN4A 4DBGB 4KODA 4D80A 1MJGM 4Z8XA 4NXMM 2UXCM 2LVPC 4WW0A 2F4VM 2BNKA 3ZH9B 2KXEA 4B7HA 2A5YB 2CV2A 2RKOA 3LVWA 3GLFE 1DGGA 4JXJA 4LGMA 3WHLA 3GLIB 4AW4A 1Z5BA 1IBKM 2KNAA 3BBZA 1HJPA 4G4RA 2D7EA 5F3WA 4BB9A 1VG5A 4AKIA 3E9SA 5JI2E 4JV5M 1T6OA 3RC8A 4QOSA 2HAKA 2DXIA 2G8LA 2VQFM 4GEWA 2F5PA 1DO0A 2HCBA 1XNQM 1YSYA 1NV8A 2EKKA 1IBLM 5BR8M 2DVWB 3AJIB 4ZPXA 4R3DA 3VK7A 2R45A 4I5SA 3SFZA 2BJWA 2FE8A 4IBFA 4MM3B 3TE6A 1QDRA 1NHGC 4DV1M 2QSFX 4XK8F 3PXGA 1NSFA 1N78A 3HJ8A 4IBDA 3T6PA 2YNMD 2XSZD 3THGA 1XMOM 1WIVA 4GHAA 1MW5A 1WXQA 3HKPA 3EIHA 3L29A 1GL7A 3UMMA 2MH8A 2V1CA 2JXNA 2Y21A 4DV2M 2C99A 4WP2A 3UZUA 4KHPM 5ITYA 3GLFB 3UJNA 1XXHE 4IJFA 3L26A 4IBEA 4FWHA 4AKGA 1BVSA 2UXBM 4NRWA 3K9OA 5EJCA 7CATA 4K0KM 3AL0C 2R62A 1MN3A 2EO2A 3GRVA 4EIWA 3U6LA 3HU2A 2DAGA 2R18A 3VDUA 3J27B 2ZAMA 1QUSA 3GPXA 1R4GA 1DGHB 2XFTA 5FSWA 2N35A 2Z4RA 1XNRM 2M5ZA 4P16A 2JY8A 4DV3M 4HL4A 1VEGA 2MJ5B 2O25A 3SARA 1SXJB 2D7GA 3B7QA 4YHHM 2AHMA 2JY6B 3M7GA 2VQEM 2R9GA 1NNUC 3GLGA 4F1IA 2EA0A 4GKKM 2CHVA 1TDHA 1VDDA 1VEKA 3U6PA 2BJVA 2KEBA 4LRSA 1W5SA 2JUJA 5ITXA 3GQ5A 3B7ZA 1N34M 3SC3A 1JR3E 1TF0B 2CWBA 3ZC7B 3FUTA 5IREB 1Z6TA 4B7FA 4GKJM 2QQ8A 2BWBA 3LW5F 3U61A 3RGPA 3GLHE 3IECA 3U6EA 2XGNA 3DA1A 4KO8A 1IN5A 2UXDM 4DV5M 4L15A 1MU5A 2ZANA 4QHTA 4B08A 3L28A 2L4EA 4LG2A 1QZEA 1WGNA 3B74A 3NBIA 1VEJA 3HWSA 4LJAA 3GLIA 5FTMA 2R0IA 5IWAM 4CJ6A 4DV4M 1MX0A 5FTNA 5ITTA 1R6BX 2ZTCA 1L8QA 4QNRA 1SXJC 1PM5A 3CGWA 2XFSA 2XEPA 3PVSA 4MH0E 3IG8A 4X66M 1YE9A 4JYAM 4G6ZA 3MJ5A 1L2BA 4PD2A 4LF6M 3KDSE 4AKHA 3DFZA 4AQYM 1NNJA 4Z6YA 1NY5A 5FLXS 5ITQA 2KA6B 1NHWC 2R6FA 1GLNA 2DNAA 3A46A 4LF8M 2Z7JA 4GC5A 4LJ7A 4AG5A 3GLHB 1IY1A 5EXPA 1R2ZA 1D0MA 3GP1A 2ZBKB 3GRRA 1R2YA 1G4AE 3U6CA 1PJQA 3MK6A 4FWGA 2QNJA 4PT5A 4NRVA 5EQTA 2R46A 3GLFA 1DV0A 2QW6A 3PNYA 3NWLA 3AFHA 3HHYA 3SAVA 4OX9M 3BGEA 2V6ZM 1HT1E 4LZJA 5KQ8A 3I01M 3JR5A 2ZM6M 2UU9M 3FTFA 2J5YA 1T3TA 1PRBA 4MGYE 2WSCF 2L6OA 1EFUB 1NJFA 3C3DA 3AOGA 2X4AA 5EXTA 3SHFA 2J7NA 3GRUA 3E46A 1DGHA 3K2LA 5H37D 4PDIA 1PJJA 4JI0M 4IBKA 2KNVA 4NSOB 3FTDA 4RKUF 3I04M 3R9XB 1JQJC 3I4VA 1SXJA 4DUYM 3KFUG 1C7YA 4B3RM 3JR4A 2LHCA 3HHWA 4LFAM 1V33A 4R71A 3U5ZB 2D7HA 3HHXA 2Z3XA 3D8BA 1QVRA 4DV7M 1L2CA 2LHGA 3CTWB 3FE3A 4KLNA 1PJSA 3FTEA 4MGKE 3LMMA 1ORYB 2UUBM 5KPRA 4NL4H 1RU3A 4GRIA 3W0LB 3MHVC 3SMPA 5EXXA 4QNMA 1XMQM 4B3SM 4IBIA 3KS8A 1E9SA 2DAEA 3AV0A 3J7BA 3RC3A 3HU1A 4FCTA 5L8RF 2XZFA 2CV1A 4QHSA 3TWLA 3C58A 4CGYB 3FRIA 2F5NA 4OW0A 4AZFA 2B3TA 2XF3A 3KVWA 5DYIA 2KZUA 3OTOM 3A42A 2C98A 3BXWA 2QPAA 1QAOA 1XWIA 2JA2A 4Y28F 5KPZA 1DGBA 4LJ8A 3KXEC 4X62M 1QAQA 2ERCA 2CHGA 5DYGA 1K3XA 4JI4M 4JI1M 1HNXM 3F92A 2C9OA 4L78A 1KFVA 1QUTA 2MR9A 4I4LA 4JI5M 1K82A 2DHRA 4MGZE 3Q8XA 4FVMA 4ITQA 1G3IA 2DENA 3GO8A 3E4RA 1TGUA 1TR8A 4RNAA 5EP1A 3FUUA 3VLFB 1KSFX 1I94M 1IXZA 1JR3A 4B3MM 1WJ7A 4LJ9A 1OJLA 4M0WA 4M9SA 4AI6A 4WURA 4QOZC 2HKJA 3PFIA 4D82A 3FKEA 5IT9S 4W5WA 2ZTDA 1AUAA 3GLHA 3IHPA 2L09A 2R4EA 1HNZM 3L25A 2JY5A 5JI3E 1N33M 3LVVA 3L27A 2R4JA 2XZUA 1TDZA 4IBCA 4L6V6 1KYIA 2V1UA 1HQCA 4MGIE 2QZ4A 3TQSA 5DNYA 1XXHB 3B9PA 3SMSA 3W67A 1SG9A 2JZ1A 2JWSA 1JB0F 1OFHA 2LTUA 2O5RA 1TTEA 5FTJA 3HGIA 3T1YM 2DWNA 3SYKA 4JI6M 4JI3M 1EIJA 1HR0M 1DO2A 3K8ZA 2FFJA 5EP4A 4LFBM 1TH4A 4I8OA 1NY6A 5KPTA 4ANRA 2DI0A 1IQPA 2K47A 1IXSB 2NQ8C 1Z5AA 3GPYA 3T1HM 3CF2A 2F5QA 3SHGB 2OOAA 2YQZA 2KRKA 4PCZA 1Z5CA 5E26A 1VQ1A 3U5ZA 3U60B 3U6OA 