The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
163
|
structure length |
150
|
Chain Sequence |
NHFDVISAFIKSIRGSDPDATLYWLANMVEAGEDPNFIFRRLLISACEDIGLADPNAIVVVQSCCDAFDRVGFPEGLFFLSQASLYLAISPKSNSTKSIFKAMEAIKLVPNHLKNNASNYLNPHNYLQQEYLPTDLIKFWKPKGWEKNKY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of a putative AAA family ATPase from Prochlorococcus marinus subsp. pastoris.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Prochlorococcus marinus subsp. pastoris str. ccmp1986
|
molecule keywords |
Putative ATPase, AAA family
|
total genus |
51
|
structure length |
150
|
sequence length |
163
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2008-04-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12002 | MgsA_C | MgsA AAA+ ATPase C terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | post-AAA+ oligomerization domain-like | DNA polymerase III clamp loader subunits, C-terminal domain | ||
Mainly Alpha | Up-down Bundle | Zinc Finger, Delta Prime; domain 3 | Zinc Finger, Delta Prime; domain 3 |
#chains in the Genus database with same CATH superfamily 2QW6 A; 3GLH E; 3GLH B; 3GLG A; 3GLI E; 1XXH E; 3GLI B; 1XXH B; 1JQJ C; 1SXJ C; 3GLF E; 3GLF B; 2CHV A; 2R9G A; 1JR3 E; 3GLH A; 3GLI A; 1XXH A; 3PVS A; 3GLF A; 1JR3 D; 1A5T A; 3CTD A; 2CHQ A; 3U5Z B; 1IQP A; 1SXJ E; 1SXJ B; 2GNO A; 3ZH9 B; 3GLG E; 3GLG B; 1JR3 A; 1SXJ D; 3U61 B; 3U60 B; 3BGE A; 1SXJ A; #chains in the Genus database with same CATH topology 2QW6 A; 3GLH E; 3ES5 A; 3GLH B; 3GLG A; 3GLI E; 1XXH E; 3GLI B; 1XXH B; 1JQJ C; 1SXJ C; 3GLF E; 3U61 A; 3GLF B; 2CHV A; 2R9G A; 3U60 A; 1JR3 E; 3GLH A; 3GLI A; 1XXH A; 3PVS A; 1MW5 A; 3RC3 A; 1JR3 D; 1A5T A; 3CTD A; 2CHQ A; 3GLF A; 3U5Z B; 1IQP A; 1SXJ E; 1SXJ B; 2GNO A; 3ZH9 B; 4CHD A; 3GLG E; 3GLG B; 1JR3 A; 3RC8 A; 1SXJ D; 3U61 B; 3U5Z A; 3U60 B; 3BGE A; 1SXJ A; #chains in the Genus database with same CATH homology 2QW6 A; 3GLH E; 3ES5 A; 3GLH B; 3GLG A; 3GLI E; 1XXH E; 3GLI B; 1XXH B; 1JQJ C; 1SXJ C; 3GLF E; 3U61 A; 3GLF B; 2CHV A; 2R9G A; 3U60 A; 1JR3 E; 3GLH A; 3GLI A; 1XXH A; 3PVS A; 1MW5 A; 3RC3 A; 1JR3 D; 1A5T A; 3CTD A; 2CHQ A; 3GLF A; 3U5Z B; 1IQP A; 1SXJ E; 1SXJ B; 2GNO A; 3ZH9 B; 4CHD A; 3GLG E; 3GLG B; 1JR3 A; 3RC8 A; 1SXJ D; 3U61 B; 3U5Z A; 3U60 B; 3BGE A; 1SXJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...