The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
127
|
structure length |
122
|
Chain Sequence |
LKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSEAAEAAIQVEVLENLQSV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of mutant forms of the yeast f1 ATPase reveal two modes of uncoupling.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
ATP synthase subunit alpha
|
| total genus |
14
|
| structure length |
122
|
| sequence length |
127
|
| chains with identical sequence |
Q
|
| ec nomenclature | |
| pdb deposition date | 2010-08-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| H | PF02823 | ATP-synt_DE_N | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | ATP Synthase; domain 1 | F0F1 ATP synthase delta/epsilon subunit, N-terminal |
#chains in the Genus database with same CATH superfamily 5FL7 H; 3OE7 H; 2XND H; 3OFN H; 2HLD H; 5DN6 I; 3OAA H; 1FS0 E; 2V7Q H; 2QE7 H; 2XOK H; 3FKS H; 1BSH A; 1BSN A; 1E79 H; 4ASU H; 2RQ7 A; 4YXW H; 2RQ6 A; 2E5Y A; 1H8E H; 3OEH H; 2WSS H; 1AQT A; #chains in the Genus database with same CATH topology 5FL7 H; 3OE7 H; 2XND H; 3OFN H; 2HLD H; 5DN6 I; 3OAA H; 1FS0 E; 2V7Q H; 2QE7 H; 2XOK H; 3FKS H; 1BSH A; 1BSN A; 1E79 H; 4ASU H; 2RQ7 A; 4YXW H; 2RQ6 A; 2E5Y A; 1H8E H; 3OEH H; 2WSS H; 1AQT A; #chains in the Genus database with same CATH homology 5FL7 H; 3OE7 H; 2XND H; 3OFN H; 2HLD H; 5DN6 I; 3OAA H; 1FS0 E; 2V7Q H; 2QE7 H; 2XOK H; 3FKS H; 1BSH A; 1BSN A; 1E79 H; 4ASU H; 2RQ7 A; 4YXW H; 2RQ6 A; 2E5Y A; 1H8E H; 3OEH H; 2WSS H; 1AQT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
