The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
source organism |
Homo sapiens
|
publication title |
Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
pubmed doi rcsb |
molecule keywords |
Calcitonin gene-related peptide type 1 receptor
|
total genus |
18
|
structure length |
100
|
sequence length |
100
|
chains with identical sequence |
B, C, J
|
ec nomenclature | |
pdb deposition date | 2010-05-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02793 | HRM | Hormone receptor domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Hormone receptor fold | GPCR, family 2, extracellular hormone receptor domain |
#chains in the Genus database with same CATH superfamily 4DLO A; 4HJ0 A; 3EHT A; 4DLQ A; 3IOL A; 2JNC A; 2JND A; 3N7R A; 2XDG A; 3C59 A; 4ZGM A; 2L27 A; 5II0 A; 3N7P A; 3AQF B; 3H3G A; 3L2J A; 4LF3 C; 4ERS A; 2JOD A; 1U34 A; 3C5T A; 3N7S A; 3C4M A; 3EHU A; 3EHS A; 2QKH A; #chains in the Genus database with same CATH topology 4DLO A; 4HJ0 A; 3EHT A; 4DLQ A; 3IOL A; 2JNC A; 2JND A; 3N7R A; 2XDG A; 3C59 A; 4ZGM A; 2L27 A; 5II0 A; 3N7P A; 3AQF B; 3H3G A; 3L2J A; 4LF3 C; 4ERS A; 2JOD A; 1U34 A; 3C5T A; 3N7S A; 3C4M A; 3EHU A; 3EHS A; 2QKH A; #chains in the Genus database with same CATH homology 4DLO A; 4HJ0 A; 3EHT A; 4DLQ A; 3IOL A; 2JNC A; 2JND A; 3N7R A; 2XDG A; 3C59 A; 4ZGM A; 2L27 A; 5II0 A; 3N7P A; 3AQF B; 3H3G A; 3L2J A; 4LF3 C; 4ERS A; 2JOD A; 1U34 A; 3C5T A; 3N7S A; 3C4M A; 3EHU A; 3EHS A; 2QKH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...