3A45A 3W68A 1IN8A 3KOWE 2VF7A 1FJGM 2VF8A 1LTMA 1YLAA 2L7HA 4GMQA 4RF1A 3HZJA 4GIPA 4M0DA 2KZSA 1F4IA 1NVMA 4B3TM 4LJ5A 4TUWA 2Y20A 3FRHA 5ITUA 3BOSA 4LCBA 3Q8GA 1QYRA 1UM8A 2GQFA 4DR4M 2GNOA 2LBCA 3VKHA 3QWLA 1ZQ9A 2C9CA 4LF5M 4CHDA 2E5LM 2LVNC 4M9ZA 3VK8A 4REZA 3KP0E 4I81A 1NO1A 2F5OA 1AIPC 3SBJA 4LF7M 3LQRA 4HLQA 2QBYB 1HNWM 1QZMA 2JP7A 3K9PA 1HT2E 4GH9A 3UK6A 2XLJA 4G4NA 1E94E 3QYBA 2EJSA 3LCVB 2OPFA 1IY2A 3GRYA 1XB2B 4GHLA 2JY7A 2JNHA 4LF4M 1QAMA 3SAWA 3JAMS 5EP2A 1GO5A 4IIWA 5FTKA 2M60A 3ES5A 1Q39A 1IN6A 2L7IA 3KS4A 1ZMUA 2CUZA 4NSRA 3M0EA 2MROB 4LY6A 1DGFA 3V76A 3SYLA 4PDGA 4B7GA 4FCVA 1OIZA 1WR1B 3ILKA 4RF0A 2P5TA 1ZAEA 1IFYA 1S3SA 1WHCA 2LWXA 1PGYA 1QDTA 3LQQA 2WSEF 3H4JA 3LCUA 4JI8M 2C96A 2Z4SA 3FYCA 2CP8A 4MGHA 1G8PA 1G71A 2RGHA 2WZJA 1N32M 2EKFA 1YUBA 4BLCA 3J7AS 1UFZA 4CIZA 2VIIA 3IG5A 1CUKA 1J7KA 5C18A 5KQDA 2DKLA 3FYDA 5C1BA 4MB7A 3U6MA 2HWJA 3EIEA 1OIPA 2DZNB 3AOEC 4G4QA 1SXJD 1IBMM 2L2DA 3T15A 2HL7A 5BPVA 4LFCM 3R8FA 1XXHA 2QP9X 1R5LA 2KRUA 3U6DA 3J81S 5E6JA 4XGIA 3K92A 4LGYA 1LV7A 1GL6A 4GC9A 5FTLA 1G41A 3FUWA 1N36M 2XSZA 2FS1A 1QQWA 4X65M 4DR2M 2C5RA 4A3VB 2H5XA 2LVAA 2LXEA 1NV9A 3VDPA 2HHHM 1QANA 4GITA 2QENA 4DR3M 1R7RA 3KSXA 1HQYE 3RFWA 1SXJE 1V34A 3HJSA 3RGSA 2K0BX 2XH9A 4OU7A 1Q3CA 1IXSA 1PJTA 2APLA 2CE7A 3GQ3A 1V92A 2YFQA 1GABA 2LVOC 3I4YA 4OVZB 3SASA 4DR5M 2K9DA 5LMNM 1OQYA 2X49A 3U60A 3FD9A 2DZLA 8CATA 4DR1M 3ZQJA 1L1TA 4FD2A 4G3OA 1J5EM 3GQ4A 3B89A 4NXNM 4DV6M 4BBAA 2QCUA 4FCWA 1Q02A 3HHZA 3B7NA 3KW6A 3U6QA 1XC8A 3HJQA 2JZ0A 4CHTB 4YY3M 2OOBA 3RE8A 3J2PB 2K6BA 1VDLA 2KDLA 5GKNA 3J80S 3GPUA 1XHBA 3CF6E 3TL4X 3C9PA 2WSFF 1J09A 3TPZA 3CTDA 3FTCA 4FW9A 3AOEA 1NJGA 4LJ6A 2CV0A 2G5GX 2QBYA 1G59A 1OKSA 2DAIA 4X64M 4S12A 1L2DA 1JR3D 1L1ZA 1E9RA 1OTRA 2MGWA 2RGOA 3FUXA 2J7OA 2G3QA 3KP1E 3D8LA 3L2AA 4G4OA 4L4UA 4NC6A 1IN7A 1TH3A 2R65A 4DV0M 4R7GA 4JI2M 2BWEA 1TH2A 1FNNA 2CRUA 2VDBB 4LRTA 1ZV1A
chains in the Genus database with same CATH topology
3TWMA 1GVNA 3DOAA 4CISA 1EE8A 3GLGE 4LZZA 1K3WA 3I51A 1OFIA 1X37A 3SAUA 5EXSA 2CEAA 2LH0A 1W5TA 2Q2EB 1N77A 2FOIC 4AG6A 5ITXE 5ITRA 2CHQA 3TWKA 5KO3A 4II7A 3FUVA 1H6UA 2LNHC 4JI7M 3A98B 4L16A 1Z59A 3M6AA 1N75A 3DZDA 2F5SA 3QAUA 2UUCM 4IBJA 3KOYE 3U6SA 2EUCA 2ZAOA 3VKGA 2DZOB 2H1RA 1E32A 1IXRC 2OQ4A 2DWMA 4JN6A 4D81A 3CF0A 4XBOA 5LMUM 4DR6M 3GLIE 1IY0A 4NOOB 2I7NA 2UUAM 2I7PA 2X8AA 4IJEA 3VFDA 5A2QS 1A5TA 1PJIA 2CFOA 4LJ4A 2W82A 4DR7M 3GPPA 1I4WA 3HU3A 5IZ7D 3ZCBB 3KOXE 3GLGB 4OVZA 2Y0QA 3AKZA 3W0FA 4IBGA 5EP3A 2YR0A 2FNAA 1GKIA 2DWLA 1D2NA 3H4MA 2Y0TA 2DWZB 3PNVA 4DUZM 2KW0A 3KOZE 3T38A 4LF9M 4L8RC 3KSJA 3WHKA 4IBBA 4M9XA 3UGJA 1Q3BA 4FWDA 3K1JA 3U61B 1IM2A 1C1KA 1IN4A 4KODA 4D80A 4Z8XA 4NXMM 2UXCM 4WW0A 2F4VM 2BNKA 3ZH9B 2KXEA 4B7HA 2A5YB 2CV2A 2RKOA 3LVWA 3GLFE 1DGGA 4JXJA 4LGMA 3WHLA 3GLIB 4AW4A 1Z5BA 1IBKM 4G4RA 2D7EA 5F3WA 4BB9A 4AKIA 3E9SA 5JI2E 4JV5M 3RC8A 4QOSA 2DXIA 2G8LA 2VQFM 2F5PA 1DO0A 2HCBA 1XNQM 1YSYA 1IBLM 5BR8M 2DVWB 3AJIB 4ZPXA 4R3DA 3VK7A 2R45A 4I5SA 3SFZA 2BJWA 2FE8A 4IBFA 4MM3B 3TE6A 1NHGC 4DV1M 3PXGA 1NSFA 1N78A 3HJ8A 4IBDA 2YNMD 2XSZD 3THGA 1XMOM 4GHAA 1MW5A 1WXQA 3HKPA 3EIHA 3L29A 1GL7A 3UMMA 2V1CA 2Y21A 4DV2M 2C99A 3UZUA 4KHPM 5ITYA 3GLFB 3UJNA 3L26A 4IJFA 4AKGA 4IBEA 4FWHA 1XXHE 2UXBM 4NRWA 5EJCA 7CATA 4K0KM 3AL0C 2R62A 2EO2A 4EIWA 3GRVA 3U6LA 3HU2A 2R18A 3VDUA 3J27B 2ZAMA 3GPXA 1DGHB 2XFTA 5FSWA 2Z4RA 