The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
48
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
HYTWPRVNDGADWQQVRKADNWQDNGYVGDVTSPQIRCFQATPSPAPSVLNTTAGSTVTYWANPDVYHPGPVQFYMARVPDGEDINSWNGDGAVWFKVYEDHPTFGAQLTWPSTGKSSFAVPIPPCIKSGYYLLRAEQIGLHVAQSVGGAQFYISCAQLSVTGGGSTEPPNKVAFPGAYSATDPGILINIYYPVPTSYQNPGPAVFSC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Stimulation of lignocellulosic biomass hydrolysis by proteins of glycoside hydrolase family 61: structure and function of a large, enigmatic family.
pubmed doi rcsb |
| molecule tags |
Unknown function
|
| source organism |
Thielavia terrestris
|
| molecule keywords |
protein GH61E
|
| total genus |
48
|
| structure length |
208
|
| sequence length |
208
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2008-09-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03443 | Glyco_hydro_61 | Glycosyl hydrolase family 61 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2VTC A; 3EJA A; 5ACI A; 4MAI A; 5ACG A; 4EIS A; 5ACF A; 4FMR A; 3EII A; 4EIS B; 5ACH A; 4D7U A; 4D7V A; 3ZUD A; 4QI8 A; 2YET A; 5FOH A; 4B5Q A; 4EIR A; 5ACJ A; 4MAH A; #chains in the Genus database with same CATH topology 1DOA B; 3JUA A; 4OY7 A; 4EIR A; 2R5O A; 5HNO A; 4MAI A; 2JHV A; 3T5I A; 2YOX A; 5E8F A; 5DQE A; 4EIS A; 5L7K A; 4FMR A; 4ALR A; 5ACH A; 2YOW A; 4OY6 A; 3T5G B; 4OY8 A; 5F2U A; 1FST A; 5ACJ A; 4ALE A; 4JV8 B; 2JHZ A; 5ACI A; 4ALS A; 2LHS A; 3L15 A; 1KMT A; 1HH4 D; 2JHS A; 5FJQ A; 1GDF A; 1FT0 A; 3UAM A; 1RHO A; 2JI0 A; 4JHP B; 4F38 B; 4D7V A; 2BEN A; 2JHU A; 4JVB B; 4B5Q A; 1KSH B; 3KYS A; 4ALT A; 5IJU A; 4ALQ A; 4MAH A; 5HNP A; 4A02 A; 2VTC A; 3EJA A; 1KSJ B; 1AJW A; 2BXW A; 2BEM A; 5ACG A; 2XWX A; 1FSO A; 1FT3 A; 5FTZ A; 5TAR B; 5ACF A; 4GOJ C; 3EII A; 4EIS B; 5EMW A; 3ZUD A; 4ALC A; 2YET A; 3RBQ A; 4GBO A; 2JHW A; 4RE1 A; 5E80 A; 5HGU A; 2YOY A; 5AA7 A; 2JHY A; 1DS6 B; 1QVY A; 2JHT A; 4GOK C; 2JHX A; 5DQ8 A; 5EMV A; 4JVF B; 4D7U A; 3GQQ A; 4QI8 A; 4JV6 B; 5FOH A; 1KSG B; 5TB5 B; 4LN0 A; #chains in the Genus database with same CATH homology 2VTC A; 3JUA A; 3EJA A; 5HGU A; 4EIR A; 5ACI A; 4MAI A; 5ACG A; 3L15 A; 4EIS A; 5DQE A; 5ACF A; 4FMR A; 3EII A; 5EMV A; 5DQ8 A; 5EMW A; 4EIS B; 5ACH A; 4D7U A; 4D7V A; 3ZUD A; 4QI8 A; 2YET A; 5FOH A; 4B5Q A; 3KYS A; 5ACJ A; 4LN0 A; 4RE1 A; 4MAH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
