The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
97
|
structure length |
97
|
Chain Sequence |
VTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb |
| molecule keywords |
Receptor activity-modifying protein 2
|
| molecule tags |
Transport protein/membrane protein
|
| source organism |
Homo sapiens
|
| total genus |
18
|
| structure length |
97
|
| sequence length |
97
|
| ec nomenclature | |
| pdb deposition date | 2010-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF02793 | HRM | Hormone receptor domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Hormone receptor fold | GPCR, family 2, extracellular hormone receptor domain |
#chains in the Genus database with same CATH superfamily 3C5T A; 3C59 A; 3L2J A; 4ERS A; 4LF3 C; 5II0 A; 3EHT A; 2L27 A; 3N7S A; 4DLQ A; 2JND A; 3IOL A; 1U34 A; 3H3G A; 3N7P A; 2JNC A; 3N7R A; 2JOD A; 3AQF B; 2XDG A; 3EHU A; 4ZGM A; 3C4M A; 2QKH A; 4DLO A; 4HJ0 A; 3EHS A; #chains in the Genus database with same CATH topology 3C5T A; 3C59 A; 3L2J A; 4ERS A; 4LF3 C; 5II0 A; 3EHT A; 2L27 A; 3N7S A; 4DLQ A; 2JND A; 3IOL A; 1U34 A; 3H3G A; 3N7P A; 2JNC A; 3N7R A; 2JOD A; 3AQF B; 2XDG A; 3EHU A; 4ZGM A; 3C4M A; 2QKH A; 4DLO A; 4HJ0 A; 3EHS A; #chains in the Genus database with same CATH homology 3C5T A; 3C59 A; 3L2J A; 4ERS A; 4LF3 C; 5II0 A; 3EHT A; 2L27 A; 3N7S A; 4DLQ A; 2JND A; 3IOL A; 1U34 A; 3H3G A; 3N7P A; 2JNC A; 3N7R A; 2JOD A; 3AQF B; 2XDG A; 3EHU A; 4ZGM A; 3C4M A; 2QKH A; 4DLO A; 4HJ0 A; 3EHS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...