1XNRM 2M5ZA 4P16A 4DV3M 4HL4A 3SARA 1SXJB 2D7GA 4YHHM 2AHMA 3M7GA 2VQEM 2R9GA 1NNUC 3GLGA 2EA0A 4GKKM 2CHVA 1TDHA 1VDDA 3U6PA 2BJVA 2KEBA 4LRSA 1W5SA 5ITXA 3GQ5A 1N34M 3SC3A 1JR3E 3ZC7B 3FUTA 5IREB 1Z6TA 4B7FA 4GKJM 3U61A 3RGPA 3GLHE 3U6EA 2XGNA 3DA1A 4KO8A 1IN5A 2UXDM 4DV5M 4L15A 1MU5A 2ZANA 4QHTA 4B08A 3L28A 4LG2A 3NBIA 4LJAA 3GLIA 3HWSA 5FTMA 5IWAM 4DV4M 1MX0A 5FTNA 5ITTA 1R6BX 1L8QA 4QNRA 1SXJC 1PM5A 2XFSA 2XEPA 3PVSA 4MH0E 3IG8A 4X66M 1YE9A 4JYAM 4G6ZA 3MJ5A 1L2BA 4PD2A 4LF6M 3KDSE 4AKHA 3DFZA 4AQYM 1NNJA 4Z6YA 1NY5A 5FLXS 5ITQA 2KA6B 1NHWC 1GLNA 3A46A 4LF8M 2Z7JA 4GC5A 4LJ7A 4AG5A 3GLHB 1IY1A 5EXPA 1R2ZA 3GP1A 2ZBKB 3GRRA 1R2YA 1G4AE 3U6CA 3MK6A 4FWGA 4PT5A 5EQTA 4NRVA 3GLFA 2R46A 2QW6A 3PNYA 3NWLA 3AFHA 3HHYA 3SAVA 4OX9M 3BGEA 2V6ZM 1HT1E 4LZJA 5KQ8A 3JR5A 2ZM6M 2UU9M 3FTFA 1T3TA 4MGYE 2L6OA 1NJFA 3SHFA 3AOGA 2X4AA 5EXTA 2J7NA 3GRUA 1DGHA 3K2LA 5H37D 4PDIA 1PJJA 4JI0M 4IBKA 4NSOB 3FTDA 3R9XB 1JQJC 3I4VA 1SXJA 4DUYM 3KFUG 4B3RM 3JR4A 4LFAM 3HHWA 3U5ZB 2D7HA 3HHXA 2Z3XA 3D8BA 1QVRA 4DV7M 1L2CA 3CTWB 4KLNA 3FTEA 4MGKE 3LMMA 1ORYB 2UUBM 5KPRA 4NL4H 4GRIA 3W0LB 3MHVC 3SMPA 5EXXA 4QNMA 1XMQM 4B3SM 4IBIA 3KS8A 1E9SA 3AV0A 3RC3A 3J7BA 3HU1A 4FCTA 2CV1A 2XZFA 3TWLA 3C58A 4CGYB 2F5NA 4OW0A 4AZFA 3KVWA 2XF3A 5DYIA 2KZUA 3OTOM 3A42A 2C98A 2QPAA 1QAOA 1XWIA 2JA2A 5KPZA 1DGBA 4LJ8A 3KXEC 4X62M 1QAQA 2ERCA 2CHGA 5DYGA 1K3XA 4JI4M 4JI1M 1HNXM 2C9OA 4L78A 1KFVA 4I4LA 4JI5M 1K82A 2DHRA 4MGZE 3Q8XA 4FVMA 4ITQA 1G3IA 3GO8A 3E4RA 1TGUA 4RNAA 5EP1A 3FUUA 3VLFB 1KSFX 1I94M 1IXZA 1JR3A 4B3MM 4LJ9A 4M0WA 1OJLA 4AI6A 4M9SA 4WURA 4QOZC 2HKJA 3PFIA 4D82A 3FKEA 5IT9S 4W5WA 3GLHA 1HNZM 2L09A 2R4EA 3L25A 1N33M 5JI3E 3LVVA 3L27A 2R4JA 2XZUA 1TDZA 4IBCA 1KYIA 2V1UA 1HQCA 4MGIE 2QZ4A 3TQSA 5DNYA 1XXHB 3B9PA 3SMSA 2O5RA 3SATA 1OFHA 3T1YM 2DWNA 5FTJA 4JI6M 3HGIA 3SYKA 4JI3M 1HR0M 1DO2A 3K8ZA 2FFJA 5EP4A 4LFBM 1TH4A 4I8OA 1NY6A 5KPTA 1IQPA 2K47A 1IXSB 2NQ8C 1Z5AA 3GPYA 3T1HM 3CF2A 2F5QA 3SHGB 2YQZA 2KRKA 4PCZA 1Z5CA 5E26A 3U5ZA 3U60B 3U6OA 3A45A 1IN8A 3KOWE 1FJGM 2L7HA 4GMQA 4RF1A 4GIPA 4M0DA 2KZSA 1NVMA 4B3TM 4LJ5A 4TUWA 2Y20A 5ITUA 3BOSA 4LCBA 1QYRA 1UM8A 4DR4M 2GNOA 3VKHA 3QWLA 1ZQ9A 2C9CA 4LF5M 4CHDA 2E5LM 4M9ZA 3VK8A 4REZA 3KP0E 4I81A 2F5OA 3SBJA 4LF7M 3LQRA 4HLQA 2QBYB 1HNWM 1QZMA 4GH9A 1HT2E 3UK6A 2XLJA 4G4NA 1E94E 2OPFA 1IY2A 3GRYA 4GHLA 4LF4M 1QAMA 3SAWA 3JAMS 5EP2A 4IIWA 5FTKA 2M60A 3ES5A 1Q39A 1IN6A 2L7IA 3KS4A 2CUZA 4NSRA 3M0EA 4LY6A 1DGFA 3SYLA 4PDGA 4B7GA 4FCVA 3ILKA 4RF0A 2P5TA 1ZAEA 1S3SA 2LWXA 3LQQA 4JI8M 2C96A 2Z4SA 3FYCA 4MGHA 1G8PA 2RGHA 1N32M 4BLCA 1YUBA 3J7AS 2VIIA 3IG5A 1J7KA 5C18A 5KQDA 3FYDA 5C1BA 4MB7A 3U6MA 3EIEA 2DZNB 3AOEC 4G4QA 1SXJD 1IBMM 3T15A 2HL7A 5BPVA 4LFCM 3R8FA 1XXHA 2QP9X 2KRUA 3U6DA 3J81S 5E6JA 4XGIA 3K92A 4LGYA 1LV7A 1GL6A 4GC9A 5FTLA 1G41A 3FUWA 1N36M 2XSZA 1QQWA 4X65M 4DR2M 2C5RA 4A3VB 3VDPA 2LXEA 2HHHM 1QANA 4GITA 2QENA 4DR3M 1R7RA 3KSXA 1HQYE 3RFWA 1SXJE 3HJSA 3RGSA 4OU7A 2XH9A 1Q3CA 2CE7A 3GQ3A 2YFQA 3I4YA 4OVZB 3SASA 4DR5M 5LMNM 2X49A 3U60A 3FD9A 8CATA 4DR1M 1L1TA 4FD2A 1J5EM 3GQ4A 4NXNM 4DV6M 4BBAA 2QCUA 4FCWA 3HHZA 3KW6A 3U6QA 1XC8A 3HJQA 4CHTB 4YY3M 3RE8A 3J2PB 5GKNA 3J80S 3GPUA 1XHBA 3CF6E 3TL4X 1J09A 3TPZA 3CTDA 3FTCA 4FW9A 3AOEA 1NJGA 4LJ6A 2CV0A 2G5GX 2QBYA 1G59A 4X64M 4S12A 1L2DA 1JR3D 1L1ZA 1E9RA 2RGOA 4G4OA 3FUXA 3KP1E 2J7OA 3L2AA 3D8LA 4L4UA 1IN7A 1TH3A 2R65A 4DV0M 4R7GA 4JI2M 1TH2A 1FNNA 4QHSA 4LRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U5Z A;  3U60 A; 
