3N7S | Genus

Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	24
sequence length	97
structure length	94
Chain Sequence	IQLGVTRNKIMTAQYECYQKIMQDPIEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCN

Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__6942565530585565__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__6942565530585565__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/3N7S/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__6942565530585565__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"6942565530585565","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/3N7S/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__6942565530585565__ ready

script 1 started

platformSpeed = 8

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

publication title	Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism. pubmed doi rcsb
molecule keywords	Calcitonin gene-related peptide type 1 receptor
molecule tags	Membrane protein
source organism	Homo sapiens
total genus	24
structure length	94
sequence length	97
chains with identical sequence	B
ec nomenclature
pdb deposition date	2010-05-27

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF02793	HRM	Hormone receptor domain

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
4.10.1240.10	Few Secondary Structures	Irregular	Hormone receptor fold	GPCR, family 2, extracellular hormone receptor domain	3n7sA00

4LF3C 3N7SA 2XDGA 2L27A 4DLQA 3EHUA 3C4MA 3N7RA 3H3GA 3C59A 3EHSA 5II0A 1U34A 2JNCA 3EHTA 2QKHA 4ERSA 3L2JA 4ZGMA 4DLOA 3N7PA 2JODA 3AQFB 2JNDA 4HJ0A 3IOLA 3C5TA
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 4LF3 C;  3N7S A;  2XDG A;  2L27 A;  4DLQ A;  3EHU A;  3C4M A;  3N7R A;  3H3G A;  3C59 A;  3EHS A;  5II0 A;  1U34 A;  2JNC A;  3EHT A;  2QKH A;  4ERS A;  3L2J A;  4ZGM A;  4DLO A;  3N7P A;  2JOD A;  3AQF B;  2JND A;  4HJ0 A;  3IOL A;  3C5T A; 
#chains in the Genus database with same CATH topology
 4LF3 C;  3N7S A;  2XDG A;  2L27 A;  4DLQ A;  3EHU A;  3C4M A;  3N7R A;  3H3G A;  3C59 A;  3EHS A;  5II0 A;  1U34 A;  2JNC A;  3EHT A;  2QKH A;  4ERS A;  3L2J A;  4ZGM A;  4DLO A;  3N7P A;  2JOD A;  3AQF B;  2JND A;  4HJ0 A;  3IOL A;  3C5T A; 
#chains in the Genus database with same CATH homology
 4LF3 C;  3N7S A;  2XDG A;  2L27 A;  4DLQ A;  3EHU A;  3C4M A;  3N7R A;  3H3G A;  3C59 A;  3EHS A;  5II0 A;  1U34 A;  2JNC A;  3EHT A;  2QKH A;  4ERS A;  3L2J A;  4ZGM A;  4DLO A;  3N7P A;  2JOD A;  3AQF B;  2JND A;  4HJ0 A;  3IOL A;  3C5T A;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

3N7SA

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN

pfam database annotations