#chains in the Genus database with same CATH topology
 3MMP A;  3QYE A;  2LVQ D;  3TWM A;  1GVN A;  2R44 A;  3DOA A;  1EE8 A;  4CIS A;  3GLG E;  4Q7J A;  4LZZ A;  1K3W A;  3I51 A;  1OFI A;  1X37 A;  3SAU A;  5EXS A;  2CEA A;  2LH0 A;  1W5T A;  2Q2E B;  1N77 A;  2FOI C;  4AG6 A;  5ITX E;  5ITR A;  2CHQ A;  2DHY A;  3TWK A;  4F2L A;  5KO3 A;  4II7 A;  1ZMV A;  3FUV A;  1H6U A;  2LNH C;  1GJT A;  4JI7 M;  1T43 A;  3A98 B;  4L16 A;  1D0K A;  3HX3 A;  1Z59 A;  1OAO C;  3E21 A;  3M6A A;  1N75 A;  2DAK A;  3DZD A;  2F5S A;  3QAU A;  2UUC M;  4IBJ A;  3KOY E;  3U6S A;  2EUC A;  2ZAO A;  2QHO B;  3VKG A;  2FH0 A;  2Z8Y M;  2DZO B;  2H1R A;  1E32 A;  1IXR C;  2KNZ A;  2OQ4 A;  4JN6 A;  2DWM A;  4D81 A;  4P17 A;  3C3E A;  3CF0 A;  4XBO A;  5LMU M;  2KHH A;  1D0L A;  4DR6 M;  2O01 F;  3GLI E;  1IY0 A;  4NOO B;  2I7N A;  1OAI A;  2UUA M;  2I7P A;  2X8A A;  4IJE A;  3VFD A;  5A2Q S;  1A5T A;  1PJI A;  2CFO A;  4KT0 F;  4HEO A;  2OO9 A;  2W82 A;  4LJ4 A;  1GJS A;  4DR7 M;  1P3Q Q;  3GPP A;  1Y8G A;  1I4W A;  3HU3 A;  5IZ7 D;  3ZCB B;  3KOX E;  3GLG B;  4OVZ A;  2Y0Q A;  3AKZ A;  3W0F A;  1ZMW A;  3HY5 A;  4IBG A;  5EP3 A;  2RRU A;  2YR0 A;  2FNA A;  3NBX X;  5DFL A;  1GKI A;  2DWL A;  1D2N A;  2DAM A;  3H4M A;  3SAT A;  2Y0T A;  2DWZ B;  3PNV A;  4DUZ M;  4UN2 B;  2KW0 A;  3KOZ E;  3T38 A;  2L4F A;  4L8R C;  4LF9 M;  3KSJ A;  3WHK A;  4IBB A;  4M9X A;  3UGJ A;  1Q3B A;  1WGL A;  4FWD A;  3K1J A;  3U61 B;  1IM2 A;  1C1K A;  1IN4 A;  4DBG B;  4KOD A;  4D80 A;  1MJG M;  4Z8X A;  4NXM M;  2UXC M;  2LVP C;  4WW0 A;  2F4V M;  2BNK A;  3ZH9 B;  2KXE A;  4B7H A;  2A5Y B;  2CV2 A;  2RKO A;  3LVW A;  3GLF E;  1DGG A;  4JXJ A;  4LGM A;  3WHL A;  3GLI B;  4AW4 A;  1Z5B A;  1IBK M;  2KNA A;  3BBZ A;  1HJP A;  4G4R A;  2D7E A;  5F3W A;  4BB9 A;  1VG5 A;  4AKI A;  3E9S A;  5JI2 E;  4JV5 M;  1T6O A;  3RC8 A;  4QOS A;  2HAK A;  2DXI A;  2G8L A;  2VQF M;  4GEW A;  2F5P A;  1DO0 A;  2HCB A;  1XNQ M;  1YSY A;  1NV8 A;  2EKK A;  1IBL M;  5BR8 M;  2DVW B;  3AJI B;  4ZPX A;  4R3D A;  3VK7 A;  2R45 A;  4I5S A;  3SFZ A;  2BJW A;  2FE8 A;  4IBF A;  4MM3 B;  3TE6 A;  1QDR A;  1NHG C;  4DV1 M;  2QSF X;  4XK8 F;  3PXG A;  1NSF A;  1N78 A;  3HJ8 A;  4IBD A;  3T6P A;  2YNM D;  2XSZ D;  3THG A;  1XMO M;  1WIV A;  4GHA A;  1MW5 A;  1WXQ A;  3HKP A;  3EIH A;  3L29 A;  1GL7 A;  3UMM A;  2MH8 A;  2V1C A;  2JXN A;  2Y21 A;  4DV2 M;  2C99 A;  4WP2 A;  3UZU A;  4KHP M;  5ITY A;  3GLF B;  3UJN A;  1XXH E;  4IJF A;  3L26 A;  4IBE A;  4FWH A;  4AKG A;  1BVS A;  2UXB M;  4NRW A;  3K9O A;  5EJC A;  7CAT A;  4K0K M;  3AL0 C;  2R62 A;  1MN3 A;  2EO2 A;  3GRV A;  4EIW A;  3U6L A;  3HU2 A;  2DAG A;  2R18 A;  3VDU A;  3J27 B;  2ZAM A;  1QUS A;  3GPX A;  1R4G A;  1DGH B;  2XFT A;  5FSW A;  2N35 A;  2Z4R A;  1XNR M;  2M5Z A;  4P16 A;  2JY8 A;  4DV3 M;  4HL4 A;  1VEG A;  2MJ5 B;  2O25 A;  3SAR A;  1SXJ B;  2D7G A;  3B7Q A;  4YHH M;  2AHM A;  2JY6 B;  3M7G A;  2VQE M;  2R9G A;  1NNU C;  3GLG A;  4F1I A;  2EA0 A;  4GKK M;  2CHV A;  1TDH A;  1VDD A;  1VEK A;  3U6P A;  2BJV A;  2KEB A;  4LRS A;  1W5S A;  2JUJ A;  5ITX A;  3GQ5 A;  3B7Z A;  1N34 M;  3SC3 A;  1JR3 E;  1TF0 B;  2CWB A;  3ZC7 B;  3FUT A;  5IRE B;  1Z6T A;  4B7F A;  4GKJ M;  2QQ8 A;  2BWB A;  3LW5 F;  3U61 A;  3RGP A;  3GLH E;  3IEC A;  3U6E A;  2XGN A;  3DA1 A;  4KO8 A;  1IN5 A;  2UXD M;  4DV5 M;  4L15 A;  1MU5 A;  2ZAN A;  4QHT A;  4B08 A;  3L28 A;  2L4E A;  4LG2 A;  1QZE A;  1WGN A;  3B74 A;  3NBI A;  1VEJ A;  3HWS A;  4LJA A;  3GLI A;  5FTM A;  2R0I A;  5IWA M;  4CJ6 A;  4DV4 M;  1MX0 A;  5FTN A;  5ITT A;  1R6B X;  2ZTC A;  1L8Q A;  4QNR A;  1SXJ C;  1PM5 A;  3CGW A;  2XFS A;  2XEP A;  3PVS A;  4MH0 E;  3IG8 A;  4X66 M;  1YE9 A;  4JYA M;  4G6Z A;  3MJ5 A;  1L2B A;  4PD2 A;  4LF6 M;  3KDS E;  4AKH A;  3DFZ A;  4AQY M;  1NNJ A;  4Z6Y A;  1NY5 A;  5FLX S;  5ITQ A;  2KA6 B;  1NHW C;  2R6F A;  1GLN A;  2DNA A;  3A46 A;  4LF8 M;  2Z7J A;  4GC5 A;  4LJ7 A;  4AG5 A;  3GLH B;  1IY1 A;  5EXP A;  1R2Z A;  1D0M A;  3GP1 A;  2ZBK B;  3GRR A;  1R2Y A;  1G4A E;  3U6C A;  1PJQ A;  3MK6 A;  4FWG A;  2QNJ A;  4PT5 A;  4NRV A;  5EQT A;  2R46 A;  3GLF A;  1DV0 A;  2QW6 A;  3PNY A;  3NWL A;  3AFH A;  3HHY A;  3SAV A;  4OX9 M;  3BGE A;  2V6Z M;  1HT1 E;  4LZJ A;  5KQ8 A;  3I01 M;  3JR5 A;  2ZM6 M;  2UU9 M;  3FTF A;  2J5Y A;  1T3T A;  1PRB A;  4MGY E;  2WSC F;  2L6O A;  1EFU B;  1NJF A;  3C3D A;  3AOG A;  2X4A A;  5EXT A;  3SHF A;  2J7N A;  3GRU A;  3E46 A;  1DGH A;  3K2L A;  5H37 D;  4PDI A;  1PJJ A;  4JI0 M;  4IBK A;  2KNV A;  4NSO B;  3FTD A;  4RKU F;  3I04 M;  3R9X B;  1JQJ C;  3I4V A;  1SXJ A;  4DUY M;  3KFU G;  1C7Y A;  4B3R M;  3JR4 A;  2LHC A;  3HHW A;  4LFA M;  1V33 A;  4R71 A;  3U5Z B;  2D7H A;  3HHX A;  2Z3X A;  3D8B A;  1QVR A;  4DV7 M;  1L2C A;  2LHG A;  3CTW B;  3FE3 A;  4KLN A;  1PJS A;  3FTE A;  4MGK E;  3LMM A;  1ORY B;  2UUB M;  5KPR A;  4NL4 H;  1RU3 A;  4GRI A;  3W0L B;  3MHV C;  3SMP A;  5EXX A;  4QNM A;  1XMQ M;  4B3S M;  4IBI A;  3KS8 A;  1E9S A;  2DAE A;  3AV0 A;  3J7B A;  3RC3 A;  3HU1 A;  4FCT A;  5L8R F;  2XZF A;  2CV1 A;  4QHS A;  3TWL A;  3C58 A;  4CGY B;  3FRI A;  2F5N A;  4OW0 A;  4AZF A;  2B3T A;  2XF3 A;  3KVW A;  5DYI A;  2KZU A;  3OTO M;  3A42 A;  2C98 A;  3BXW A;  2QPA A;  1QAO A;  1XWI A;  2JA2 A;  4Y28 F;  5KPZ A;  1DGB A;  4LJ8 A;  3KXE C;  4X62 M;  1QAQ A;  2ERC A;  2CHG A;  5DYG A;  1K3X A;  4JI4 M;  4JI1 M;  1HNX M;  3F92 A;  2C9O A;  4L78 A;  1KFV A;  1QUT A;  2MR9 A;  4I4L A;  4JI5 M;  1K82 A;  2DHR A;  4MGZ E;  3Q8X A;  4FVM A;  4ITQ A;  1G3I A;  2DEN A;  3GO8 A;  3E4R A;  1TGU A;  1TR8 A;  4RNA A;  5EP1 A;  3FUU A;  3VLF B;  1KSF X;  1I94 M;  1IXZ A;  1JR3 A;  4B3M M;  1WJ7 A;  4LJ9 A;  1OJL A;  4M0W A;  4M9S A;  4AI6 A;  4WUR A;  4QOZ C;  2HKJ A;  3PFI A;  4D82 A;  3FKE A;  5IT9 S;  4W5W A;  2ZTD A;  1AUA A;  3GLH A;  3IHP A;  2L09 A;  2R4E A;  1HNZ M;  3L25 A;  2JY5 A;  5JI3 E;  1N33 M;  3LVV A;  3L27 A;  2R4J A;  2XZU A;  1TDZ A;  4IBC A;  4L6V 6;  1KYI A;  2V1U A;  1HQC A;  4MGI E;  2QZ4 A;  3TQS A;  5DNY A;  1XXH B;  3B9P A;  3SMS A;  3W67 A;  1SG9 A;  2JZ1 A;  2JWS A;  1JB0 F;  1OFH A;  2LTU A;  2O5R A;  1TTE A;  5FTJ A;  3HGI A;  3T1Y M;  2DWN A;  3SYK A;  4JI6 M;  4JI3 M;  1EIJ A;  1HR0 M;  1DO2 A;  3K8Z A;  2FFJ A;  5EP4 A;  4LFB M;  1TH4 A;  4I8O A;  1NY6 A;  5KPT A;  4ANR A;  2DI0 A;  1IQP A;  2K47 A;  1IXS B;  2NQ8 C;  1Z5A A;  3GPY A;  3T1H M;  3CF2 A;  2F5Q A;  3SHG B;  2OOA A;  2YQZ A;  2KRK A;  4PCZ A;  1Z5C A;  5E26 A;  1VQ1 A;  3U5Z A;  3U60 B;  3U6O A;  3A45 A;  3W68 A;  1IN8 A;  3KOW E;  2VF7 A;  1FJG M;  2VF8 A;  1LTM A;  1YLA A;  2L7H A;  4GMQ A;  4RF1 A;  3HZJ A;  4GIP A;  4M0D A;  2KZS A;  1F4I A;  1NVM A;  4B3T M;  4LJ5 A;  4TUW A;  2Y20 A;  3FRH A;  5ITU A;  3BOS A;  4LCB A;  3Q8G A;  1QYR A;  1UM8 A;  2GQF A;  4DR4 M;  2GNO A;  2LBC A;  3VKH A;  3QWL A;  1ZQ9 A;  2C9C A;  4LF5 M;  4CHD A;  2E5L M;  2LVN C;  4M9Z A;  3VK8 A;  4REZ A;  3KP0 E;  4I81 A;  1NO1 A;  2F5O A;  1AIP C;  3SBJ A;  4LF7 M;  3LQR A;  4HLQ A;  2QBY B;  1HNW M;  1QZM A;  2JP7 A;  3K9P A;  1HT2 E;  4GH9 A;  3UK6 A;  2XLJ A;  4G4N A;  1E94 E;  3QYB A;  2EJS A;  3LCV B;  2OPF A;  1IY2 A;  3GRY A;  1XB2 B;  4GHL A;  2JY7 A;  2JNH A;  4LF4 M;  1QAM A;  3SAW A;  3JAM S;  5EP2 A;  1GO5 A;  4IIW A;  5FTK A;  2M60 A;  3ES5 A;  1Q39 A;  1IN6 A;  2L7I A;  3KS4 A;  1ZMU A;  2CUZ A;  4NSR A;  3M0E A;  2MRO B;  4LY6 A;  1DGF A;  3V76 A;  3SYL A;  4PDG A;  4B7G A;  4FCV A;  1OIZ A;  1WR1 B;  3ILK A;  4RF0 A;  2P5T A;  1ZAE A;  1IFY A;  1S3S A;  1WHC A;  2LWX A;  1PGY A;  1QDT A;  3LQQ A;  2WSE F;  3H4J A;  3LCU A;  4JI8 M;  2C96 A;  2Z4S A;  3FYC A;  2CP8 A;  4MGH A;  1G8P A;  1G71 A;  2RGH A;  2WZJ A;  1N32 M;  2EKF A;  1YUB A;  4BLC A;  3J7A S;  1UFZ A;  4CIZ A;  2VII A;  3IG5 A;  1CUK A;  1J7K A;  5C18 A;  5KQD A;  2DKL A;  3FYD A;  5C1B A;  4MB7 A;  3U6M A;  2HWJ A;  3EIE A;  1OIP A;  2DZN B;  3AOE C;  4G4Q A;  1SXJ D;  1IBM M;  2L2D A;  3T15 A;  2HL7 A;  5BPV A;  4LFC M;  3R8F A;  1XXH A;  2QP9 X;  1R5L A;  2KRU A;  3U6D A;  3J81 S;  5E6J A;  4XGI A;  3K92 A;  4LGY A;  1LV7 A;  1GL6 A;  4GC9 A;  5FTL A;  1G41 A;  3FUW A;  1N36 M;  2XSZ A;  2FS1 A;  1QQW A;  4X65 M;  4DR2 M;  2C5R A;  4A3V B;  2H5X A;  2LVA A;  2LXE A;  1NV9 A;  3VDP A;  2HHH M;  1QAN A;  4GIT A;  2QEN A;  4DR3 M;  1R7R A;  3KSX A;  1HQY E;  3RFW A;  1SXJ E;  1V34 A;  3HJS A;  3RGS A;  2K0B X;  2XH9 A;  4OU7 A;  1Q3C A;  1IXS A;  1PJT A;  2APL A;  2CE7 A;  3GQ3 A;  1V92 A;  2YFQ A;  1GAB A;  2LVO C;  3I4Y A;  4OVZ B;  3SAS A;  4DR5 M;  2K9D A;  5LMN M;  1OQY A;  2X49 A;  3U60 A;  3FD9 A;  2DZL A;  8CAT A;  4DR1 M;  3ZQJ A;  1L1T A;  4FD2 A;  4G3O A;  1J5E M;  3GQ4 A;  3B89 A;  4NXN M;  4DV6 M;  4BBA A;  2QCU A;  4FCW A;  1Q02 A;  3HHZ A;  3B7N A;  3KW6 A;  3U6Q A;  1XC8 A;  3HJQ A;  2JZ0 A;  4CHT B;  4YY3 M;  2OOB A;  3RE8 A;  3J2P B;  2K6B A;  1VDL A;  2KDL A;  5GKN A;  3J80 S;  3GPU A;  1XHB A;  3CF6 E;  3TL4 X;  3C9P A;  2WSF F;  1J09 A;  3TPZ A;  3CTD A;  3FTC A;  4FW9 A;  3AOE A;  1NJG A;  4LJ6 A;  2CV0 A;  2G5G X;  2QBY A;  1G59 A;  1OKS A;  2DAI A;  4X64 M;  4S12 A;  1L2D A;  1JR3 D;  1L1Z A;  1E9R A;  1OTR A;  2MGW A;  2RGO A;  3FUX A;  2J7O A;  2G3Q A;  3KP1 E;  3D8L A;  3L2A A;  4G4O A;  4L4U A;  4NC6 A;  1IN7 A;  1TH3 A;  2R65 A;  4DV0 M;  4R7G A;  4JI2 M;  2BWE A;  1TH2 A;  1FNN A;  2CRU A;  2VDB B;  4LRT A;  1ZV1 A; 
#chains in the Genus database with same CATH homology
 3TWM A;  1GVN A;  3DOA A;  4CIS A;  1EE8 A;  3GLG E;  4LZZ A;  1K3W A;  3I51 A;  1OFI A;  1X37 A;  3SAU A;  5EXS A;  2CEA A;  2LH0 A;  1W5T A;  2Q2E B;  1N77 A;  2FOI C;  4AG6 A;  5ITX E;  5ITR A;  2CHQ A;  3TWK A;  5KO3 A;  4II7 A;  3FUV A;  1H6U A;  2LNH C;  4JI7 M;  3A98 B;  4L16 A;  1Z59 A;  3M6A A;  1N75 A;  3DZD A;  2F5S A;  3QAU A;  2UUC M;  4IBJ A;  3KOY E;  3U6S A;  2EUC A;  2ZAO A;  3VKG A;  2DZO B;  2H1R A;  1E32 A;  1IXR C;  2OQ4 A;  2DWM A;  4JN6 A;  4D81 A;  3CF0 A;  4XBO A;  5LMU M;  4DR6 M;  3GLI E;  1IY0 A;  4NOO B;  2I7N A;  2UUA M;  2I7P A;  2X8A A;  4IJE A;  3VFD A;  5A2Q S;  1A5T A;  1PJI A;  2CFO A;  4LJ4 A;  2W82 A;  4DR7 M;  3GPP A;  1I4W A;  3HU3 A;  5IZ7 D;  3ZCB B;  3KOX E;  3GLG B;  4OVZ A;  2Y0Q A;  3AKZ A;  3W0F A;  4IBG A;  5EP3 A;  2YR0 A;  2FNA A;  1GKI A;  2DWL A;  1D2N A;  3H4M A;  2Y0T A;  2DWZ B;  3PNV A;  4DUZ M;  2KW0 A;  3KOZ E;  3T38 A;  4LF9 M;  4L8R C;  3KSJ A;  3WHK A;  4IBB A;  4M9X A;  3UGJ A;  1Q3B A;  4FWD A;  3K1J A;  3U61 B;  1IM2 A;  1C1K A;  1IN4 A;  4KOD A;  4D80 A;  4Z8X A;  4NXM M;  2UXC M;  4WW0 A;  2F4V M;  2BNK A;  3ZH9 B;  2KXE A;  4B7H A;  2A5Y B;  2CV2 A;  2RKO A;  3LVW A;  3GLF E;  1DGG A;  4JXJ A;  4LGM A;  3WHL A;  3GLI B;  4AW4 A;  1Z5B A;  1IBK M;  4G4R A;  2D7E A;  5F3W A;  4BB9 A;  4AKI A;  3E9S A;  5JI2 E;  4JV5 M;  3RC8 A;  4QOS A;  2DXI A;  2G8L A;  2VQF M;  2F5P A;  1DO0 A;  2HCB A;  1XNQ M;  1YSY A;  1IBL M;  5BR8 M;  2DVW B;  3AJI B;  4ZPX A;  4R3D A;  3VK7 A;  2R45 A;  4I5S A;  3SFZ A;  2BJW A;  2FE8 A;  4IBF A;  4MM3 B;  3TE6 A;  1NHG C;  4DV1 M;  3PXG A;  1NSF A;  1N78 A;  3HJ8 A;  4IBD A;  2YNM D;  2XSZ D;  3THG A;  1XMO M;  4GHA A;  1MW5 A;  1WXQ A;  3HKP A;  3EIH A;  3L29 A;  1GL7 A;  3UMM A;  2V1C A;  2Y21 A;  4DV2 M;  2C99 A;  3UZU A;  4KHP M;  5ITY A;  3GLF B;  3UJN A;  3L26 A;  4IJF A;  4AKG A;  4IBE A;  4FWH A;  1XXH E;  2UXB M;  4NRW A;  5EJC A;  7CAT A;  4K0K M;  3AL0 C;  2R62 A;  2EO2 A;  4EIW A;  3GRV A;  3U6L A;  3HU2 A;  2R18 A;  3VDU A;  3J27 B;  2ZAM A;  3GPX A;  1DGH B;  2XFT A;  5FSW A;  2Z4R A;  1XNR M;  2M5Z A;  4P16 A;  4DV3 M;  4HL4 A;  3SAR A;  1SXJ B;  2D7G A;  4YHH M;  2AHM A;  3M7G A;  2VQE M;  2R9G A;  1NNU C;  3GLG A;  2EA0 A;  4GKK M;  2CHV A;  1TDH A;  1VDD A;  3U6P A;  2BJV A;  2KEB A;  4LRS A;  1W5S A;  5ITX A;  3GQ5 A;  1N34 M;  3SC3 A;  1JR3 E;  3ZC7 B;  3FUT A;  5IRE B;  1Z6T A;  4B7F A;  4GKJ M;  3U61 A;  3RGP A;  3GLH E;  3U6E A;  2XGN A;  3DA1 A;  4KO8 A;  1IN5 A;  2UXD M;  4DV5 M;  4L15 A;  1MU5 A;  2ZAN A;  4QHT A;  4B08 A;  3L28 A;  4LG2 A;  3NBI A;  4LJA A;  3GLI A;  3HWS A;  5FTM A;  5IWA M;  4DV4 M;  1MX0 A;  5FTN A;  5ITT A;  1R6B X;  1L8Q A;  4QNR A;  1SXJ C;  1PM5 A;  2XFS A;  2XEP A;  3PVS A;  4MH0 E;  3IG8 A;  4X66 M;  1YE9 A;  4JYA M;  4G6Z A;  3MJ5 A;  1L2B A;  4PD2 A;  4LF6 M;  3KDS E;  4AKH A;  3DFZ A;  4AQY M;  1NNJ A;  4Z6Y A;  1NY5 A;  5FLX S;  5ITQ A;  2KA6 B;  1NHW C;  1GLN A;  3A46 A;  4LF8 M;  2Z7J A;  4GC5 A;  4LJ7 A;  4AG5 A;  3GLH B;  1IY1 A;  5EXP A;  1R2Z A;  3GP1 A;  2ZBK B;  3GRR A;  1R2Y A;  1G4A E;  3U6C A;  3MK6 A;  4FWG A;  4PT5 A;  5EQT A;  4NRV A;  3GLF A;  2R46 A;  2QW6 A;  3PNY A;  3NWL A;  3AFH A;  3HHY A;  3SAV A;  4OX9 M;  3BGE A;  2V6Z M;  1HT1 E;  4LZJ A;  5KQ8 A;  3JR5 A;  2ZM6 M;  2UU9 M;  3FTF A;  1T3T A;  4MGY E;  2L6O A;  1NJF A;  3SHF A;  3AOG A;  2X4A A;  5EXT A;  2J7N A;  3GRU A;  1DGH A;  3K2L A;  5H37 D;  4PDI A;  1PJJ A;  4JI0 M;  4IBK A;  4NSO B;  3FTD A;  3R9X B;  1JQJ C;  3I4V A;  1SXJ A;  4DUY M;  3KFU G;  4B3R M;  3JR4 A;  4LFA M;  3HHW A;  3U5Z B;  2D7H A;  3HHX A;  2Z3X A;  3D8B A;  1QVR A;  4DV7 M;  1L2C A;  3CTW B;  4KLN A;  3FTE A;  4MGK E;  3LMM A;  1ORY B;  2UUB M;  5KPR A;  4NL4 H;  4GRI A;  3W0L B;  3MHV C;  3SMP A;  5EXX A;  4QNM A;  1XMQ M;  4B3S M;  4IBI A;  3KS8 A;  1E9S A;  3AV0 A;  3RC3 A;  3J7B A;  3HU1 A;  4FCT A;  2CV1 A;  2XZF A;  3TWL A;  3C58 A;  4CGY B;  2F5N A;  4OW0 A;  4AZF A;  3KVW A;  2XF3 A;  5DYI A;  2KZU A;  3OTO M;  3A42 A;  2C98 A;  2QPA A;  1QAO A;  1XWI A;  2JA2 A;  5KPZ A;  1DGB A;  4LJ8 A;  3KXE C;  4X62 M;  1QAQ A;  2ERC A;  2CHG A;  5DYG A;  1K3X A;  4JI4 M;  4JI1 M;  1HNX M;  2C9O A;  4L78 A;  1KFV A;  4I4L A;  4JI5 M;  1K82 A;  2DHR A;  4MGZ E;  3Q8X A;  4FVM A;  4ITQ A;  1G3I A;  3GO8 A;  3E4R A;  1TGU A;  4RNA A;  5EP1 A;  3FUU A;  3VLF B;  1KSF X;  1I94 M;  1IXZ A;  1JR3 A;  4B3M M;  4LJ9 A;  4M0W A;  1OJL A;  4AI6 A;  4M9S A;  4WUR A;  4QOZ C;  2HKJ A;  3PFI A;  4D82 A;  3FKE A;  5IT9 S;  4W5W A;  3GLH A;  1HNZ M;  2L09 A;  2R4E A;  3L25 A;  1N33 M;  5JI3 E;  3LVV A;  3L27 A;  2R4J A;  2XZU A;  1TDZ A;  4IBC A;  1KYI A;  2V1U A;  1HQC A;  4MGI E;  2QZ4 A;  3TQS A;  5DNY A;  1XXH B;  3B9P A;  3SMS A;  2O5R A;  3SAT A;  1OFH A;  3T1Y M;  2DWN A;  5FTJ A;  4JI6 M;  3HGI A;  3SYK A;  4JI3 M;  1HR0 M;  1DO2 A;  3K8Z A;  2FFJ A;  5EP4 A;  4LFB M;  1TH4 A;  4I8O A;  1NY6 A;  5KPT A;  1IQP A;  2K47 A;  1IXS B;  2NQ8 C;  1Z5A A;  3GPY A;  3T1H M;  3CF2 A;  2F5Q A;  3SHG B;  2YQZ A;  2KRK A;  4PCZ A;  1Z5C A;  5E26 A;  3U5Z A;  3U60 B;  3U6O A;  3A45 A;  1IN8 A;  3KOW E;  1FJG M;  2L7H A;  4GMQ A;  4RF1 A;  4GIP A;  4M0D A;  2KZS A;  1NVM A;  4B3T M;  4LJ5 A;  4TUW A;  2Y20 A;  5ITU A;  3BOS A;  4LCB A;  1QYR A;  1UM8 A;  4DR4 M;  2GNO A;  3VKH A;  3QWL A;  1ZQ9 A;  2C9C A;  4LF5 M;  4CHD A;  2E5L M;  4M9Z A;  3VK8 A;  4REZ A;  3KP0 E;  4I81 A;  2F5O A;  3SBJ A;  4LF7 M;  3LQR A;  4HLQ A;  2QBY B;  1HNW M;  1QZM A;  4GH9 A;  1HT2 E;  3UK6 A;  2XLJ A;  4G4N A;  1E94 E;  2OPF A;  1IY2 A;  3GRY A;  4GHL A;  4LF4 M;  1QAM A;  3SAW A;  3JAM S;  5EP2 A;  4IIW A;  5FTK A;  2M60 A;  3ES5 A;  1Q39 A;  1IN6 A;  2L7I A;  3KS4 A;  2CUZ A;  4NSR A;  3M0E A;  4LY6 A;  1DGF A;  3SYL A;  4PDG A;  4B7G A;  4FCV A;  3ILK A;  4RF0 A;  2P5T A;  1ZAE A;  1S3S A;  2LWX A;  3LQQ A;  4JI8 M;  2C96 A;  2Z4S A;  3FYC A;  4MGH A;  1G8P A;  2RGH A;  1N32 M;  4BLC A;  1YUB A;  3J7A S;  2VII A;  3IG5 A;  1J7K A;  5C18 A;  5KQD A;  3FYD A;  5C1B A;  4MB7 A;  3U6M A;  3EIE A;  2DZN B;  3AOE C;  4G4Q A;  1SXJ D;  1IBM M;  3T15 A;  2HL7 A;  5BPV A;  4LFC M;  3R8F A;  1XXH A;  2QP9 X;  2KRU A;  3U6D A;  3J81 S;  5E6J A;  4XGI A;  3K92 A;  4LGY A;  1LV7 A;  1GL6 A;  4GC9 A;  5FTL A;  1G41 A;  3FUW A;  1N36 M;  2XSZ A;  1QQW A;  4X65 M;  4DR2 M;  2C5R A;  4A3V B;  3VDP A;  2LXE A;  2HHH M;  1QAN A;  4GIT A;  2QEN A;  4DR3 M;  1R7R A;  3KSX A;  1HQY E;  3RFW A;  1SXJ E;  3HJS A;  3RGS A;  4OU7 A;  2XH9 A;  1Q3C A;  2CE7 A;  3GQ3 A;  2YFQ A;  3I4Y A;  4OVZ B;  3SAS A;  4DR5 M;  5LMN M;  2X49 A;  3U60 A;  3FD9 A;  8CAT A;  4DR1 M;  1L1T A;  4FD2 A;  1J5E M;  3GQ4 A;  4NXN M;  4DV6 M;  4BBA A;  2QCU A;  4FCW A;  3HHZ A;  3KW6 A;  3U6Q A;  1XC8 A;  3HJQ A;  4CHT B;  4YY3 M;  3RE8 A;  3J2P B;  5GKN A;  3J80 S;  3GPU A;  1XHB A;  3CF6 E;  3TL4 X;  1J09 A;  3TPZ A;  3CTD A;  3FTC A;  4FW9 A;  3AOE A;  1NJG A;  4LJ6 A;  2CV0 A;  2G5G X;  2QBY A;  1G59 A;  4X64 M;  4S12 A;  1L2D A;  1JR3 D;  1L1Z A;  1E9R A;  2RGO A;  4G4O A;  3FUX A;  3KP1 E;  2J7O A;  3L2A A;  3D8L A;  4L4U A;  1IN7 A;  1TH3 A;  2R65 A;  4DV0 M;  4R7G A;  4JI2 M;  1TH2 A;  1FNN A;  4QHS A;  4LRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...